Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7566
Gene name
LocationContig_81:72737..76316
Strand+
Gene length (bp)3579
Transcript length (bp)3264
Coding sequence length (bp)3264
Protein length (aa) 1088

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16016 VASt VAD1 Analog of StAR-related lipid transfer domain 3.0E-38 721 866
PF02893 GRAM GRAM domain 6.6E-23 472 579

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42976|YGZ7_SCHPO Uncharacterized membrane protein C20F10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC20F10.07 PE=1 SV=1 456 878 8.0E-80
sp|P43560|LAM5_YEAST Membrane-anchored lipid-binding protein LAM5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM5 PE=1 SV=2 460 869 8.0E-51
sp|Q06681|YSP2_YEAST Membrane-anchored lipid-binding protein YSP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSP2 PE=1 SV=1 699 883 2.0E-37
sp|Q80TI0|GRM1B_MOUSE GRAM domain-containing protein 1B OS=Mus musculus GN=Gramd1b PE=1 SV=2 467 909 2.0E-33
sp|P38800|LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM4 PE=1 SV=1 458 575 2.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42976|YGZ7_SCHPO Uncharacterized membrane protein C20F10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC20F10.07 PE=1 SV=1 456 878 8.0E-80
sp|P43560|LAM5_YEAST Membrane-anchored lipid-binding protein LAM5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM5 PE=1 SV=2 460 869 8.0E-51
sp|Q06681|YSP2_YEAST Membrane-anchored lipid-binding protein YSP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSP2 PE=1 SV=1 699 883 2.0E-37
sp|Q80TI0|GRM1B_MOUSE GRAM domain-containing protein 1B OS=Mus musculus GN=Gramd1b PE=1 SV=2 467 909 2.0E-33
sp|P38800|LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM4 PE=1 SV=1 458 575 2.0E-33
sp|Q3KR56|GRM1A_RAT GRAM domain-containing protein 1A OS=Rattus norvegicus GN=Gramd1a PE=2 SV=2 467 923 2.0E-33
sp|Q3KR37|GRM1B_HUMAN GRAM domain-containing protein 1B OS=Homo sapiens GN=GRAMD1B PE=1 SV=1 467 878 1.0E-32
sp|Q8VEF1|GRM1A_MOUSE GRAM domain-containing protein 1A OS=Mus musculus GN=Gramd1a PE=1 SV=2 467 923 8.0E-32
sp|P38800|LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM4 PE=1 SV=1 652 1070 4.0E-31
sp|Q06681|YSP2_YEAST Membrane-anchored lipid-binding protein YSP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSP2 PE=1 SV=1 699 1073 6.0E-31
sp|Q96CP6|GRM1A_HUMAN GRAM domain-containing protein 1A OS=Homo sapiens GN=GRAMD1A PE=1 SV=2 467 923 3.0E-30
sp|Q8IYS0|GRM1C_HUMAN GRAM domain-containing protein 1C OS=Homo sapiens GN=GRAMD1C PE=1 SV=2 462 576 2.0E-21
sp|Q5RC33|GRM1C_PONAB GRAM domain-containing protein 1C OS=Pongo abelii GN=GRAMD1C PE=2 SV=1 462 576 2.0E-21
sp|Q96HH9|GRAM3_HUMAN GRAM domain-containing protein 3 OS=Homo sapiens GN=GRAMD3 PE=1 SV=1 468 579 9.0E-20
sp|Q5R8N8|GRAM3_PONAB GRAM domain-containing protein 3 OS=Pongo abelii GN=GRAMD3 PE=2 SV=1 468 579 1.0E-19
sp|Q6PEM6|GRAM3_MOUSE GRAM domain-containing protein 3 OS=Mus musculus GN=Gramd3 PE=1 SV=2 468 579 2.0E-19
sp|F4HVW5|VAD1_ARATH Protein VASCULAR ASSOCIATED DEATH 1, chloroplastic OS=Arabidopsis thaliana GN=VAD1 PE=1 SV=1 469 852 2.0E-19
sp|Q5FVG8|GRAM3_RAT GRAM domain-containing protein 3 OS=Rattus norvegicus GN=Gramd3 PE=1 SV=1 468 579 4.0E-19
sp|Q8IUY3|GRAM2_HUMAN GRAM domain-containing protein 2 OS=Homo sapiens GN=GRAMD2 PE=2 SV=2 464 593 2.0E-18
sp|Q3V3G7|GRAM2_MOUSE GRAM domain-containing protein 2 OS=Mus musculus GN=Gramd2 PE=2 SV=1 468 587 3.0E-18
sp|Q08001|LAM6_YEAST Membrane-anchored lipid-binding protein LAM6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM6 PE=1 SV=1 464 620 2.0E-15
sp|Q08001|LAM6_YEAST Membrane-anchored lipid-binding protein LAM6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM6 PE=1 SV=1 772 902 2.0E-15
sp|Q54HC6|ARKA_DICDI Ankyrin repeat-containing protein kinase A OS=Dictyostelium discoideum GN=arkA PE=1 SV=1 422 569 2.0E-08
sp|Q3UYK3|TBCD9_MOUSE TBC1 domain family member 9 OS=Mus musculus GN=Tbc1d9 PE=2 SV=2 473 571 7.0E-08
sp|Q6ZT07|TBCD9_HUMAN TBC1 domain family member 9 OS=Homo sapiens GN=TBC1D9 PE=2 SV=2 473 571 1.0E-07
sp|A7KAN4|ATG26_PENRW Sterol 3-beta-glucosyltransferase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg26 PE=3 SV=1 473 628 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 949 971 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7566
MDVGKLLPKAISAKRRRRRQQKEEERRRRHEQHGDDDATMTSARRGSDGTFDSTDEGDGDGDGDGSFASFDSSPR
LDRQTASDRIPPRPRRPASPDAPGSTSPPARPATISTHPSLIGYLTTSSPVVQATHLDSWSQLDPSGKNASPISL
PNADDRTTPPPPRINTTKPAPLIVSTPPTPVDSLSFPDDKHRIADGSISPAQGMIAHRKSKSGSAAISPSKLSSV
TLPPSTPSIDPSQQTPTSSTGFFSTVISAAQNAATTLGNNIPVSGMGIGSANKSKSSLSRSQTVYNPPTPSNLGP
TSRIRSTDGSMDSKESAVQTLGAGELSLSQLGISEPTGSITSTQSATLADAADARSRSDSAPMDSQPRPAEPAVE
ESSSRPRSLLEASHDDHAPSQADSDTKGSVQRSSSMRSGAKPHRKRGSSVTTGGTTTTTVGAHSAAANSSGPPPN
TAAYGAPKLTGFAIASKKRNRDFHSFFKSVPDDDYLIEDYSCALQREILAHGRLYVSEGHLCFSSNILGWTTTLV
MSFDEIVSVEKRSTALVFKNGLMISTLHAKHIFASFTSRDATYDLIVNIWKLGHPTLKSTLNGVRLEGTGGDKTE
KVDADPASADNEVQLASDSDDEGDEGDDDEEEDDDDDFYDEEEHDDAAETHVTDSTGAIVEPEKSSLRKASALTA
PNGAPADTGRETTAPPGGSVDFPGPASHPPTDCGDSASHYDKFVGDEIIPAPLGKVYNLVFGPGSVAWMAKWLTG
EQKCTDLQMEDRKGLSAENRTRNYTYVKPLNASIGPKQTKCIVSETLENIDLEKAVNLVVSVQNPDVPSGNIFSV
KTRYCLSWAENNATRLQVNCTVEWTGKSWIKGPIEKGVSDGQAQYCKDLCAALRAAVTSRPRAATGASGPSKPRK
KARKSKALQSGDNNTEKRDGPKHAAKQQWGPLEPVRGIIEPCIDILGPVLTGNVMYGLLVGLLVALWFGFGSGPS
KNSVTYGPEMGVWSPQRLAAYEEMWRREESELWYWLEERVGLDQLMSPGSAGSRPKDSEHRSMEEKLKQEHMTER
EMKEAIRVTEERLRVLQEVVSKSSLDKERGSEQASKS*
Coding >OphauB2|7566
ATGGACGTGGGCAAGCTTTTGCCAAAGGCCATCTCGGCCAAGCGCCGCCGCCGACGACAGCAAAAAGAGGAGGAG
CGGCGCCGGCGCCATGAGCAGCACGGCGATGACGACGCGACCATGACGAGTGCCAGACGAGGCAGCGACGGCACC
TTTGACTCGACCGACGAGGGCGACGGCGATGGCGACGGCGACGGCAGCTTTGCGTCCTTTGACTCTAGCCCGAGG
CTAGATAGACAGACAGCATCTGACCGAATACCACCAAGGCCACGGCGACCCGCTTCTCCTGACGCTCCGGGCTCT
ACTTCTCCTCCCGCCCGTCCCGCAACCATCTCTACACACCCGTCCCTCATCGGATACCTAACGACGTCGTCTCCC
GTTGTCCAGGCCACCCATCTCGACTCGTGGTCCCAGCTTGACCCCAGCGGCAAAAACGCCTCGCCCATCTCTCTC
CCGAATGCTGACGACCGCACAACGCCGCCGCCCCCACGCATCAACACGACCAAACCCGCTCCTCTAATTGTCAGC
ACTCCGCCAACGCCTGTCGACTCCCTCTCTTTTCCTGACGATAAGCATCGCATTGCAGATGGCAGCATCTCTCCT
GCACAGGGCATGATTGCGCATAGGAAGAGCAAGTCCGGATCTGCCGCAATCAGCCCTAGTAAACTCTCCAGCGTC
ACTCTTCCGCCTTCTACACCCTCTATCGACCCCAGTCAACAGACACCAACTTCTTCCACTGGCTTCTTCTCTACG
GTCATCTCAGCCGCCCAAAACGCTGCCACGACGCTGGGTAACAATATACCAGTCAGCGGGATGGGTATAGGCTCT
GCCAACAAGAGCAAGTCTAGCCTATCGAGATCGCAAACCGTATACAATCCTCCTACACCTTCCAACCTTGGTCCC
ACCTCACGAATCCGGTCGACTGACGGCAGCATGGATTCGAAAGAATCGGCCGTTCAGACACTTGGCGCTGGTGAA
CTCAGTTTAAGCCAGCTTGGAATCTCTGAACCTACGGGCTCCATAACCTCAACCCAGAGCGCAACACTTGCCGAC
GCGGCCGACGCCAGATCTCGGTCCGACTCGGCGCCCATGGATTCTCAGCCACGTCCTGCAGAGCCAGCGGTCGAG
GAGTCTTCTAGCAGACCCCGCTCTCTACTCGAAGCCAGCCATGATGACCATGCCCCATCTCAGGCCGACTCGGAC
ACCAAGGGCAGTGTCCAGCGAAGCTCGAGTATGCGAAGCGGTGCCAAACCACACCGTAAACGGGGAAGCTCTGTC
ACAACGGGAGGCACGACAACGACGACTGTCGGCGCACATTCGGCTGCGGCAAACAGTTCGGGCCCTCCACCCAAC
ACAGCTGCCTATGGGGCACCCAAACTCACGGGCTTCGCAATTGCTAGCAAGAAGCGAAATCGCGACTTTCACAGC
TTTTTCAAGAGCGTTCCAGACGACGACTACTTGATTGAAGACTATAGCTGTGCTCTGCAGCGCGAAATCCTTGCC
CATGGCAGGTTATACGTGTCGGAGGGACATCTTTGCTTTAGCAGCAACATTTTGGGCTGGACTACAACATTGGTC
ATGAGCTTTGATGAAATTGTGTCGGTTGAAAAGAGAAGCACGGCGCTCGTCTTCAAGAATGGCTTGATGATATCC
ACCTTGCACGCCAAGCACATTTTCGCCAGCTTTACCAGCAGAGACGCCACATATGACTTGATTGTAAATATCTGG
AAGCTTGGTCACCCCACACTCAAGAGCACACTGAATGGCGTACGACTAGAGGGCACTGGCGGTGACAAGACGGAA
AAGGTGGATGCCGATCCTGCCAGTGCCGACAATGAAGTTCAACTAGCATCTGATTCGGACGACGAGGGCGATGAG
GGCGACGACGATGAAGAAGAAGACGACGACGACGACTTTTACGATGAAGAAGAACACGACGATGCCGCCGAAACA
CATGTGACTGATTCGACGGGCGCCATTGTGGAGCCGGAAAAGTCGTCGCTTAGAAAGGCGTCAGCCTTGACGGCG
CCGAATGGAGCTCCGGCTGACACGGGCCGCGAGACGACGGCACCCCCTGGAGGCTCAGTCGACTTTCCCGGCCCT
GCTTCTCACCCGCCGACTGACTGCGGCGACTCGGCGTCGCACTATGACAAGTTTGTTGGCGATGAAATTATTCCC
GCCCCGCTGGGCAAGGTGTACAATCTGGTTTTTGGGCCGGGGTCGGTGGCATGGATGGCAAAGTGGTTGACGGGA
GAGCAAAAATGCACCGACTTGCAAATGGAGGACAGAAAGGGCCTGAGTGCCGAGAACCGGACGCGCAACTACACC
TATGTGAAGCCACTCAATGCGTCAATTGGACCGAAGCAGACAAAGTGCATCGTGTCGGAAACGCTGGAGAATATT
GACTTGGAAAAGGCTGTCAATTTGGTTGTTTCGGTGCAAAATCCCGATGTGCCGAGCGGCAACATTTTCAGCGTC
AAGACGAGATATTGCCTTTCGTGGGCGGAGAATAACGCGACACGCCTTCAAGTGAATTGCACGGTTGAGTGGACT
GGCAAGAGCTGGATCAAAGGTCCAATTGAAAAGGGAGTGAGTGATGGACAGGCACAGTATTGCAAAGACTTGTGT
GCTGCGCTCAGAGCTGCTGTGACGAGTCGGCCTCGAGCGGCAACTGGTGCGAGCGGACCTTCGAAGCCTAGAAAG
AAGGCTAGGAAGAGCAAAGCACTACAGTCTGGCGATAACAACACGGAAAAGAGGGACGGACCCAAGCACGCAGCC
AAGCAACAATGGGGTCCTTTGGAGCCTGTGCGAGGCATCATTGAGCCGTGTATTGATATCCTGGGGCCCGTCTTG
ACTGGCAACGTCATGTACGGCTTGCTTGTTGGCCTGTTGGTTGCGCTGTGGTTTGGCTTCGGGTCTGGGCCGAGC
AAGAATTCGGTGACGTATGGACCCGAGATGGGCGTCTGGAGCCCGCAGCGACTAGCGGCATATGAAGAGATGTGG
CGACGGGAGGAGAGCGAACTTTGGTACTGGCTCGAGGAACGTGTTGGGCTGGACCAGCTGATGAGTCCGGGCAGC
GCAGGCAGTCGGCCAAAGGATTCGGAGCACCGCAGCATGGAGGAGAAGCTGAAACAAGAGCACATGACGGAGCGC
GAGATGAAGGAGGCAATACGTGTCACGGAAGAGAGACTACGAGTGCTGCAAGAGGTTGTTTCCAAATCAAGTCTG
GATAAGGAGCGGGGAAGCGAGCAGGCATCCAAGTCATGA
Transcript >OphauB2|7566
ATGGACGTGGGCAAGCTTTTGCCAAAGGCCATCTCGGCCAAGCGCCGCCGCCGACGACAGCAAAAAGAGGAGGAG
CGGCGCCGGCGCCATGAGCAGCACGGCGATGACGACGCGACCATGACGAGTGCCAGACGAGGCAGCGACGGCACC
TTTGACTCGACCGACGAGGGCGACGGCGATGGCGACGGCGACGGCAGCTTTGCGTCCTTTGACTCTAGCCCGAGG
CTAGATAGACAGACAGCATCTGACCGAATACCACCAAGGCCACGGCGACCCGCTTCTCCTGACGCTCCGGGCTCT
ACTTCTCCTCCCGCCCGTCCCGCAACCATCTCTACACACCCGTCCCTCATCGGATACCTAACGACGTCGTCTCCC
GTTGTCCAGGCCACCCATCTCGACTCGTGGTCCCAGCTTGACCCCAGCGGCAAAAACGCCTCGCCCATCTCTCTC
CCGAATGCTGACGACCGCACAACGCCGCCGCCCCCACGCATCAACACGACCAAACCCGCTCCTCTAATTGTCAGC
ACTCCGCCAACGCCTGTCGACTCCCTCTCTTTTCCTGACGATAAGCATCGCATTGCAGATGGCAGCATCTCTCCT
GCACAGGGCATGATTGCGCATAGGAAGAGCAAGTCCGGATCTGCCGCAATCAGCCCTAGTAAACTCTCCAGCGTC
ACTCTTCCGCCTTCTACACCCTCTATCGACCCCAGTCAACAGACACCAACTTCTTCCACTGGCTTCTTCTCTACG
GTCATCTCAGCCGCCCAAAACGCTGCCACGACGCTGGGTAACAATATACCAGTCAGCGGGATGGGTATAGGCTCT
GCCAACAAGAGCAAGTCTAGCCTATCGAGATCGCAAACCGTATACAATCCTCCTACACCTTCCAACCTTGGTCCC
ACCTCACGAATCCGGTCGACTGACGGCAGCATGGATTCGAAAGAATCGGCCGTTCAGACACTTGGCGCTGGTGAA
CTCAGTTTAAGCCAGCTTGGAATCTCTGAACCTACGGGCTCCATAACCTCAACCCAGAGCGCAACACTTGCCGAC
GCGGCCGACGCCAGATCTCGGTCCGACTCGGCGCCCATGGATTCTCAGCCACGTCCTGCAGAGCCAGCGGTCGAG
GAGTCTTCTAGCAGACCCCGCTCTCTACTCGAAGCCAGCCATGATGACCATGCCCCATCTCAGGCCGACTCGGAC
ACCAAGGGCAGTGTCCAGCGAAGCTCGAGTATGCGAAGCGGTGCCAAACCACACCGTAAACGGGGAAGCTCTGTC
ACAACGGGAGGCACGACAACGACGACTGTCGGCGCACATTCGGCTGCGGCAAACAGTTCGGGCCCTCCACCCAAC
ACAGCTGCCTATGGGGCACCCAAACTCACGGGCTTCGCAATTGCTAGCAAGAAGCGAAATCGCGACTTTCACAGC
TTTTTCAAGAGCGTTCCAGACGACGACTACTTGATTGAAGACTATAGCTGTGCTCTGCAGCGCGAAATCCTTGCC
CATGGCAGGTTATACGTGTCGGAGGGACATCTTTGCTTTAGCAGCAACATTTTGGGCTGGACTACAACATTGGTC
ATGAGCTTTGATGAAATTGTGTCGGTTGAAAAGAGAAGCACGGCGCTCGTCTTCAAGAATGGCTTGATGATATCC
ACCTTGCACGCCAAGCACATTTTCGCCAGCTTTACCAGCAGAGACGCCACATATGACTTGATTGTAAATATCTGG
AAGCTTGGTCACCCCACACTCAAGAGCACACTGAATGGCGTACGACTAGAGGGCACTGGCGGTGACAAGACGGAA
AAGGTGGATGCCGATCCTGCCAGTGCCGACAATGAAGTTCAACTAGCATCTGATTCGGACGACGAGGGCGATGAG
GGCGACGACGATGAAGAAGAAGACGACGACGACGACTTTTACGATGAAGAAGAACACGACGATGCCGCCGAAACA
CATGTGACTGATTCGACGGGCGCCATTGTGGAGCCGGAAAAGTCGTCGCTTAGAAAGGCGTCAGCCTTGACGGCG
CCGAATGGAGCTCCGGCTGACACGGGCCGCGAGACGACGGCACCCCCTGGAGGCTCAGTCGACTTTCCCGGCCCT
GCTTCTCACCCGCCGACTGACTGCGGCGACTCGGCGTCGCACTATGACAAGTTTGTTGGCGATGAAATTATTCCC
GCCCCGCTGGGCAAGGTGTACAATCTGGTTTTTGGGCCGGGGTCGGTGGCATGGATGGCAAAGTGGTTGACGGGA
GAGCAAAAATGCACCGACTTGCAAATGGAGGACAGAAAGGGCCTGAGTGCCGAGAACCGGACGCGCAACTACACC
TATGTGAAGCCACTCAATGCGTCAATTGGACCGAAGCAGACAAAGTGCATCGTGTCGGAAACGCTGGAGAATATT
GACTTGGAAAAGGCTGTCAATTTGGTTGTTTCGGTGCAAAATCCCGATGTGCCGAGCGGCAACATTTTCAGCGTC
AAGACGAGATATTGCCTTTCGTGGGCGGAGAATAACGCGACACGCCTTCAAGTGAATTGCACGGTTGAGTGGACT
GGCAAGAGCTGGATCAAAGGTCCAATTGAAAAGGGAGTGAGTGATGGACAGGCACAGTATTGCAAAGACTTGTGT
GCTGCGCTCAGAGCTGCTGTGACGAGTCGGCCTCGAGCGGCAACTGGTGCGAGCGGACCTTCGAAGCCTAGAAAG
AAGGCTAGGAAGAGCAAAGCACTACAGTCTGGCGATAACAACACGGAAAAGAGGGACGGACCCAAGCACGCAGCC
AAGCAACAATGGGGTCCTTTGGAGCCTGTGCGAGGCATCATTGAGCCGTGTATTGATATCCTGGGGCCCGTCTTG
ACTGGCAACGTCATGTACGGCTTGCTTGTTGGCCTGTTGGTTGCGCTGTGGTTTGGCTTCGGGTCTGGGCCGAGC
AAGAATTCGGTGACGTATGGACCCGAGATGGGCGTCTGGAGCCCGCAGCGACTAGCGGCATATGAAGAGATGTGG
CGACGGGAGGAGAGCGAACTTTGGTACTGGCTCGAGGAACGTGTTGGGCTGGACCAGCTGATGAGTCCGGGCAGC
GCAGGCAGTCGGCCAAAGGATTCGGAGCACCGCAGCATGGAGGAGAAGCTGAAACAAGAGCACATGACGGAGCGC
GAGATGAAGGAGGCAATACGTGTCACGGAAGAGAGACTACGAGTGCTGCAAGAGGTTGTTTCCAAATCAAGTCTG
GATAAGGAGCGGGGAAGCGAGCAGGCATCCAAGTCATGA
Gene >OphauB2|7566
ATGGACGTGGGCAAGCTTTTGCCAAAGGCCATCTCGGCCAAGCGCCGCCGCCGACGACAGCAAAAAGAGGAGGAG
CGGCGCCGGCGCCATGAGCAGCACGGCGATGACGACGCGACCATGACGAGTGCCAGACGAGGCAGCGACGGCACC
TTTGACTCGACCGACGAGGGCGACGGCGATGGCGACGGCGACGGCAGCTTTGCGTCCTTTGACTCTAGCCCGAGG
CTAGATAGACAGACAGCATCTGACCGGTGAGTGGGTTGCTCGGGGCCGACCATTGTCGTCTTACATACAGCCTTA
TACGTCGTTTTTTATCGCCCTCTCCCTCTCCTACCTCTGCCAACACGTATGCTACAAGGCCGCTGCAACAGGGAA
AAAGCAAACGAGTCTTGCGATTCTTTTTTTCCTTTTTTTCTGCCGACTTGAATGTCAATTCCACTCCCACCCTCT
TTGCAAATCCACCATCCCTGTCCCTGCTCTCTAACCTTCTCTGTCTGACATCAAGCAGAATACCACCAAGGCCAC
GGCGACCCGCTTCTCCTGACGCTCCGGGCTCTACTTCTCCTCCCGCCCGTCCCGCAACCATCTCTACACACCCGT
CCCTCATCGGATACCTAACGACGTCGTCTCCCGTTGTCCAGGCCACCCATCTCGACTCGTGGTCCCAGCTTGACC
CCAGCGGCAAAAACGCCTCGCCCATCTCTCTCCCGAATGCTGACGACCGCACAACGCCGCCGCCCCCACGCATCA
ACACGACCAAACCCGCTCCTCTAATTGTCAGCACTCCGCCAACGCCTGTCGACTCCCTCTCTTTTCCTGACGATA
AGCATCGCATTGCAGATGGCAGCATCTCTCCTGCACAGGGCATGATTGCGCATAGGAAGAGCAAGTCCGGATCTG
CCGCAATCAGCCCTAGTAAACTCTCCAGCGTCACTCTTCCGCCTTCTACACCCTCTATCGACCCCAGTCAACAGA
CACCAACTTCTTCCACTGGCTTCTTCTCTACGGTCATCTCAGCCGCCCAAAACGCTGCCACGACGCTGGGTAACA
ATATACCAGTCAGCGGGATGGGTATAGGCTCTGCCAACAAGAGCAAGTCTAGCCTATCGAGATCGCAAACCGTAT
ACAATCCTCCTACACCTTCCAACCTTGGTCCCACCTCACGAATCCGGTCGACTGACGGCAGCATGGATTCGAAAG
AATCGGCCGTTCAGACACTTGGCGCTGGTGAACTCAGTTTAAGCCAGCTTGGAATCTCTGAACCTACGGGCTCCA
TAACCTCAACCCAGAGCGCAACACTTGCCGACGCGGCCGACGCCAGATCTCGGTCCGACTCGGCGCCCATGGATT
CTCAGCCACGTCCTGCAGAGCCAGCGGTCGAGGAGTCTTCTAGCAGACCCCGCTCTCTACTCGAAGCCAGCCATG
ATGACCATGCCCCATCTCAGGCCGACTCGGACACCAAGGGCAGTGTCCAGCGAAGCTCGAGTATGCGAAGCGGTG
CCAAACCACACCGTAAACGGGGAAGCTCTGTCACAACGGGAGGCACGACAACGACGACTGTCGGCGCACATTCGG
CTGCGGCAAACAGTTCGGGCCCTCCACCCAACACAGCTGCCTATGGGGCACCCAAACTCACGGGCTTCGCAATTG
CTAGCAAGAAGCGAAATCGCGACTTTCACAGCTTTTTCAAGAGCGTTCCAGACGACGACTACTTGATTGAAGACT
ATAGCTGTGCTCTGCAGCGCGAAATCCTTGCCCATGGCAGGTTATACGTGTCGGAGGGACATCTTTGCTTTAGCA
GCAACATTTTGGGCTGGACTACAACATTGGTCATGAGCTTTGATGAAATTGTGTCGGTTGAAAAGAGAAGCACGG
CGCTCGTCTTCAAGAATGGCTTGATGATATCCACCTTGCACGCCAAGCACATTTTCGCCAGCTTTACCAGCAGAG
ACGCCACATATGACTTGATTGTAAATATCTGGAAGCTTGGTCACCCCACACTCAAGAGCACACTGAATGGCGTAC
GACTAGAGGGCACTGGCGGTGACAAGACGGAAAAGGTGGATGCCGATCCTGCCAGTGCCGACAATGAAGTTCAAC
TAGCATCTGATTCGGACGACGAGGGCGATGAGGGCGACGACGATGAAGAAGAAGACGACGACGACGACTTTTACG
ATGAAGAAGAACACGACGATGCCGCCGAAACACATGTGACTGATTCGACGGGCGCCATTGTGGAGCCGGAAAAGT
CGTCGCTTAGAAAGGCGTCAGCCTTGACGGCGCCGAATGGAGCTCCGGCTGACACGGGCCGCGAGACGACGGCAC
CCCCTGGAGGCTCAGTCGACTTTCCCGGCCCTGCTTCTCACCCGCCGACTGACTGCGGCGACTCGGCGTCGCACT
ATGACAAGTTTGTTGGCGATGAAATTATTCCCGCCCCGCTGGGCAAGGTGTACAATCTGGTTTTTGGGCCGGGGT
CGGTGGCATGGATGGCAAAGTGGTTGACGGGAGAGCAAAAATGCACCGACTTGCAAATGGAGGACAGAAAGGGCC
TGAGTGCCGAGAACCGGACGCGCAACTACACCTATGTGAAGCCACTCAATGCGTCAATTGGACCGAAGCAGACAA
AGTGCATCGTGTCGGAAACGCTGGAGAATATTGACTTGGAAAAGGCTGTCAATTTGGTTGTTTCGGTGCAAAATC
CCGATGTGCCGAGCGGCAACATTTTCAGCGTCAAGACGAGATATTGCCTTTCGTGGGCGGAGAATAACGCGACAC
GCCTTCAAGTGAATTGCACGGTTGAGTGGACTGGCAAGAGCTGGATCAAAGGTTGGCTCTTGAGAAGTGTGTGAG
GTGCGCATTATGGCTGCTGACTGTTGTGGGTTAGGTCCAATTGAAAAGGGAGTGAGTGATGGACAGGCACAGTAT
TGCAAAGACTTGTGTGCTGCGCTCAGAGCTGCTGTGACGAGTCGGCCTCGAGCGGCAACTGGTGCGAGCGGACCT
TCGAAGCCTAGAAAGAAGGCTAGGAAGAGCAAAGCACTACAGTCTGGCGATAACAACACGGAAAAGAGGGACGGA
CCCAAGCACGCAGCCAAGCAACAATGGGGTCCTTTGGAGCCTGTGCGAGGCATCATTGAGCCGTGTATTGATATC
CTGGGGCCCGTCTTGACTGGCAACGTCATGTACGGCTTGCTTGTTGGCCTGTTGGTTGCGCTGTGGTTTGGCTTC
GGGTCTGGGCCGAGCAAGAATTCGGTGACGTATGGACCCGAGATGGGCGTCTGGAGCCCGCAGCGACTAGCGGCA
TATGAAGAGATGTGGCGACGGGAGGAGAGCGAACTTTGGTACTGGCTCGAGGAACGTGTTGGGCTGGACCAGCTG
ATGAGTCCGGGCAGCGCAGGCAGTCGGCCAAAGGATTCGGAGCACCGCAGCATGGAGGAGAAGCTGAAACAAGAG
CACATGACGGAGCGCGAGATGAAGGAGGCAATACGTGTCACGGAAGAGAGACTACGAGTGCTGCAAGAGGTTGTT
TCCAAATCAAGTCTGGATAAGGAGCGGGGAAGCGAGCAGGCATCCAAGTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail