Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|756
Gene name
LocationContig_115:53212..54847
Strand+
Gene length (bp)1635
Transcript length (bp)1314
Coding sequence length (bp)1314
Protein length (aa) 438

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2500
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1502
Ophiocordyceps australis map64 (Brazil) OphauB2|756 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06024
Ophiocordyceps camponoti-rufipedis Ophun1|6835
Ophiocordyceps kimflemingae Ophio5|391
Ophiocordyceps subramaniannii Hirsu2|3623

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|756
MDPTTTLITFLLQTDPSVQTVELIGSWDNFSSCYTMKRDVRRGQGQWRGCYSFKNIVCDDTALKRTKRNGGLKMG
ATYYYYYEIDGSIETYDAAEPWTTSCPYLPGQAVNTLIVPIEHSIRKRSASLNSMREESFRTMDPNAKFTKPQPV
PTLMAEISRRRLDTATPIFHSRPAVRPPSPIFLWRRFFGRRQTSRAPTRDVETKLALRAETDQMRGFTSSESSIS
TKASIESMVQSLPPHSAGALQPRRSREPVLSIPEDIVEEADDEVPSFGPVAPQRAGQAASLSPNSLHSECFSPSK
AVGKVACSPSISSSMLTSSVSPTLGEDEPPSFYDSNDDDEVLSSNDGDNYPHQSLPGLCVPGYGFAGYSLPRQTD
YTKGMTSSPPMQAFGLPRLVARSEATVPLSGTNLLATTIDSDLDDFVHEMGWMVDVIGNKQT*
Coding >OphauB2|756
ATGGATCCAACGACTACCCTCATCACCTTTTTGCTCCAAACGGACCCTTCAGTTCAAACTGTCGAGCTCATTGGC
TCGTGGGACAACTTTTCGTCATGTTATACAATGAAGCGAGACGTGAGACGCGGCCAGGGACAATGGAGAGGATGC
TACTCGTTCAAGAATATTGTTTGCGACGACACTGCTCTCAAGCGGACAAAGAGAAATGGTGGTCTCAAAATGGGC
GCCACTTATTACTACTATTACGAGATAGATGGCTCGATTGAGACGTATGATGCAGCTGAGCCATGGACCACGTCT
TGTCCCTATTTGCCTGGCCAGGCAGTCAACACGCTCATTGTCCCCATTGAGCACTCGATTCGCAAGCGCAGCGCA
TCTCTTAATTCTATGCGCGAAGAGAGTTTTAGAACCATGGATCCAAACGCCAAGTTTACAAAACCCCAACCCGTT
CCCACTTTGATGGCCGAAATTTCCCGACGCCGCTTAGATACCGCTACTCCCATCTTCCACAGCCGTCCTGCAGTT
CGTCCGCCTTCTCCAATTTTCCTGTGGAGACGGTTCTTTGGCCGCCGGCAAACAAGTCGAGCCCCAACCCGCGAC
GTCGAGACTAAGCTTGCGCTCCGTGCCGAGACGGATCAGATGCGTGGATTTACTTCTTCAGAAAGCAGCATATCC
ACAAAGGCATCTATTGAATCAATGGTACAGTCGCTTCCTCCGCATAGCGCCGGGGCTTTGCAGCCACGTCGTAGC
AGAGAACCCGTCTTGAGCATTCCCGAAGATATTGTTGAGGAAGCCGATGACGAAGTTCCTTCTTTTGGCCCGGTT
GCCCCGCAACGCGCTGGCCAGGCTGCAAGTTTATCGCCAAACTCGCTCCACTCTGAATGCTTTAGCCCCTCAAAG
GCTGTTGGCAAGGTTGCCTGTTCTCCGTCGATTAGTTCAAGTATGCTTACGTCGTCTGTGTCTCCGACGCTGGGC
GAGGACGAACCTCCGTCATTTTACGACTCGAATGACGACGACGAGGTCTTGTCGAGTAACGACGGCGACAACTAT
CCCCACCAGTCCTTGCCGGGTCTTTGTGTCCCAGGATACGGATTTGCCGGATACAGCCTTCCTCGACAGACGGAC
TATACAAAAGGCATGACTTCTAGTCCACCTATGCAAGCATTTGGTTTACCGCGTCTTGTGGCCCGGAGCGAGGCG
ACAGTGCCATTGAGCGGCACTAATTTACTGGCTACAACGATTGACAGTGATCTGGACGATTTTGTCCACGAAATG
GGCTGGATGGTTGATGTCATTGGCAACAAGCAGACATGA
Transcript >OphauB2|756
ATGGATCCAACGACTACCCTCATCACCTTTTTGCTCCAAACGGACCCTTCAGTTCAAACTGTCGAGCTCATTGGC
TCGTGGGACAACTTTTCGTCATGTTATACAATGAAGCGAGACGTGAGACGCGGCCAGGGACAATGGAGAGGATGC
TACTCGTTCAAGAATATTGTTTGCGACGACACTGCTCTCAAGCGGACAAAGAGAAATGGTGGTCTCAAAATGGGC
GCCACTTATTACTACTATTACGAGATAGATGGCTCGATTGAGACGTATGATGCAGCTGAGCCATGGACCACGTCT
TGTCCCTATTTGCCTGGCCAGGCAGTCAACACGCTCATTGTCCCCATTGAGCACTCGATTCGCAAGCGCAGCGCA
TCTCTTAATTCTATGCGCGAAGAGAGTTTTAGAACCATGGATCCAAACGCCAAGTTTACAAAACCCCAACCCGTT
CCCACTTTGATGGCCGAAATTTCCCGACGCCGCTTAGATACCGCTACTCCCATCTTCCACAGCCGTCCTGCAGTT
CGTCCGCCTTCTCCAATTTTCCTGTGGAGACGGTTCTTTGGCCGCCGGCAAACAAGTCGAGCCCCAACCCGCGAC
GTCGAGACTAAGCTTGCGCTCCGTGCCGAGACGGATCAGATGCGTGGATTTACTTCTTCAGAAAGCAGCATATCC
ACAAAGGCATCTATTGAATCAATGGTACAGTCGCTTCCTCCGCATAGCGCCGGGGCTTTGCAGCCACGTCGTAGC
AGAGAACCCGTCTTGAGCATTCCCGAAGATATTGTTGAGGAAGCCGATGACGAAGTTCCTTCTTTTGGCCCGGTT
GCCCCGCAACGCGCTGGCCAGGCTGCAAGTTTATCGCCAAACTCGCTCCACTCTGAATGCTTTAGCCCCTCAAAG
GCTGTTGGCAAGGTTGCCTGTTCTCCGTCGATTAGTTCAAGTATGCTTACGTCGTCTGTGTCTCCGACGCTGGGC
GAGGACGAACCTCCGTCATTTTACGACTCGAATGACGACGACGAGGTCTTGTCGAGTAACGACGGCGACAACTAT
CCCCACCAGTCCTTGCCGGGTCTTTGTGTCCCAGGATACGGATTTGCCGGATACAGCCTTCCTCGACAGACGGAC
TATACAAAAGGCATGACTTCTAGTCCACCTATGCAAGCATTTGGTTTACCGCGTCTTGTGGCCCGGAGCGAGGCG
ACAGTGCCATTGAGCGGCACTAATTTACTGGCTACAACGATTGACAGTGATCTGGACGATTTTGTCCACGAAATG
GGCTGGATGGTTGATGTCATTGGCAACAAGCAGACATGA
Gene >OphauB2|756
ATGGATCCAACGACTACCCTCATCACCTTTTTGCTGTAAGTGTACCCTCCCTTACTCGCACCATGATCAATCAAC
ACTACAAGTTTTGCGACTGCCTCGATTCTCAACATGTATATTCTTGTGTGTCATTACTCTGCTGGTTCAATTTCA
TTGCCAATCCATCGTCAAATGTCATTGCTATAAATGCCAAGTCGGGGGCAATAAGAAGCTTCTTCTCCACATTTG
CCCTTTTTTCCCAGAAATTTAGCTAGCCTACTACATGGATGCAAGACATCATGGCAGCTAACACTGTTGCTTAGC
CAAACGGACCCTTCAGTTCAAACTGTCGAGCTCATTGGCTCGTGGGACAACTTTTCGTCATGTTATACAATGAAG
CGAGACGTGAGACGCGGCCAGGGACAATGGAGAGGATGCTACTCGTTCAAGAATATTGTTTGCGACGACACTGCT
CTCAAGCGGACAAAGAGAAATGGTGGTCTCAAAATGGGCGCCACTTATTACTACTATGTAGGACCGACTTGCTGC
CGTCAACGCCAGCCCTGTTTTGCTAACCAATCATCTTAGTACGAGATAGATGGCTCGATTGAGACGTATGATGCA
GCTGAGCCATGGACCACGTCTTGTCCCTATTTGCCTGGCCAGGCAGTCAACACGCTCATTGTCCCCATTGAGCAC
TCGATTCGCAAGCGCAGCGCATCTCTTAATTCTATGCGCGAAGAGAGTTTTAGAACCATGGATCCAAACGCCAAG
TTTACAAAACCCCAACCCGTTCCCACTTTGATGGCCGAAATTTCCCGACGCCGCTTAGATACCGCTACTCCCATC
TTCCACAGCCGTCCTGCAGTTCGTCCGCCTTCTCCAATTTTCCTGTGGAGACGGTTCTTTGGCCGCCGGCAAACA
AGTCGAGCCCCAACCCGCGACGTCGAGACTAAGCTTGCGCTCCGTGCCGAGACGGATCAGATGCGTGGATTTACT
TCTTCAGAAAGCAGCATATCCACAAAGGCATCTATTGAATCAATGGTACAGTCGCTTCCTCCGCATAGCGCCGGG
GCTTTGCAGCCACGTCGTAGCAGAGAACCCGTCTTGAGCATTCCCGAAGATATTGTTGAGGAAGCCGATGACGAA
GTTCCTTCTTTTGGCCCGGTTGCCCCGCAACGCGCTGGCCAGGCTGCAAGTTTATCGCCAAACTCGCTCCACTCT
GAATGCTTTAGCCCCTCAAAGGCTGTTGGCAAGGTTGCCTGTTCTCCGTCGATTAGTTCAAGTATGCTTACGTCG
TCTGTGTCTCCGACGCTGGGCGAGGACGAACCTCCGTCATTTTACGACTCGAATGACGACGACGAGGTCTTGTCG
AGTAACGACGGCGACAACTATCCCCACCAGTCCTTGCCGGGTCTTTGTGTCCCAGGATACGGATTTGCCGGATAC
AGCCTTCCTCGACAGACGGACTATACAAAAGGCATGACTTCTAGTCCACCTATGCAAGCATTTGGTTTACCGCGT
CTTGTGGCCCGGAGCGAGGCGACAGTGCCATTGAGCGGCACTAATTTACTGGCTACAACGATTGACAGTGATCTG
GACGATTTTGTCCACGAAATGGGCTGGATGGTTGATGTCATTGGCAACAAGCAGACATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail