Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7578
Gene name
LocationContig_82:26946..28828
Strand-
Gene length (bp)1882
Transcript length (bp)1818
Coding sequence length (bp)1818
Protein length (aa) 606

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04506 Rft-1 Rft protein 1.8E-144 6 594

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C6S3|RFT1_YARLI Oligosaccharide translocation protein RFT1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RFT1 PE=3 SV=1 148 537 2.0E-68
sp|P40913|RFT1_KLULA Oligosaccharide translocation protein RFT1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RFT1 PE=3 SV=2 7 553 5.0E-59
sp|P38206|RFT1_YEAST Oligosaccharide translocation protein RFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFT1 PE=1 SV=1 145 536 6.0E-59
sp|Q6FPE8|RFT1_CANGA Oligosaccharide translocation protein RFT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RFT1 PE=3 SV=1 147 551 3.0E-53
sp|Q754Q7|RFT1_ASHGO Oligosaccharide translocation protein RFT1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RFT1 PE=3 SV=1 146 598 7.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C6S3|RFT1_YARLI Oligosaccharide translocation protein RFT1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RFT1 PE=3 SV=1 148 537 2.0E-68
sp|P40913|RFT1_KLULA Oligosaccharide translocation protein RFT1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RFT1 PE=3 SV=2 7 553 5.0E-59
sp|P38206|RFT1_YEAST Oligosaccharide translocation protein RFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFT1 PE=1 SV=1 145 536 6.0E-59
sp|Q6FPE8|RFT1_CANGA Oligosaccharide translocation protein RFT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RFT1 PE=3 SV=1 147 551 3.0E-53
sp|Q754Q7|RFT1_ASHGO Oligosaccharide translocation protein RFT1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RFT1 PE=3 SV=1 146 598 7.0E-50
sp|Q5A6N8|RFT1_CANAL Oligosaccharide translocation protein RFT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RFT1 PE=3 SV=1 138 531 8.0E-48
sp|O94302|RFT1_SCHPO Oligosaccharide translocation protein rft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rft1 PE=3 SV=1 116 522 3.0E-44
sp|Q0D2E8|RFT1_XENTR Protein RFT1 homolog OS=Xenopus tropicalis GN=rft1 PE=2 SV=1 131 553 8.0E-31
sp|Q96AA3|RFT1_HUMAN Protein RFT1 homolog OS=Homo sapiens GN=RFT1 PE=1 SV=1 140 523 1.0E-28
sp|Q54IV7|RFT1_DICDI Protein RFT1 homolog OS=Dictyostelium discoideum GN=rft1 PE=3 SV=1 137 508 4.0E-28
sp|Q8C3B8|RFT1_MOUSE Protein RFT1 homolog OS=Mus musculus GN=Rft1 PE=2 SV=2 116 523 2.0E-27
sp|Q23444|RFT1_CAEEL Protein RFT1 homolog OS=Caenorhabditis elegans GN=ZK180.3 PE=3 SV=1 144 537 9.0E-18
sp|Q9Y123|RFT1_DROME Protein RFT1 homolog OS=Drosophila melanogaster GN=CG3149 PE=2 SV=1 296 523 3.0E-17
sp|Q5A6N8|RFT1_CANAL Oligosaccharide translocation protein RFT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RFT1 PE=3 SV=1 6 75 8.0E-10
sp|Q6C6S3|RFT1_YARLI Oligosaccharide translocation protein RFT1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RFT1 PE=3 SV=1 8 76 4.0E-08
sp|Q6FPE8|RFT1_CANGA Oligosaccharide translocation protein RFT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RFT1 PE=3 SV=1 7 69 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006488 dolichol-linked oligosaccharide biosynthetic process Yes
GO:0016021 integral component of membrane Yes
GO:1901137 carbohydrate derivative biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0005575 cellular_component No
GO:0071704 organic substance metabolic process No
GO:0031224 intrinsic component of membrane No
GO:0044237 cellular metabolic process No
GO:0009058 biosynthetic process No
GO:0044255 cellular lipid metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0006490 oligosaccharide-lipid intermediate biosynthetic process No
GO:0006629 lipid metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 153 175 22
2 185 207 22
3 220 242 22
4 246 268 22
5 403 425 22
6 430 452 22
7 473 495 22
8 500 519 19
9 532 554 22
10 569 591 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7578
MASVMVRGASLLILLQLASRLATFAANQILLRFLTAPLLGAATQLELYYLSVLFFARESLRVAVQRQAPDSFGPD
LDKTQSRAANEIEPLPPDADEAHDDAGQLHKPQSASQAQDLNADASRVVKTQPPKAKEAGQDRSNSSNKRQLQAL
INLGHLALVLGLPIAGLLAWLYLATALSSPLANFFLSLRLYALAAVIELVSEPAFLLMHTTLRFRVRAAAEASAT
ALRCAVVFASVIYAARYHLAVGVLPFALGQLAYASALLLVYLYASSSCASHAGFSLLPQKLADDGSFVLGYFYRP
TVSLASSMMAQSILKHVLTQGDTLLISLLATPAVQGVYALANNYGGLLARLVLQPVEESCRSYFARLLSSSSPSS
VPATVPASKRSSAILEAKNSLGTIIRLYLIFSCLVVAIGPFAAPSLLSIVAGSRWASAGAGSVLGVFCFYIPFLA
LNGLTESFVASVATERQVHSQSIWMAAFSLVFTLSAFVLMRLFPLGAQGLVLANIVNMLCRIIWSVVFIKNYFVS
HGASFSVTSFLPLSAMVSALATFAMLLGLHVLQEAESDPIGTLVKLAGSAVPLVMMIAFSEGRFLLDCIQHVRGR
TYIKQ*
Coding >OphauB2|7578
ATGGCTAGCGTCATGGTCAGAGGCGCCTCGCTACTCATTCTTCTGCAGTTGGCATCGCGCCTTGCCACTTTTGCC
GCCAACCAAATCCTCTTGCGTTTTCTGACGGCACCTCTGCTTGGAGCGGCTACACAGCTCGAGCTATACTACCTC
TCGGTTCTTTTTTTTGCTCGAGAAAGTTTGCGGGTCGCTGTGCAGCGCCAGGCACCTGACTCTTTTGGGCCCGAC
CTTGACAAGACTCAATCTCGGGCTGCCAACGAGATAGAGCCTCTGCCGCCTGATGCGGATGAAGCTCATGATGAT
GCAGGCCAATTGCACAAGCCCCAAAGTGCAAGCCAAGCTCAGGACCTGAATGCTGATGCATCTCGTGTAGTCAAG
ACTCAACCACCCAAGGCAAAGGAAGCGGGTCAAGACCGTAGCAACAGCTCCAACAAGAGACAGCTCCAAGCCCTC
ATCAATCTCGGCCATCTTGCACTTGTGCTCGGTCTGCCCATTGCCGGCCTCTTGGCCTGGCTCTATCTCGCCACT
GCACTCTCGTCTCCTCTTGCCAACTTTTTCCTTTCGCTTCGTCTCTATGCCCTTGCCGCCGTTATTGAACTCGTC
TCAGAGCCTGCTTTTCTCCTCATGCACACCACTTTGCGCTTCCGTGTCCGCGCCGCTGCCGAGGCAAGCGCCACG
GCTCTCCGTTGCGCCGTTGTCTTTGCCTCTGTCATTTACGCCGCCCGCTACCACTTGGCCGTTGGCGTCTTGCCC
TTTGCGCTCGGCCAGCTTGCGTATGCGTCTGCGCTTCTGCTCGTCTATCTGTACGCTTCAAGCTCATGCGCGAGC
CATGCTGGATTTTCTCTTTTGCCGCAAAAATTGGCAGACGATGGCTCGTTTGTCCTGGGCTATTTTTACCGTCCC
ACTGTCTCCCTGGCGTCGAGCATGATGGCTCAGAGCATTTTGAAACATGTCCTCACCCAGGGAGACACGCTCCTC
ATCTCGCTGCTCGCCACTCCTGCCGTTCAGGGAGTCTACGCCCTCGCAAACAACTATGGGGGCCTCCTCGCCCGC
TTAGTCCTTCAACCTGTTGAGGAGAGTTGCCGCAGCTATTTTGCCCGCCTGCTGTCCTCGTCCTCCCCGTCTTCG
GTCCCTGCCACCGTCCCTGCCTCGAAACGCTCGTCCGCAATACTAGAAGCCAAGAACAGCCTTGGCACTATTATC
CGTCTCTATCTCATCTTTTCTTGTCTCGTCGTTGCCATCGGCCCTTTTGCCGCGCCCTCTCTTCTTTCCATTGTC
GCCGGCTCTCGTTGGGCCTCTGCTGGCGCCGGCTCCGTCCTTGGCGTTTTTTGCTTCTATATTCCCTTTTTGGCT
CTCAATGGCCTCACAGAGTCCTTTGTTGCTTCAGTGGCCACCGAGCGCCAGGTCCACAGCCAGTCCATTTGGATG
GCGGCTTTTTCCTTGGTATTTACTCTCTCGGCATTCGTCTTGATGCGTCTTTTCCCACTTGGCGCTCAGGGTCTT
GTGCTGGCCAACATTGTCAACATGCTGTGTCGCATCATTTGGAGCGTCGTCTTTATCAAGAATTACTTTGTGTCG
CATGGCGCTTCGTTTTCCGTCACGTCCTTTTTACCACTCTCAGCCATGGTCTCGGCTCTAGCTACATTTGCCATG
CTGCTGGGGCTTCATGTCCTTCAAGAGGCCGAATCGGACCCCATAGGCACGCTCGTCAAACTTGCAGGCTCGGCC
GTGCCACTAGTCATGATGATAGCCTTTTCAGAAGGAAGATTTCTCCTTGACTGTATCCAGCATGTGCGCGGCCGC
ACATATATCAAACAGTGA
Transcript >OphauB2|7578
ATGGCTAGCGTCATGGTCAGAGGCGCCTCGCTACTCATTCTTCTGCAGTTGGCATCGCGCCTTGCCACTTTTGCC
GCCAACCAAATCCTCTTGCGTTTTCTGACGGCACCTCTGCTTGGAGCGGCTACACAGCTCGAGCTATACTACCTC
TCGGTTCTTTTTTTTGCTCGAGAAAGTTTGCGGGTCGCTGTGCAGCGCCAGGCACCTGACTCTTTTGGGCCCGAC
CTTGACAAGACTCAATCTCGGGCTGCCAACGAGATAGAGCCTCTGCCGCCTGATGCGGATGAAGCTCATGATGAT
GCAGGCCAATTGCACAAGCCCCAAAGTGCAAGCCAAGCTCAGGACCTGAATGCTGATGCATCTCGTGTAGTCAAG
ACTCAACCACCCAAGGCAAAGGAAGCGGGTCAAGACCGTAGCAACAGCTCCAACAAGAGACAGCTCCAAGCCCTC
ATCAATCTCGGCCATCTTGCACTTGTGCTCGGTCTGCCCATTGCCGGCCTCTTGGCCTGGCTCTATCTCGCCACT
GCACTCTCGTCTCCTCTTGCCAACTTTTTCCTTTCGCTTCGTCTCTATGCCCTTGCCGCCGTTATTGAACTCGTC
TCAGAGCCTGCTTTTCTCCTCATGCACACCACTTTGCGCTTCCGTGTCCGCGCCGCTGCCGAGGCAAGCGCCACG
GCTCTCCGTTGCGCCGTTGTCTTTGCCTCTGTCATTTACGCCGCCCGCTACCACTTGGCCGTTGGCGTCTTGCCC
TTTGCGCTCGGCCAGCTTGCGTATGCGTCTGCGCTTCTGCTCGTCTATCTGTACGCTTCAAGCTCATGCGCGAGC
CATGCTGGATTTTCTCTTTTGCCGCAAAAATTGGCAGACGATGGCTCGTTTGTCCTGGGCTATTTTTACCGTCCC
ACTGTCTCCCTGGCGTCGAGCATGATGGCTCAGAGCATTTTGAAACATGTCCTCACCCAGGGAGACACGCTCCTC
ATCTCGCTGCTCGCCACTCCTGCCGTTCAGGGAGTCTACGCCCTCGCAAACAACTATGGGGGCCTCCTCGCCCGC
TTAGTCCTTCAACCTGTTGAGGAGAGTTGCCGCAGCTATTTTGCCCGCCTGCTGTCCTCGTCCTCCCCGTCTTCG
GTCCCTGCCACCGTCCCTGCCTCGAAACGCTCGTCCGCAATACTAGAAGCCAAGAACAGCCTTGGCACTATTATC
CGTCTCTATCTCATCTTTTCTTGTCTCGTCGTTGCCATCGGCCCTTTTGCCGCGCCCTCTCTTCTTTCCATTGTC
GCCGGCTCTCGTTGGGCCTCTGCTGGCGCCGGCTCCGTCCTTGGCGTTTTTTGCTTCTATATTCCCTTTTTGGCT
CTCAATGGCCTCACAGAGTCCTTTGTTGCTTCAGTGGCCACCGAGCGCCAGGTCCACAGCCAGTCCATTTGGATG
GCGGCTTTTTCCTTGGTATTTACTCTCTCGGCATTCGTCTTGATGCGTCTTTTCCCACTTGGCGCTCAGGGTCTT
GTGCTGGCCAACATTGTCAACATGCTGTGTCGCATCATTTGGAGCGTCGTCTTTATCAAGAATTACTTTGTGTCG
CATGGCGCTTCGTTTTCCGTCACGTCCTTTTTACCACTCTCAGCCATGGTCTCGGCTCTAGCTACATTTGCCATG
CTGCTGGGGCTTCATGTCCTTCAAGAGGCCGAATCGGACCCCATAGGCACGCTCGTCAAACTTGCAGGCTCGGCC
GTGCCACTAGTCATGATGATAGCCTTTTCAGAAGGAAGATTTCTCCTTGACTGTATCCAGCATGTGCGCGGCCGC
ACATATATCAAACAGTGA
Gene >OphauB2|7578
ATGGCTAGCGTCATGGTCAGAGGCGCCTCGCTACTCATTCTTCTGCAGTTGGCATCGCGCCTTGCCACTTTTGCC
GCCAACCAAATCCTCTTGCGTTTTCTGACGGCACCTCTGCTTGGAGCGGCTACACAGCTCGAGCTATACTACCTC
TCGGTTCTTTTTTTTGCTCGAGAAAGTTTGCGGGTCGCTGTGCAGCGCCAGGCACCTGACTCTTTTGGGCCCGAC
CTTGACAAGACTCAATCTCGGGCTGCCAACGAGATAGAGCCTCTGCCGCCTGATGCGGATGAAGCTCATGATGAT
GCAGGCCAATTGCACAAGCCCCAAAGTGCAAGCCAAGCTCAGGACCTGAATGCTGATGCATCTCGTGTAGTCAAG
ACTCAACCACCCAAGGCAAAGGAAGCGGGTCAAGACCGTAGCAACAGCTCCAACAAGAGACAGCTCCAAGCCCTC
ATCAATCTCGGCCATCTTGCACTTGTGCTCGGTCTGCCCATTGCCGGCCTCTTGGCCTGGCTCTATCTCGCCACT
GCACTCTCGTCTCCTCTTGCCAACTTTTTCCTTTCGCTTCGTCTCTATGCCCTTGCCGCCGTTATTGAACTCGTC
TCAGAGCCTGCTTTTCTCCTCATGCACACCACTTTGCGCTTCCGTGTCCGCGCCGCTGCCGAGGCAAGCGCCACG
GCTCTCCGTTGCGCCGTTGTCTTTGCCTCTGTCATTTACGCCGCCCGCTACCACTTGGCCGTTGGCGTCTTGCCC
TTTGCGCTCGGCCAGCTTGCGTATGCGTCTGCGCTTCTGCTCGTCTATCTGTACGCTTCAAGCTCATGCGCGAGC
CATGCTGGATTTTCTCTTTTGCCGCAAAAATTGGCAGACGATGGCTCGTTTGTCCTGGGCTATTTTTACCGTCCC
ACTGTCTCCCTGGCGTCGAGCATGATGGCTCAGAGCATTTTGAAACATGTCCTCACCCAGGGAGACACGCTCCTC
ATCTCGCTGCTCGCCACTCCTGCCGTTCAGGGAGTCTACGCCCTCGCAAACAACTATGGGGGCCTCCTCGCCCGC
TTAGTCCTTCAACCTGTTGAGGAGAGTTGCCGCAGCTATTTTGCCCGCCTGCTGTCCTCGTCCTCCCCGTCTTCG
GTCCCTGCCACCGTCCCTGCCTCGAAACGCTCGTCCGCAATACTAGAAGCCAAGAACAGCCTTGGCACTATTATC
CGTCTCTATCTCATCTTTTCTTGTCTCGTCGTTGCCATCGGCCCTTTTGCCGCGCCCTCTCTTCTTTCCATTGTC
GCCGGCTCTCGTTGGGCCTCTGCTGGCGCCGGCTCCGTCCTTGGCGTTTTTTGCTTCTATATTCCCTTTTTGGCT
CTCAATGGCCTCACAGAGTCCTTTGTTGCTTCAGTGGCCACCGAGCGCCAGGTCCACAGCCAGTCCATTTGGATG
GCGGCTTTTTCCTTGGTATTTACTCTCTCGGCATTCGTCTTGATGCGTCTTTTCCCACTTGGCGCTCAGGGTCTT
GTGCTGGCCAACATTGTCAACATGCTGTGTCGCATCATTTGGAGCGTCGTCTTTATCAAGAATTACTTTGTGTCG
CATGGCGCTTCGTTTTCCGTCACGTCCTTTTTACCACTCTCAGCCATGGTCTCGGCTCTAGCTACATTTGCCATG
CTGCTGGGGCTTCATGTCCTTCAAGAGGCCGAATCGGACCCCATAGGCACGCTCGTCAAACTTGCAGGCTCGGCC
GTGCCACTAGTCATGATGATGTACGTCTTGTCTACATGTCCACTCCATGTAGTTGCTGGTTCAAGGTGGCTGATA
AAGACACAGAGCCTTTTCAGAAGGAAGATTTCTCCTTGACTGTATCCAGCATGTGCGCGGCCGCACATATATCAA
ACAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail