Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7571
Gene name
LocationContig_82:12782..13601
Strand+
Gene length (bp)819
Transcript length (bp)768
Coding sequence length (bp)768
Protein length (aa) 256

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13093 FTA4 Kinetochore complex Fta4 of Sim4 subunit, or CENP-50 3.2E-50 11 209

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94716|FTA4_SCHPO Kinetochore protein fta4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fta4 PE=1 SV=1 16 148 4.0E-06

GO

GO Term Description Terminal node
GO:0031511 Mis6-Sim4 complex Yes
GO:0032991 protein-containing complex No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7571
MSSQAPKPTPTVASVKKAFVAAQANILAQGPTPSAAWRASNDASQQPLPQGAIDEAVAALGRVVQQHCRRVYAPQ
ATRNVAEQIWNVYVRDADASMEAQAEAERAGVARDIDLLDDDAIDTLPASWPSQRHGEAHAMEAKRYQEAVARLG
QLRDERRELRRRVDMLARLNTMTHVLDARHVQENLITRNGAVEHELDRMRILLARVAGRVAELPDATAAPDASAA
VDVDVLARADKIRVDDFVDGFAANPNLFHS*
Coding >OphauB2|7571
ATGTCGTCGCAGGCGCCAAAGCCAACGCCAACAGTCGCGTCGGTGAAGAAGGCCTTTGTGGCCGCACAGGCAAAC
ATACTCGCGCAGGGGCCGACGCCGTCTGCTGCGTGGCGAGCCTCCAACGACGCGTCGCAGCAGCCTCTGCCTCAA
GGTGCCATCGACGAGGCGGTAGCAGCACTGGGCCGAGTGGTGCAGCAGCACTGTCGGCGCGTCTACGCCCCGCAG
GCGACGCGCAATGTGGCTGAGCAGATATGGAATGTCTATGTGCGCGACGCCGACGCGAGCATGGAGGCGCAGGCC
GAGGCTGAGCGAGCGGGCGTGGCCCGGGACATTGATCTGCTCGACGACGACGCCATTGACACGCTGCCGGCCTCG
TGGCCCTCGCAGCGCCATGGCGAGGCCCATGCCATGGAGGCCAAGCGCTATCAAGAGGCTGTGGCGCGCCTCGGG
CAGCTACGCGACGAGCGAAGAGAGCTCCGGCGGCGCGTCGACATGCTTGCCCGCCTCAATACCATGACGCATGTC
CTGGACGCGCGCCACGTCCAAGAGAACCTCATTACCCGCAACGGCGCAGTCGAGCACGAGCTGGACAGGATGCGC
ATCTTGCTGGCCCGTGTAGCCGGGCGAGTGGCCGAGCTGCCTGATGCGACTGCAGCTCCAGACGCGAGCGCTGCC
GTAGACGTCGACGTACTGGCCAGGGCGGACAAGATACGAGTCGACGACTTTGTCGACGGCTTTGCAGCCAATCCC
AACCTCTTTCACTCTTGA
Transcript >OphauB2|7571
ATGTCGTCGCAGGCGCCAAAGCCAACGCCAACAGTCGCGTCGGTGAAGAAGGCCTTTGTGGCCGCACAGGCAAAC
ATACTCGCGCAGGGGCCGACGCCGTCTGCTGCGTGGCGAGCCTCCAACGACGCGTCGCAGCAGCCTCTGCCTCAA
GGTGCCATCGACGAGGCGGTAGCAGCACTGGGCCGAGTGGTGCAGCAGCACTGTCGGCGCGTCTACGCCCCGCAG
GCGACGCGCAATGTGGCTGAGCAGATATGGAATGTCTATGTGCGCGACGCCGACGCGAGCATGGAGGCGCAGGCC
GAGGCTGAGCGAGCGGGCGTGGCCCGGGACATTGATCTGCTCGACGACGACGCCATTGACACGCTGCCGGCCTCG
TGGCCCTCGCAGCGCCATGGCGAGGCCCATGCCATGGAGGCCAAGCGCTATCAAGAGGCTGTGGCGCGCCTCGGG
CAGCTACGCGACGAGCGAAGAGAGCTCCGGCGGCGCGTCGACATGCTTGCCCGCCTCAATACCATGACGCATGTC
CTGGACGCGCGCCACGTCCAAGAGAACCTCATTACCCGCAACGGCGCAGTCGAGCACGAGCTGGACAGGATGCGC
ATCTTGCTGGCCCGTGTAGCCGGGCGAGTGGCCGAGCTGCCTGATGCGACTGCAGCTCCAGACGCGAGCGCTGCC
GTAGACGTCGACGTACTGGCCAGGGCGGACAAGATACGAGTCGACGACTTTGTCGACGGCTTTGCAGCCAATCCC
AACCTCTTTCACTCTTGA
Gene >OphauB2|7571
ATGTCGTCGCAGGCGCCAAAGCCAACGCCAACAGTCGCGTCGGTGAAGAAGGCCTTTGTGGCCGCACAGGCAAAC
ATACTCGCGCAGGGGCCGACGCCGTCTGCTGCGTGGCGAGCCTCCAACGACGCGTCGCAGCAGCCTCTGCCTCAA
GGTGCCATCGACGAGGCGGTAGCAGCACTGGGCCGAGTGGTGCAGCAGCACTGTCGGCGCGTCTACGCCCCGCAG
GCGACGCGCAATGTGGCTGAGCAGATATGGAATGTCTATGTGCGCGACGCCGACGCGAGCATGGAGGCGCAGGCC
GAGGCTGAGCGAGCGGGCGTGGCCCGGGACATTGATCTGCGTAGGTGCAGCGGTGCAAGAGGGCATGAGGCTTGA
CGGCTGACAGGGACAGTCGACGACGACGCCATTGACACGCTGCCGGCCTCGTGGCCCTCGCAGCGCCATGGCGAG
GCCCATGCCATGGAGGCCAAGCGCTATCAAGAGGCTGTGGCGCGCCTCGGGCAGCTACGCGACGAGCGAAGAGAG
CTCCGGCGGCGCGTCGACATGCTTGCCCGCCTCAATACCATGACGCATGTCCTGGACGCGCGCCACGTCCAAGAG
AACCTCATTACCCGCAACGGCGCAGTCGAGCACGAGCTGGACAGGATGCGCATCTTGCTGGCCCGTGTAGCCGGG
CGAGTGGCCGAGCTGCCTGATGCGACTGCAGCTCCAGACGCGAGCGCTGCCGTAGACGTCGACGTACTGGCCAGG
GCGGACAAGATACGAGTCGACGACTTTGTCGACGGCTTTGCAGCCAATCCCAACCTCTTTCACTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail