Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7579
Gene name
LocationContig_82:31007..32692
Strand+
Gene length (bp)1685
Transcript length (bp)1626
Coding sequence length (bp)1626
Protein length (aa) 542

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03473 MOSC MOSC domain 8.8E-19 49 155
PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain 4.0E-12 469 530

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P76254|YEAX_ECOLI Putative dioxygenase subunit beta YeaX OS=Escherichia coli (strain K12) GN=yeaX PE=3 SV=1 239 535 5.0E-37
sp|Q05182|PHT2_PSEPU Phthalate 4,5-dioxygenase oxygenase reductase subunit OS=Pseudomonas putida GN=pht2 PE=2 SV=1 268 532 1.0E-34
sp|O24840|VANB_ACIAD Vanillate O-demethylase oxidoreductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=vanB PE=3 SV=1 259 538 2.0E-33
sp|H9N291|NDMD_PSEPU Oxidoreductase NdmD OS=Pseudomonas putida GN=ndmD PE=3 SV=1 245 531 3.0E-33
sp|O54037|VANB_PSEPU Vanillate O-demethylase oxidoreductase OS=Pseudomonas putida GN=vanB PE=3 SV=1 245 531 8.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P76254|YEAX_ECOLI Putative dioxygenase subunit beta YeaX OS=Escherichia coli (strain K12) GN=yeaX PE=3 SV=1 239 535 5.0E-37
sp|Q05182|PHT2_PSEPU Phthalate 4,5-dioxygenase oxygenase reductase subunit OS=Pseudomonas putida GN=pht2 PE=2 SV=1 268 532 1.0E-34
sp|O24840|VANB_ACIAD Vanillate O-demethylase oxidoreductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=vanB PE=3 SV=1 259 538 2.0E-33
sp|H9N291|NDMD_PSEPU Oxidoreductase NdmD OS=Pseudomonas putida GN=ndmD PE=3 SV=1 245 531 3.0E-33
sp|O54037|VANB_PSEPU Vanillate O-demethylase oxidoreductase OS=Pseudomonas putida GN=vanB PE=3 SV=1 245 531 8.0E-30
sp|P33164|PDR_BURCE Phthalate dioxygenase reductase OS=Burkholderia cepacia GN=ophA1 PE=1 SV=3 265 532 2.0E-29
sp|P12580|VANB_PSES9 Vanillate O-demethylase oxidoreductase OS=Pseudomonas sp. (strain ATCC 19151) GN=vanB PE=3 SV=1 250 531 6.0E-28
sp|Q52186|POBB_PSEPS Phenoxybenzoate dioxygenase subunit beta OS=Pseudomonas pseudoalcaligenes GN=pobB PE=2 SV=1 272 530 6.0E-28
sp|P94680|TSAB1_COMTE Toluene-4-sulfonate monooxygenase system reductase subunit TsaB1 OS=Comamonas testosteroni GN=tsaB1 PE=1 SV=1 268 540 1.0E-24
sp|Q9AHG2|TSAB2_COMTE Putative toluene-4-sulfonate monooxygenase system reductase subunit TsaB2 OS=Comamonas testosteroni GN=tsaB2 PE=5 SV=1 268 540 1.0E-24
sp|O05617|VANB_PSEUH Vanillate O-demethylase oxidoreductase OS=Pseudomonas sp. (strain HR199 / DSM 7063) GN=vanB PE=3 SV=1 258 531 1.0E-22
sp|Q44257|CBAB_COMTE 3-chlorobenzoate-3,4-dioxygenase reductase subunit OS=Comamonas testosteroni GN=cbaB PE=3 SV=2 244 534 2.0E-21
sp|P43976|Y278_HAEIN Uncharacterized protein HI_0278 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0278 PE=3 SV=2 27 211 5.0E-21
sp|O34542|YFLK_BACSU Uncharacterized protein YflK OS=Bacillus subtilis (strain 168) GN=yflK PE=3 SV=1 51 208 2.0E-14
sp|P32157|YIIM_ECOLI Protein YiiM OS=Escherichia coli (strain K12) GN=yiiM PE=1 SV=2 32 159 8.0E-14
sp|P9WJ93|KSHB_MYCTU 3-ketosteroid-9-alpha-hydroxylase reductase subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=hmp PE=1 SV=1 245 531 9.0E-12
sp|P9WJ92|KSHB_MYCTO 3-ketosteroid-9-alpha-hydroxylase reductase subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=hmp PE=3 SV=1 245 531 9.0E-12
sp|Q7TTP0|HMP_BORPE Flavohemoprotein OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=hmp PE=3 SV=1 240 451 4.0E-11
sp|Q7TTP2|HMP_BORPA Flavohemoprotein OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=hmp PE=3 SV=1 240 451 4.0E-11
sp|Q7WHW5|HMP_BORBR Flavohemoprotein OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=hmp PE=3 SV=1 240 451 4.0E-11
sp|P76081|PAAE_ECOLI 1,2-phenylacetyl-CoA epoxidase, subunit E OS=Escherichia coli (strain K12) GN=paaE PE=1 SV=1 240 509 1.0E-10
sp|Q9I0H4|HMP_PSEAE Flavohemoprotein OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hmp PE=3 SV=1 241 457 9.0E-10
sp|Q88PP0|HMP_PSEPK Flavohemoprotein OS=Pseudomonas putida (strain KT2440) GN=hmp PE=3 SV=1 236 454 9.0E-09
sp|Q9RC40|HMP_BACHD Flavohemoprotein OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hmp PE=3 SV=1 240 456 9.0E-08
sp|Q9UAG7|FHBA_DICDI Flavohemoprotein A OS=Dictyostelium discoideum GN=fhbA PE=2 SV=1 236 451 1.0E-07
sp|A0R525|KSHB_MYCS2 3-ketosteroid-9-alpha-hydroxylase reductase subunit OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=kshB PE=3 SV=1 245 528 3.0E-07
sp|Q9RYR5|HMP_DEIRA Flavohemoprotein OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=hmp PE=3 SV=1 236 455 4.0E-07
sp|Q7NSD8|HMP_CHRVO Flavohemoprotein OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=hmp PE=3 SV=1 240 458 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0051536 iron-sulfur cluster binding Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0030151 molybdenum ion binding Yes
GO:0003824 catalytic activity Yes
GO:0043168 anion binding No
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0043167 ion binding No
GO:0019842 vitamin binding No
GO:1901363 heterocyclic compound binding No
GO:0051540 metal cluster binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0070279 vitamin B6 binding No
GO:0046872 metal ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7579
MKTDKLVEVRRRVLDRLAEDNVQSGSRRVESLQINMGGVEGEEHQGAFEMGPDKAVLAYCSSHYATWRRLYGEQA
GQFVAGSFGENFVVAGMSESSVCIGDVVSVGGSVRLQVSLPRQASGRLRRRLGIGAGGCMAGWYYRVVQAGTVYA
GDEVRVEERPWPQWTVERVQECLEGGQDEGGQDNGEAIEQLAGLEALGEESRGQFRKRARQRASQRARQRAGMGE
QQWRQQWRQQWRQQWREYRVVRRSMETRRIVSLVLEAVEAEAPTTRAGWHVRIKLPNGMERSFSVVGASAQRFEV
GIALNDNSRGASRYLHERVGEGDVLQVGHMRHQAAWAVSTSHHCFISGGIGITGLLALLSHSQAAGLDYTLHYAV
RSVAETPFRDRLQPLAQHTVTYDKSRGQRMDIAHIVRSLAPNSRLYICGPQSLMQAGRRAVAECAIPPQHVHLDA
FFAPVGGDAFEVQLGPRVLRVEKEASLLQVLRRESLDLPSSCEMGSCGTCRVRLTAGSVEHRGTALLAEEKEESM
LACVSRGIGRISIQLY*
Coding >OphauB2|7579
ATGAAGACGGACAAGTTGGTTGAGGTGCGGAGGAGGGTCTTGGACAGGCTGGCAGAGGACAATGTGCAGAGTGGG
AGTCGACGGGTGGAATCACTGCAAATCAACATGGGGGGCGTCGAGGGAGAGGAGCACCAAGGGGCATTTGAAATG
GGGCCTGACAAGGCTGTTCTCGCCTACTGCTCGAGCCACTATGCGACGTGGAGGAGGCTGTATGGCGAGCAGGCG
GGGCAGTTTGTGGCGGGCAGCTTTGGGGAAAACTTTGTGGTGGCTGGCATGAGCGAGAGCAGCGTGTGCATTGGC
GACGTGGTGTCGGTGGGAGGCTCGGTGCGGCTGCAAGTGTCGCTTCCACGGCAGGCAAGCGGCAGGCTCAGGAGG
CGGCTGGGCATCGGGGCGGGCGGGTGCATGGCGGGATGGTACTACCGGGTGGTGCAGGCGGGGACAGTGTATGCT
GGCGACGAGGTGCGGGTGGAGGAACGACCATGGCCGCAGTGGACGGTGGAGCGGGTGCAAGAGTGTCTCGAGGGC
GGGCAGGACGAGGGCGGGCAGGACAATGGCGAGGCGATAGAGCAGCTGGCGGGGCTGGAGGCGCTGGGGGAGGAG
AGCCGGGGGCAGTTTCGCAAGCGGGCTCGGCAGAGGGCGAGCCAGAGGGCGCGGCAGAGGGCGGGCATGGGCGAG
CAGCAGTGGAGGCAGCAGTGGAGGCAGCAGTGGAGGCAGCAGTGGAGGGAGTACCGGGTGGTGCGGCGCAGCATG
GAGACGAGGCGCATCGTGTCGCTGGTGCTGGAGGCGGTCGAGGCCGAGGCACCGACGACGCGGGCAGGATGGCAC
GTGCGCATCAAGCTGCCCAACGGCATGGAGCGCTCCTTTTCCGTGGTGGGCGCGTCGGCGCAGCGCTTCGAGGTG
GGCATTGCGCTCAACGACAACAGCCGCGGCGCGTCGCGCTACCTGCACGAGAGGGTGGGCGAGGGCGACGTGCTC
CAGGTGGGCCACATGCGCCACCAGGCCGCCTGGGCCGTCAGCACCAGCCACCACTGCTTCATCTCGGGCGGCATC
GGCATCACCGGTCTGCTGGCCCTGCTCAGCCATAGCCAGGCCGCCGGGCTCGACTACACCCTGCACTATGCTGTG
CGCTCCGTCGCCGAGACGCCCTTTCGCGACCGCCTGCAGCCCCTGGCCCAGCACACCGTCACCTACGACAAGTCG
CGCGGCCAGCGAATGGACATTGCCCATATTGTGCGCTCCCTGGCCCCCAACAGCCGCCTATACATTTGCGGGCCC
CAGAGCCTGATGCAGGCCGGCCGCCGCGCCGTTGCCGAGTGCGCCATTCCGCCCCAGCACGTCCATCTCGACGCC
TTTTTTGCCCCCGTCGGCGGCGACGCCTTTGAGGTGCAGCTTGGTCCCCGAGTCCTGCGCGTCGAAAAGGAGGCC
AGTCTGCTCCAGGTGCTGCGTCGCGAGAGCCTCGACCTGCCCTCGAGCTGCGAGATGGGCAGCTGTGGCACCTGT
AGGGTCAGGCTGACGGCCGGAAGCGTTGAGCATCGAGGCACCGCCCTGTTGGCTGAGGAGAAGGAGGAGAGTATG
CTGGCCTGTGTGAGTCGCGGCATTGGCCGCATTTCCATTCAGCTCTACTAG
Transcript >OphauB2|7579
ATGAAGACGGACAAGTTGGTTGAGGTGCGGAGGAGGGTCTTGGACAGGCTGGCAGAGGACAATGTGCAGAGTGGG
AGTCGACGGGTGGAATCACTGCAAATCAACATGGGGGGCGTCGAGGGAGAGGAGCACCAAGGGGCATTTGAAATG
GGGCCTGACAAGGCTGTTCTCGCCTACTGCTCGAGCCACTATGCGACGTGGAGGAGGCTGTATGGCGAGCAGGCG
GGGCAGTTTGTGGCGGGCAGCTTTGGGGAAAACTTTGTGGTGGCTGGCATGAGCGAGAGCAGCGTGTGCATTGGC
GACGTGGTGTCGGTGGGAGGCTCGGTGCGGCTGCAAGTGTCGCTTCCACGGCAGGCAAGCGGCAGGCTCAGGAGG
CGGCTGGGCATCGGGGCGGGCGGGTGCATGGCGGGATGGTACTACCGGGTGGTGCAGGCGGGGACAGTGTATGCT
GGCGACGAGGTGCGGGTGGAGGAACGACCATGGCCGCAGTGGACGGTGGAGCGGGTGCAAGAGTGTCTCGAGGGC
GGGCAGGACGAGGGCGGGCAGGACAATGGCGAGGCGATAGAGCAGCTGGCGGGGCTGGAGGCGCTGGGGGAGGAG
AGCCGGGGGCAGTTTCGCAAGCGGGCTCGGCAGAGGGCGAGCCAGAGGGCGCGGCAGAGGGCGGGCATGGGCGAG
CAGCAGTGGAGGCAGCAGTGGAGGCAGCAGTGGAGGCAGCAGTGGAGGGAGTACCGGGTGGTGCGGCGCAGCATG
GAGACGAGGCGCATCGTGTCGCTGGTGCTGGAGGCGGTCGAGGCCGAGGCACCGACGACGCGGGCAGGATGGCAC
GTGCGCATCAAGCTGCCCAACGGCATGGAGCGCTCCTTTTCCGTGGTGGGCGCGTCGGCGCAGCGCTTCGAGGTG
GGCATTGCGCTCAACGACAACAGCCGCGGCGCGTCGCGCTACCTGCACGAGAGGGTGGGCGAGGGCGACGTGCTC
CAGGTGGGCCACATGCGCCACCAGGCCGCCTGGGCCGTCAGCACCAGCCACCACTGCTTCATCTCGGGCGGCATC
GGCATCACCGGTCTGCTGGCCCTGCTCAGCCATAGCCAGGCCGCCGGGCTCGACTACACCCTGCACTATGCTGTG
CGCTCCGTCGCCGAGACGCCCTTTCGCGACCGCCTGCAGCCCCTGGCCCAGCACACCGTCACCTACGACAAGTCG
CGCGGCCAGCGAATGGACATTGCCCATATTGTGCGCTCCCTGGCCCCCAACAGCCGCCTATACATTTGCGGGCCC
CAGAGCCTGATGCAGGCCGGCCGCCGCGCCGTTGCCGAGTGCGCCATTCCGCCCCAGCACGTCCATCTCGACGCC
TTTTTTGCCCCCGTCGGCGGCGACGCCTTTGAGGTGCAGCTTGGTCCCCGAGTCCTGCGCGTCGAAAAGGAGGCC
AGTCTGCTCCAGGTGCTGCGTCGCGAGAGCCTCGACCTGCCCTCGAGCTGCGAGATGGGCAGCTGTGGCACCTGT
AGGGTCAGGCTGACGGCCGGAAGCGTTGAGCATCGAGGCACCGCCCTGTTGGCTGAGGAGAAGGAGGAGAGTATG
CTGGCCTGTGTGAGTCGCGGCATTGGCCGCATTTCCATTCAGCTCTACTAG
Gene >OphauB2|7579
ATGAAGACGGACAAGTTGGTTGAGGTGCGGAGGAGGGTCTTGGACAGGCTGGCAGAGGACAATGTGCAGAGTGGG
AGTCGACGGGTGGAATCACTGCAAATCAACATGGGGGGCGTCGAGGGAGAGGAGCACCAAGGGGCATTTGAAATG
GGGCCTGACAAGGCTGTTCTCGCCTGTAAGCGTCGGCGTGGACTCGGGGGGGCGTGGGAGCGACATGGCTAACAG
TGATTGCAGACTGCTCGAGCCACTATGCGACGTGGAGGAGGCTGTATGGCGAGCAGGCGGGGCAGTTTGTGGCGG
GCAGCTTTGGGGAAAACTTTGTGGTGGCTGGCATGAGCGAGAGCAGCGTGTGCATTGGCGACGTGGTGTCGGTGG
GAGGCTCGGTGCGGCTGCAAGTGTCGCTTCCACGGCAGGCAAGCGGCAGGCTCAGGAGGCGGCTGGGCATCGGGG
CGGGCGGGTGCATGGCGGGATGGTACTACCGGGTGGTGCAGGCGGGGACAGTGTATGCTGGCGACGAGGTGCGGG
TGGAGGAACGACCATGGCCGCAGTGGACGGTGGAGCGGGTGCAAGAGTGTCTCGAGGGCGGGCAGGACGAGGGCG
GGCAGGACAATGGCGAGGCGATAGAGCAGCTGGCGGGGCTGGAGGCGCTGGGGGAGGAGAGCCGGGGGCAGTTTC
GCAAGCGGGCTCGGCAGAGGGCGAGCCAGAGGGCGCGGCAGAGGGCGGGCATGGGCGAGCAGCAGTGGAGGCAGC
AGTGGAGGCAGCAGTGGAGGCAGCAGTGGAGGGAGTACCGGGTGGTGCGGCGCAGCATGGAGACGAGGCGCATCG
TGTCGCTGGTGCTGGAGGCGGTCGAGGCCGAGGCACCGACGACGCGGGCAGGATGGCACGTGCGCATCAAGCTGC
CCAACGGCATGGAGCGCTCCTTTTCCGTGGTGGGCGCGTCGGCGCAGCGCTTCGAGGTGGGCATTGCGCTCAACG
ACAACAGCCGCGGCGCGTCGCGCTACCTGCACGAGAGGGTGGGCGAGGGCGACGTGCTCCAGGTGGGCCACATGC
GCCACCAGGCCGCCTGGGCCGTCAGCACCAGCCACCACTGCTTCATCTCGGGCGGCATCGGCATCACCGGTCTGC
TGGCCCTGCTCAGCCATAGCCAGGCCGCCGGGCTCGACTACACCCTGCACTATGCTGTGCGCTCCGTCGCCGAGA
CGCCCTTTCGCGACCGCCTGCAGCCCCTGGCCCAGCACACCGTCACCTACGACAAGTCGCGCGGCCAGCGAATGG
ACATTGCCCATATTGTGCGCTCCCTGGCCCCCAACAGCCGCCTATACATTTGCGGGCCCCAGAGCCTGATGCAGG
CCGGCCGCCGCGCCGTTGCCGAGTGCGCCATTCCGCCCCAGCACGTCCATCTCGACGCCTTTTTTGCCCCCGTCG
GCGGCGACGCCTTTGAGGTGCAGCTTGGTCCCCGAGTCCTGCGCGTCGAAAAGGAGGCCAGTCTGCTCCAGGTGC
TGCGTCGCGAGAGCCTCGACCTGCCCTCGAGCTGCGAGATGGGCAGCTGTGGCACCTGTAGGGTCAGGCTGACGG
CCGGAAGCGTTGAGCATCGAGGCACCGCCCTGTTGGCTGAGGAGAAGGAGGAGAGTATGCTGGCCTGTGTGAGTC
GCGGCATTGGCCGCATTTCCATTCAGCTCTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail