Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|758
Gene name
LocationContig_115:58714..60239
Strand+
Gene length (bp)1525
Transcript length (bp)1242
Coding sequence length (bp)1242
Protein length (aa) 414

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 4.4E-20 247 386

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 75 398 2.0E-44
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 75 398 3.0E-43
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 76 396 3.0E-30
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 76 396 4.0E-29
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 231 392 3.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 75 398 2.0E-44
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 75 398 3.0E-43
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 76 396 3.0E-30
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 76 396 4.0E-29
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 231 392 3.0E-19
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 248 386 3.0E-17
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 248 386 2.0E-16
sp|Q7XB11|4OMT1_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 1 OS=Papaver somniferum GN=4'OMT1 PE=2 SV=1 235 395 2.0E-15
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 188 385 1.0E-14
sp|Q54GZ0|OMT9_DICDI O-methyltransferase 9 OS=Dictyostelium discoideum GN=omt9 PE=3 SV=1 248 397 1.0E-14
sp|Q7XB10|4OMT2_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 2 OS=Papaver somniferum GN=4'OMT2 PE=1 SV=1 81 395 2.0E-14
sp|P16559|TCMN_STRGA Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN OS=Streptomyces glaucescens GN=tcmN PE=1 SV=2 248 384 7.0E-14
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 248 386 2.0E-13
sp|Q54S95|OMT7_DICDI O-methyltransferase 7 OS=Dictyostelium discoideum GN=omt7 PE=3 SV=1 248 395 6.0E-13
sp|C7SDN9|N7OMT_PAPSO Norreticuline-7-O-methyltransferase OS=Papaver somniferum PE=1 SV=1 248 385 8.0E-13
sp|Q8GSN1|MOMT_CATRO Myricetin O-methyltransferase OS=Catharanthus roseus PE=1 SV=1 100 396 2.0E-11
sp|B0EXJ8|HTOMT_CATRO Tabersonine 16-O-methyltransferase OS=Catharanthus roseus GN=16OMT PE=1 SV=1 246 396 1.0E-10
sp|Q38J50|FOMT2_WHEAT Tricetin 3',4',5'-O-trimethyltransferase OS=Triticum aestivum GN=OMT2 PE=1 SV=1 231 351 8.0E-10
sp|Q86I40|OMT4_DICDI O-methyltransferase 4 OS=Dictyostelium discoideum GN=omt4 PE=3 SV=1 248 395 9.0E-10
sp|P45986|IMT1_MESCR Inositol 4-methyltransferase OS=Mesembryanthemum crystallinum GN=IMT1 PE=1 SV=1 200 395 2.0E-09
sp|O95671|ASML_HUMAN N-acetylserotonin O-methyltransferase-like protein OS=Homo sapiens GN=ASMTL PE=1 SV=3 250 385 2.0E-09
sp|Q8T638|DMTA_DICDI Des-methyl DIF-1 methyltransferase A OS=Dictyostelium discoideum GN=dmtA PE=1 SV=1 248 385 3.0E-09
sp|Q9LEL5|4OMT_COPJA 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase OS=Coptis japonica PE=1 SV=1 199 395 6.0E-09
sp|Q8H9A8|COOMT_COPJA Columbamine O-methyltransferase OS=Coptis japonica PE=1 SV=1 182 384 6.0E-09
sp|P42712|DMPM_STRAD O-demethylpuromycin-O-methyltransferase OS=Streptomyces alboniger GN=dmpM PE=3 SV=1 106 395 7.0E-09
sp|B0CN39|SFMM3_STRLA O-methyltransferase SfmM3 OS=Streptomyces lavendulae GN=sfmM3 PE=3 SV=1 95 395 7.0E-09
sp|P93324|CHOMT_MEDSA Isoliquiritigenin 2'-O-methyltransferase OS=Medicago sativa PE=1 SV=1 248 383 2.0E-08
sp|Q6WUC2|7OMT_PAPSO (R,S)-reticuline 7-O-methyltransferase OS=Papaver somniferum GN=7OMT PE=1 SV=1 207 386 3.0E-08
sp|Q9LEL6|6OMT_COPJA (RS)-norcoclaurine 6-O-methyltransferase OS=Coptis japonica PE=1 SV=1 248 395 3.0E-08
sp|P28002|COMT1_MEDSA Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1 248 395 6.0E-08
sp|A8J6X1|BMT_GLELI Bergaptol O-methyltransferase OS=Glehnia littoralis GN=BMT PE=1 SV=1 248 394 1.0E-07
sp|Q6VMW0|Q8OMT_MENPI 8-hydroxyquercetin 8-O-methyltransferase OS=Mentha piperita GN=OMT2 PE=1 SV=1 305 384 2.0E-07
sp|Q84KK5|D7OMT_GLYEC Isoflavone 7-O-methyltransferase OS=Glycyrrhiza echinata GN=D7OMT PE=1 SV=1 248 395 2.0E-07
sp|Q9FQY8|COMT1_CAPAN Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2 248 383 2.0E-07
sp|Q9FK25|OMT1_ARATH Flavone 3'-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1 248 353 3.0E-07
sp|Q06509|COMT1_MAIZE Caffeic acid 3-O-methyltransferase OS=Zea mays PE=3 SV=1 231 357 4.0E-07
sp|D5AP78|CRTF_RHOCB Demethylspheroidene O-methyltransferase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=crtF PE=1 SV=1 234 410 4.0E-07
sp|O23760|COMT1_CLABR Caffeic acid 3-O-methyltransferase OS=Clarkia breweri GN=COMT PE=1 SV=1 248 351 5.0E-07
sp|Q43047|COMT3_POPKI Caffeic acid 3-O-methyltransferase 3 OS=Populus kitakamiensis GN=HOMT3 PE=3 SV=1 200 351 5.0E-07
sp|Q41086|COMT2_POPTM Caffeic acid 3-O-methyltransferase 2 OS=Populus tremuloides GN=OMT2 PE=3 SV=1 246 351 5.0E-07
sp|Q92056|ASMT_CHICK Acetylserotonin O-methyltransferase OS=Gallus gallus GN=ASMT PE=2 SV=1 277 400 6.0E-07
sp|O81646|COMT1_CAPCH Caffeic acid 3-O-methyltransferase OS=Capsicum chinense GN=COMT PE=2 SV=1 248 351 7.0E-07
sp|Q54B60|OMT11_DICDI Probable inactive O-methyltransferase 11 OS=Dictyostelium discoideum GN=omt11 PE=3 SV=1 248 399 7.0E-07
sp|Q42653|OMT2_CHRAE Quercetin 3-O-methyltransferase 2 OS=Chrysosplenium americanum GN=OMT2 PE=1 SV=1 248 396 8.0E-07
sp|O04385|IEMT_CLABR (Iso)eugenol O-methyltransferase OS=Clarkia breweri GN=IEMT1 PE=1 SV=2 248 383 9.0E-07
sp|P59049|OMT1_CHRAE Quercetin 3-O-methyltransferase 1 OS=Chrysosplenium americanum GN=OMT1 PE=1 SV=1 248 396 9.0E-07
sp|Q43046|COMT1_POPKI Caffeic acid 3-O-methyltransferase 1 OS=Populus kitakamiensis GN=HOMT1 PE=3 SV=1 248 391 1.0E-06
sp|P46484|COMT1_EUCGU Caffeic acid 3-O-methyltransferase OS=Eucalyptus gunnii GN=OMT PE=2 SV=1 248 393 1.0E-06
sp|Q43609|COMT1_PRUDU Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1 248 351 2.0E-06
sp|Q8GU25|COMT1_ROSCH Caffeic acid 3-O-methyltransferase OS=Rosa chinensis GN=COMT1 PE=2 SV=1 248 392 2.0E-06
sp|B3GSH5|ASMT_RAT Acetylserotonin O-methyltransferase OS=Rattus norvegicus GN=Asmt PE=1 SV=1 248 390 5.0E-06
sp|Q93WU2|EOMT1_OCIBA Eugenol O-methyltransferase OS=Ocimum basilicum GN=EOMT1 PE=1 SV=1 199 395 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0008168 methyltransferase activity No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup30
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7767
Ophiocordyceps australis 1348a (Ghana) OphauG2|7346
Ophiocordyceps australis 1348a (Ghana) OphauG2|7110
Ophiocordyceps australis 1348a (Ghana) OphauG2|4885
Ophiocordyceps australis 1348a (Ghana) OphauG2|4306
Ophiocordyceps australis 1348a (Ghana) OphauG2|3956
Ophiocordyceps australis 1348a (Ghana) OphauG2|1539
Ophiocordyceps australis 1348a (Ghana) OphauG2|1895
Ophiocordyceps australis 1348a (Ghana) OphauG2|266
Ophiocordyceps australis map64 (Brazil) OphauB2|758 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1462
Ophiocordyceps australis map64 (Brazil) OphauB2|2012
Ophiocordyceps australis map64 (Brazil) OphauB2|4017
Ophiocordyceps australis map64 (Brazil) OphauB2|4564
Ophiocordyceps australis map64 (Brazil) OphauB2|7299
Ophiocordyceps camponoti-rufipedis Ophun1|2861
Ophiocordyceps camponoti-rufipedis Ophun1|2000
Ophiocordyceps subramaniannii Hirsu2|8115
Ophiocordyceps subramaniannii Hirsu2|7926
Ophiocordyceps subramaniannii Hirsu2|6259
Ophiocordyceps subramaniannii Hirsu2|2878
Ophiocordyceps subramaniannii Hirsu2|1201
Ophiocordyceps subramaniannii Hirsu2|11082

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|758
MTATRAIDGSVANTPSNLEALPELLKQVCHGVAALTAGEKVDRHNLIAKCRAMTMAIETPRETMVEHCVILSSTI
AAISFGIDIGLWNLMVRNGDGAQRVSDLAASLGVDAILLGRMMRHLGATGHITETASEEYQPTTFSKSLSLPRVA
SGYRYISATASSTFSFGDFCRQQAWKLPAPDKRSYFQCIHDTDLDFFAWFQQRGYGPDFNHLMGGFFMGRVPWMG
PGYYPVQERLIDGADTCPDAAFLVDIGGNVGHSLADLKHHYPQLPGNLILEDLPAVINQIEHLDPSIIRIPYDFH
TEQPIKGARAYFMRAILHDWSDQACLSILARIKTAMKPGYSRLLINELVIPPTGVYHEATALDLQLMVLLSSWER
TRSQWHDLLENRAGLRIMRIWDSGRADSDNLIECELVA*
Coding >OphauB2|758
ATGACTGCGACACGTGCCATTGACGGCTCCGTTGCCAACACGCCAAGCAATCTTGAAGCACTCCCCGAGCTGCTC
AAACAAGTGTGTCATGGCGTTGCGGCTCTTACGGCTGGTGAAAAGGTTGATCGCCATAATCTCATTGCCAAGTGT
CGTGCCATGACCATGGCTATAGAGACACCGAGAGAAACCATGGTGGAACACTGTGTAATCCTGAGTTCTACTATT
GCGGCGATTAGCTTCGGCATTGATATCGGGCTATGGAACCTAATGGTTAGAAATGGTGACGGGGCCCAGCGTGTG
AGCGACTTGGCTGCCAGTCTAGGCGTCGATGCCATTCTCCTAGGTCGAATGATGCGGCATCTAGGCGCCACGGGC
CACATCACCGAGACTGCTTCGGAAGAATACCAGCCCACCACCTTTTCCAAGTCTCTATCCTTGCCCCGCGTAGCA
AGTGGCTACCGATACATTTCAGCCACCGCATCAAGCACCTTTAGCTTTGGCGACTTTTGCCGCCAACAAGCATGG
AAGCTGCCCGCGCCCGACAAGAGATCCTACTTCCAATGTATTCACGACACTGACCTAGACTTTTTCGCCTGGTTT
CAGCAGCGCGGCTACGGACCCGACTTTAACCACCTCATGGGCGGCTTCTTCATGGGCCGCGTGCCGTGGATGGGG
CCGGGCTACTACCCCGTCCAGGAGCGCTTGATTGACGGTGCTGATACTTGTCCCGATGCAGCATTCCTCGTCGAC
ATTGGCGGCAACGTGGGCCATAGTCTGGCGGATCTGAAGCATCACTATCCACAGCTGCCCGGCAACTTGATTCTT
GAGGATCTGCCCGCCGTAATCAACCAGATTGAGCATCTCGACCCCTCCATTATTCGCATCCCCTACGACTTTCAC
ACTGAGCAGCCCATCAAAGGTGCTCGAGCCTACTTTATGCGCGCCATCTTGCACGACTGGTCAGACCAAGCATGT
CTAAGCATCCTTGCTCGCATAAAGACGGCCATGAAGCCCGGATACAGCAGGCTCCTCATCAATGAGCTCGTTATC
CCGCCTACCGGTGTCTACCATGAGGCCACGGCGCTCGATTTACAGCTCATGGTGCTCTTGTCCTCGTGGGAGAGG
ACTCGGAGCCAATGGCATGATTTGCTGGAGAACAGGGCAGGGCTGAGAATCATGCGCATCTGGGACAGTGGGCGC
GCGGATTCGGACAACTTGATTGAGTGTGAGCTGGTTGCATGA
Transcript >OphauB2|758
ATGACTGCGACACGTGCCATTGACGGCTCCGTTGCCAACACGCCAAGCAATCTTGAAGCACTCCCCGAGCTGCTC
AAACAAGTGTGTCATGGCGTTGCGGCTCTTACGGCTGGTGAAAAGGTTGATCGCCATAATCTCATTGCCAAGTGT
CGTGCCATGACCATGGCTATAGAGACACCGAGAGAAACCATGGTGGAACACTGTGTAATCCTGAGTTCTACTATT
GCGGCGATTAGCTTCGGCATTGATATCGGGCTATGGAACCTAATGGTTAGAAATGGTGACGGGGCCCAGCGTGTG
AGCGACTTGGCTGCCAGTCTAGGCGTCGATGCCATTCTCCTAGGTCGAATGATGCGGCATCTAGGCGCCACGGGC
CACATCACCGAGACTGCTTCGGAAGAATACCAGCCCACCACCTTTTCCAAGTCTCTATCCTTGCCCCGCGTAGCA
AGTGGCTACCGATACATTTCAGCCACCGCATCAAGCACCTTTAGCTTTGGCGACTTTTGCCGCCAACAAGCATGG
AAGCTGCCCGCGCCCGACAAGAGATCCTACTTCCAATGTATTCACGACACTGACCTAGACTTTTTCGCCTGGTTT
CAGCAGCGCGGCTACGGACCCGACTTTAACCACCTCATGGGCGGCTTCTTCATGGGCCGCGTGCCGTGGATGGGG
CCGGGCTACTACCCCGTCCAGGAGCGCTTGATTGACGGTGCTGATACTTGTCCCGATGCAGCATTCCTCGTCGAC
ATTGGCGGCAACGTGGGCCATAGTCTGGCGGATCTGAAGCATCACTATCCACAGCTGCCCGGCAACTTGATTCTT
GAGGATCTGCCCGCCGTAATCAACCAGATTGAGCATCTCGACCCCTCCATTATTCGCATCCCCTACGACTTTCAC
ACTGAGCAGCCCATCAAAGGTGCTCGAGCCTACTTTATGCGCGCCATCTTGCACGACTGGTCAGACCAAGCATGT
CTAAGCATCCTTGCTCGCATAAAGACGGCCATGAAGCCCGGATACAGCAGGCTCCTCATCAATGAGCTCGTTATC
CCGCCTACCGGTGTCTACCATGAGGCCACGGCGCTCGATTTACAGCTCATGGTGCTCTTGTCCTCGTGGGAGAGG
ACTCGGAGCCAATGGCATGATTTGCTGGAGAACAGGGCAGGGCTGAGAATCATGCGCATCTGGGACAGTGGGCGC
GCGGATTCGGACAACTTGATTGAGTGTGAGCTGGTTGCATGA
Gene >OphauB2|758
ATGACTGCGACACGTGCCATTGACGGCTCCGTTGCCAACACGCCAAGCAATCTTGAAGCACTCCCCGAGCTGCTC
AAACAAGTGTGTCATGGCGTTGCGGCTCTTACGGCTGGTGAAAAGGTTGATCGCCATAATCTCATTGCCAAGTGT
CGTGCCATGACCATGGCTATAGAGACACCGAGAGAAACCATGGTGGAACACTGTGTAATCCTGGTGAGTGCCATG
GCAAGGAAATCAAGACTGCCATTTTCTCGCATACTGACTGGGCAGAGTTCTACTATTGCGGCGATTAGCTTCGGC
ATTGATATCGGGCTATGGAACCTAATGGTTAGAAATGGTGACGGGGCCCAGCGTGTGAGCGACTTGGCTGCCAGT
CTAGGCGTCGATGCCATTCTCCTAGGCAAGTCTCGACTATACTCTACTAACCGCACCACGACCCCAAGCGAGTTG
CAAATCAGGTCTAACCCGCTACATCACTACAGGTCGAATGATGCGGCATCTAGGCGCCACGGGCCACATCACCGA
GACTGCTTCGGAAGAATACCAGCCCACCACCTTTTCCAAGTCTCTATCCTTGCCCCGCGTAGCAAGTGGCTACCG
ATAGTACGCACACGCTTCTTTTCTTCTATCAAACAGCCTATATCACTCTTTGCTCTACTTACTCACTCCTGGATA
GCATTTCAGCCACCGCATCAAGCACCTTTAGCTTTGGCGACTTTTGCCGCCAACAAGCATGGAAGCTGCCCGCGC
CCGACAAGAGATCCTACTTCCAATGTATTCACGACACTGACCTAGACTTTTTCGCCTGGTTTCAGCAGCGCGGCT
ACGGACCCGACTTTAACCACCTCATGGGCGGCTTCTTCATGGGCCGCGTGCCGTGGATGGGGCCGGGCTACTACC
CCGTCCAGGAGCGCTTGATTGACGGTGCTGATACTTGTCCCGATGCAGCATTCCTCGTCGACATTGGCGGCAACG
TGGGCCATAGTCTGGCGGATCTGAAGCATCACTATCCACAGCTGCCCGGCAACTTGATTCTTGAGGATCTGCCCG
CCGTAATCAACCAGATTGAGCATCTCGACCCCTCCATTATTCGCATCCCCTACGACTTTCACACTGAGCAGCCCA
TCAAAGGTGAAGAAACCACTCTCCTATTCTGCACGTTTGTCCTTGTAGCGCCTGCTTACCTCTGCCTTGCACACC
AGGTGCTCGAGCCTACTTTATGCGCGCCATCTTGCACGACTGGTCAGACCAAGCATGTCTAAGCATCCTTGCTCG
CATAAAGACGGCCATGAAGCCCGGATACAGCAGGCTCCTCATCAATGAGCTCGTTATCCCGCCTACCGGTGTCTA
CCATGAGGCCACGGCGCTCGATTTACAGCTCATGGTGCTCTTGTCCTCGTGGGAGAGGACTCGGAGCCAATGGCA
TGATTTGCTGGAGAACAGGGCAGGGCTGAGAATCATGCGCATCTGGGACAGTGGGCGCGCGGATTCGGACAACTT
GATTGAGTGTGAGCTGGTTGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail