Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7565
Gene name
LocationContig_81:70424..71525
Strand-
Gene length (bp)1101
Transcript length (bp)1101
Coding sequence length (bp)1101
Protein length (aa) 367

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07039 DUF1325 SGF29 tudor-like domain 1.8E-35 234 364

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9USW9|SGF29_SCHPO SAGA-associated factor 29 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgf29 PE=1 SV=2 230 364 2.0E-17
sp|P25554|SGF29_YEAST SAGA-associated factor 29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGF29 PE=1 SV=2 235 362 6.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7565
MAHRNRSGRGSSRNNGGNSQHGEEAQIWEACKAQIAEIVTSINAENDNLAQIVSLDKKIGAMDPEKVATDLFRHL
EDRSRAGVKFSETNMMMLKSVIEQLNVLRAVVLAKEQAEGTGHGAGPSGSGNTGGPSKRSTRDKGDGGAAAAAAA
AALYDFEGAGDSPVPSPMAGGSAGRKHGDRASSTRDRDSMPPKADSVEPQGSIAGGSGGSGPGSAVSTSGAAGNG
GNRRVVFSKGDTVAFKPKNSGGEATSDWILGEVAAVLGEGKSRRYKVLDVEPDEEPGKQKEYRTSASSMIAIAPE
SAAGTLKAWEAGKLVLALYPQTTTFYRAEVHSMDEGGRMVNLKFEGENDSTTLQQVERRFVIEYRQ*
Coding >OphauB2|7565
ATGGCCCATCGCAACCGCAGCGGCCGTGGATCAAGCCGTAACAATGGCGGCAATTCACAGCACGGCGAAGAAGCA
CAGATATGGGAAGCCTGCAAGGCGCAAATCGCCGAAATCGTGACTAGCATCAACGCGGAGAACGACAACCTTGCA
CAAATCGTCAGCCTGGACAAGAAGATTGGGGCCATGGATCCGGAAAAGGTGGCGACTGATTTGTTTCGCCATCTT
GAGGATCGGTCTCGTGCAGGCGTCAAGTTTTCCGAGACCAACATGATGATGCTCAAGTCGGTCATTGAGCAACTC
AATGTCTTGCGCGCCGTGGTGCTGGCAAAAGAACAAGCCGAGGGCACAGGACATGGCGCTGGCCCTTCAGGTTCC
GGAAACACGGGCGGTCCGAGCAAACGCTCAACCAGAGATAAGGGTGACGGGGGTGCAGCAGCAGCAGCGGCCGCC
GCCGCCTTGTACGACTTTGAGGGAGCCGGAGACTCTCCTGTGCCGAGCCCAATGGCTGGCGGCTCAGCTGGCAGG
AAGCATGGAGACCGGGCATCAAGCACGCGTGATCGAGATAGCATGCCGCCCAAGGCAGACAGCGTGGAACCGCAA
GGCTCAATCGCCGGCGGCTCTGGTGGCTCCGGCCCCGGCTCGGCAGTTTCCACATCGGGCGCAGCAGGTAACGGT
GGCAATCGGCGCGTCGTCTTCAGCAAAGGCGACACGGTGGCGTTTAAGCCCAAAAATTCTGGCGGCGAGGCTACG
TCGGACTGGATCTTGGGAGAGGTGGCAGCTGTGCTGGGCGAAGGCAAGAGTCGGAGATACAAGGTGCTCGATGTT
GAGCCTGATGAGGAGCCAGGAAAGCAAAAGGAGTACCGTACGAGTGCAAGCAGCATGATTGCCATTGCGCCCGAG
AGCGCGGCCGGGACACTCAAGGCATGGGAGGCGGGCAAGCTGGTACTGGCGCTCTATCCCCAAACGACGACATTC
TACAGAGCCGAGGTGCACAGCATGGACGAGGGGGGCCGAATGGTCAATCTCAAGTTTGAAGGGGAAAACGACTCG
ACAACATTGCAGCAGGTCGAGCGGCGGTTTGTCATTGAATACAGGCAATGA
Transcript >OphauB2|7565
ATGGCCCATCGCAACCGCAGCGGCCGTGGATCAAGCCGTAACAATGGCGGCAATTCACAGCACGGCGAAGAAGCA
CAGATATGGGAAGCCTGCAAGGCGCAAATCGCCGAAATCGTGACTAGCATCAACGCGGAGAACGACAACCTTGCA
CAAATCGTCAGCCTGGACAAGAAGATTGGGGCCATGGATCCGGAAAAGGTGGCGACTGATTTGTTTCGCCATCTT
GAGGATCGGTCTCGTGCAGGCGTCAAGTTTTCCGAGACCAACATGATGATGCTCAAGTCGGTCATTGAGCAACTC
AATGTCTTGCGCGCCGTGGTGCTGGCAAAAGAACAAGCCGAGGGCACAGGACATGGCGCTGGCCCTTCAGGTTCC
GGAAACACGGGCGGTCCGAGCAAACGCTCAACCAGAGATAAGGGTGACGGGGGTGCAGCAGCAGCAGCGGCCGCC
GCCGCCTTGTACGACTTTGAGGGAGCCGGAGACTCTCCTGTGCCGAGCCCAATGGCTGGCGGCTCAGCTGGCAGG
AAGCATGGAGACCGGGCATCAAGCACGCGTGATCGAGATAGCATGCCGCCCAAGGCAGACAGCGTGGAACCGCAA
GGCTCAATCGCCGGCGGCTCTGGTGGCTCCGGCCCCGGCTCGGCAGTTTCCACATCGGGCGCAGCAGGTAACGGT
GGCAATCGGCGCGTCGTCTTCAGCAAAGGCGACACGGTGGCGTTTAAGCCCAAAAATTCTGGCGGCGAGGCTACG
TCGGACTGGATCTTGGGAGAGGTGGCAGCTGTGCTGGGCGAAGGCAAGAGTCGGAGATACAAGGTGCTCGATGTT
GAGCCTGATGAGGAGCCAGGAAAGCAAAAGGAGTACCGTACGAGTGCAAGCAGCATGATTGCCATTGCGCCCGAG
AGCGCGGCCGGGACACTCAAGGCATGGGAGGCGGGCAAGCTGGTACTGGCGCTCTATCCCCAAACGACGACATTC
TACAGAGCCGAGGTGCACAGCATGGACGAGGGGGGCCGAATGGTCAATCTCAAGTTTGAAGGGGAAAACGACTCG
ACAACATTGCAGCAGGTCGAGCGGCGGTTTGTCATTGAATACAGGCAATGA
Gene >OphauB2|7565
ATGGCCCATCGCAACCGCAGCGGCCGTGGATCAAGCCGTAACAATGGCGGCAATTCACAGCACGGCGAAGAAGCA
CAGATATGGGAAGCCTGCAAGGCGCAAATCGCCGAAATCGTGACTAGCATCAACGCGGAGAACGACAACCTTGCA
CAAATCGTCAGCCTGGACAAGAAGATTGGGGCCATGGATCCGGAAAAGGTGGCGACTGATTTGTTTCGCCATCTT
GAGGATCGGTCTCGTGCAGGCGTCAAGTTTTCCGAGACCAACATGATGATGCTCAAGTCGGTCATTGAGCAACTC
AATGTCTTGCGCGCCGTGGTGCTGGCAAAAGAACAAGCCGAGGGCACAGGACATGGCGCTGGCCCTTCAGGTTCC
GGAAACACGGGCGGTCCGAGCAAACGCTCAACCAGAGATAAGGGTGACGGGGGTGCAGCAGCAGCAGCGGCCGCC
GCCGCCTTGTACGACTTTGAGGGAGCCGGAGACTCTCCTGTGCCGAGCCCAATGGCTGGCGGCTCAGCTGGCAGG
AAGCATGGAGACCGGGCATCAAGCACGCGTGATCGAGATAGCATGCCGCCCAAGGCAGACAGCGTGGAACCGCAA
GGCTCAATCGCCGGCGGCTCTGGTGGCTCCGGCCCCGGCTCGGCAGTTTCCACATCGGGCGCAGCAGGTAACGGT
GGCAATCGGCGCGTCGTCTTCAGCAAAGGCGACACGGTGGCGTTTAAGCCCAAAAATTCTGGCGGCGAGGCTACG
TCGGACTGGATCTTGGGAGAGGTGGCAGCTGTGCTGGGCGAAGGCAAGAGTCGGAGATACAAGGTGCTCGATGTT
GAGCCTGATGAGGAGCCAGGAAAGCAAAAGGAGTACCGTACGAGTGCAAGCAGCATGATTGCCATTGCGCCCGAG
AGCGCGGCCGGGACACTCAAGGCATGGGAGGCGGGCAAGCTGGTACTGGCGCTCTATCCCCAAACGACGACATTC
TACAGAGCCGAGGTGCACAGCATGGACGAGGGGGGCCGAATGGTCAATCTCAAGTTTGAAGGGGAAAACGACTCG
ACAACATTGCAGCAGGTCGAGCGGCGGTTTGTCATTGAATACAGGCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail