Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7554
Gene name
LocationContig_81:40710..43326
Strand-
Gene length (bp)2616
Transcript length (bp)2238
Coding sequence length (bp)2238
Protein length (aa) 746

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 2.6E-14 308 411
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 3.3E-06 41 77

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O59741|YN25_SCHPO Uncharacterized transcriptional regulatory protein C530.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.05 PE=3 SV=2 290 468 3.0E-08
sp|P40467|ASG1_YEAST Activator of stress genes 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASG1 PE=1 SV=1 313 505 8.0E-07

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0008270 zinc ion binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0003700 DNA-binding transcription factor activity No
GO:0060255 regulation of macromolecule metabolic process No
GO:0050789 regulation of biological process No
GO:0018130 heterocycle biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0046872 metal ion binding No
GO:0043167 ion binding No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009889 regulation of biosynthetic process No
GO:0003674 molecular_function No
GO:0009059 macromolecule biosynthetic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0140110 transcription regulator activity No
GO:0010468 regulation of gene expression No
GO:0043170 macromolecule metabolic process No
GO:0046914 transition metal ion binding No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0016070 RNA metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0003676 nucleic acid binding No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0009987 cellular process No
GO:0019222 regulation of metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0050794 regulation of cellular process No
GO:1901363 heterocyclic compound binding No
GO:0044249 cellular biosynthetic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0090304 nucleic acid metabolic process No
GO:0065007 biological regulation No
GO:0043169 cation binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup713
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6248
Ophiocordyceps australis map64 (Brazil) OphauB2|7554 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06918
Ophiocordyceps camponoti-rufipedis Ophun1|1928
Ophiocordyceps kimflemingae Ophio5|5964
Ophiocordyceps subramaniannii Hirsu2|1521
Ophiocordyceps subramaniannii Hirsu2|9798

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7554
MHGATTSPVDAPDAGPQKRPSVGSEAQAPRRPKRGKYTPVACDECKKRKLKCIPVDEGSCERCIASGLTCAYAAG
PSQATRNKHESQQVRTLSEDVAQLRQQVADLVGTVKTLKDGVPLQRPLSASAHSQDAPTLVQSPSTSGVPPKAPQ
FIGPTRPAYGLVVGERSLTRMGIPTYESPPPSGAQSSSEEPEPLPRPPGSITNEAEFWLHCTPAEVARLLSVFEE
EVESVYPFIDIVELSSRAEQILDVMRNRRPLDMAEGLELPVTLRDIEMTKIAVATGLVIEGHGKTELSTAMAESV
ERQVSRISSPEVELKEIQLLTMLSIYYFHCDEDLLAWRTIGIAAREALEMGLHRRKSLLDNFKDTGSRRLATRVF
WCVYVLDRRWSFGTSLSFALADRDIDPNLPEPDADFSYLKCMVGYARLCSKLWEAIPPFGSQSQSIPEDAVQALD
LRTQDWLESIPSHLRLRHPRLGLAARSQPRLLQRLRALLYLRGNHTRISIYQHFLLSASSIMANLQRAWLVVNIA
QDSVEVLVHLNATTDIYSRQQNAFNYFLLSALAVIFLSVCHAPNIFTEPCRKCFLDAVELVRGFSRHSAVSRRLW
KSIRGLLPRLKSLGIQSNSAEGSQGGEVAVVQQQTSPVAGSTVGGGPNNMPTADTMGSGSDFRELSHPVRAESGA
VTLWDTRASSDMMADTDLSGSVPDMFQMRNDLLDLFDALGQGQSYPGEFGTNFYSPGETDAFNRRLQGLI*
Coding >OphauB2|7554
ATGCATGGAGCAACAACCTCACCGGTCGATGCTCCTGATGCCGGGCCGCAGAAACGACCGTCTGTTGGCAGTGAG
GCACAGGCTCCTCGCCGCCCCAAGCGCGGCAAGTACACGCCTGTTGCCTGTGACGAGTGCAAGAAGAGAAAGCTA
AAATGCATCCCCGTCGACGAGGGGAGCTGCGAGCGCTGCATTGCCAGCGGCTTGACGTGCGCCTACGCTGCTGGA
CCGTCTCAGGCTACTCGCAACAAGCATGAGAGCCAGCAAGTCCGCACGCTCAGCGAAGACGTGGCTCAGCTCCGC
CAGCAAGTCGCCGATCTGGTTGGCACCGTCAAGACGCTCAAGGATGGCGTTCCTCTCCAACGGCCTCTCTCAGCA
TCTGCTCATTCGCAAGATGCGCCCACGCTTGTCCAGTCACCCTCTACCTCTGGCGTGCCGCCCAAGGCGCCTCAG
TTTATTGGCCCTACGCGGCCGGCATATGGCTTGGTTGTTGGCGAGCGCTCTCTTACCCGAATGGGCATCCCTACC
TATGAATCGCCTCCTCCCAGCGGCGCCCAGTCCTCCAGCGAGGAGCCTGAGCCTCTGCCTCGTCCCCCTGGCTCC
ATCACCAACGAGGCGGAATTTTGGCTCCACTGCACCCCGGCCGAGGTGGCCAGGCTACTCTCCGTCTTTGAGGAG
GAAGTCGAGTCGGTTTACCCCTTTATCGATATTGTCGAGCTCTCGTCGCGCGCAGAGCAAATCCTCGATGTCATG
CGTAACCGCCGGCCCTTGGACATGGCTGAAGGCCTCGAGCTGCCCGTAACCTTGCGCGATATTGAAATGACCAAG
ATTGCCGTTGCCACTGGCCTCGTCATTGAGGGCCATGGAAAGACTGAGCTGAGCACTGCCATGGCTGAGTCTGTT
GAGCGCCAAGTGTCGCGCATATCAAGTCCCGAGGTTGAACTTAAGGAGATTCAATTACTCACCATGCTGAGCATC
TATTATTTCCACTGTGATGAAGATTTGCTCGCCTGGCGCACAATTGGAATCGCCGCCCGGGAGGCCCTTGAAATG
GGACTTCACCGCCGCAAGAGTCTTCTTGACAACTTTAAAGATACAGGGTCGCGGCGTCTTGCCACTCGTGTCTTT
TGGTGTGTCTATGTTCTTGACCGCCGCTGGAGCTTTGGCACCAGCCTTTCCTTTGCTCTCGCGGACCGTGATATT
GACCCTAATCTTCCCGAGCCGGATGCCGACTTTTCCTACCTCAAGTGTATGGTGGGATATGCCCGGCTCTGCTCC
AAACTGTGGGAAGCCATACCACCGTTTGGCTCGCAGTCGCAATCGATTCCCGAGGATGCTGTCCAAGCCCTTGAT
CTTCGTACTCAAGACTGGCTTGAATCTATTCCATCTCACCTCCGTCTACGGCACCCACGCCTCGGCCTCGCTGCC
CGATCCCAGCCGCGACTTTTGCAGCGGCTTCGGGCTTTGCTCTACCTGCGCGGCAATCACACCCGCATTTCCATC
TACCAGCACTTTTTACTCAGTGCTTCGAGTATCATGGCTAATTTGCAGAGGGCCTGGCTAGTTGTAAACATTGCC
CAGGACAGCGTCGAAGTCTTGGTTCATCTCAATGCAACGACGGACATTTACTCGCGCCAGCAAAATGCCTTCAAC
TACTTTTTGCTGAGTGCCCTGGCCGTCATCTTTCTGTCGGTCTGCCACGCGCCCAACATCTTTACCGAGCCCTGC
CGCAAGTGCTTTCTTGACGCAGTTGAGCTAGTCAGGGGCTTTTCTCGGCACAGCGCCGTCAGTCGACGTTTGTGG
AAGAGCATCCGTGGCCTGCTGCCTCGTCTCAAGAGCCTTGGAATTCAGAGCAACTCGGCCGAGGGCAGCCAAGGC
GGCGAAGTGGCAGTAGTACAGCAGCAGACGAGTCCTGTCGCTGGCTCTACAGTTGGCGGCGGGCCCAATAATATG
CCCACTGCCGATACCATGGGAAGCGGCTCCGACTTTCGAGAATTATCGCATCCCGTCAGAGCAGAGAGCGGTGCA
GTGACTCTTTGGGACACACGAGCCAGCAGCGACATGATGGCCGACACGGATCTAAGCGGCTCAGTGCCTGACATG
TTTCAAATGCGCAACGATTTGTTGGATCTTTTTGATGCGCTCGGCCAGGGGCAGAGTTACCCTGGAGAGTTTGGC
ACCAATTTTTACAGCCCTGGTGAGACAGATGCCTTCAACCGTAGGCTTCAGGGGTTGATATAG
Transcript >OphauB2|7554
ATGCATGGAGCAACAACCTCACCGGTCGATGCTCCTGATGCCGGGCCGCAGAAACGACCGTCTGTTGGCAGTGAG
GCACAGGCTCCTCGCCGCCCCAAGCGCGGCAAGTACACGCCTGTTGCCTGTGACGAGTGCAAGAAGAGAAAGCTA
AAATGCATCCCCGTCGACGAGGGGAGCTGCGAGCGCTGCATTGCCAGCGGCTTGACGTGCGCCTACGCTGCTGGA
CCGTCTCAGGCTACTCGCAACAAGCATGAGAGCCAGCAAGTCCGCACGCTCAGCGAAGACGTGGCTCAGCTCCGC
CAGCAAGTCGCCGATCTGGTTGGCACCGTCAAGACGCTCAAGGATGGCGTTCCTCTCCAACGGCCTCTCTCAGCA
TCTGCTCATTCGCAAGATGCGCCCACGCTTGTCCAGTCACCCTCTACCTCTGGCGTGCCGCCCAAGGCGCCTCAG
TTTATTGGCCCTACGCGGCCGGCATATGGCTTGGTTGTTGGCGAGCGCTCTCTTACCCGAATGGGCATCCCTACC
TATGAATCGCCTCCTCCCAGCGGCGCCCAGTCCTCCAGCGAGGAGCCTGAGCCTCTGCCTCGTCCCCCTGGCTCC
ATCACCAACGAGGCGGAATTTTGGCTCCACTGCACCCCGGCCGAGGTGGCCAGGCTACTCTCCGTCTTTGAGGAG
GAAGTCGAGTCGGTTTACCCCTTTATCGATATTGTCGAGCTCTCGTCGCGCGCAGAGCAAATCCTCGATGTCATG
CGTAACCGCCGGCCCTTGGACATGGCTGAAGGCCTCGAGCTGCCCGTAACCTTGCGCGATATTGAAATGACCAAG
ATTGCCGTTGCCACTGGCCTCGTCATTGAGGGCCATGGAAAGACTGAGCTGAGCACTGCCATGGCTGAGTCTGTT
GAGCGCCAAGTGTCGCGCATATCAAGTCCCGAGGTTGAACTTAAGGAGATTCAATTACTCACCATGCTGAGCATC
TATTATTTCCACTGTGATGAAGATTTGCTCGCCTGGCGCACAATTGGAATCGCCGCCCGGGAGGCCCTTGAAATG
GGACTTCACCGCCGCAAGAGTCTTCTTGACAACTTTAAAGATACAGGGTCGCGGCGTCTTGCCACTCGTGTCTTT
TGGTGTGTCTATGTTCTTGACCGCCGCTGGAGCTTTGGCACCAGCCTTTCCTTTGCTCTCGCGGACCGTGATATT
GACCCTAATCTTCCCGAGCCGGATGCCGACTTTTCCTACCTCAAGTGTATGGTGGGATATGCCCGGCTCTGCTCC
AAACTGTGGGAAGCCATACCACCGTTTGGCTCGCAGTCGCAATCGATTCCCGAGGATGCTGTCCAAGCCCTTGAT
CTTCGTACTCAAGACTGGCTTGAATCTATTCCATCTCACCTCCGTCTACGGCACCCACGCCTCGGCCTCGCTGCC
CGATCCCAGCCGCGACTTTTGCAGCGGCTTCGGGCTTTGCTCTACCTGCGCGGCAATCACACCCGCATTTCCATC
TACCAGCACTTTTTACTCAGTGCTTCGAGTATCATGGCTAATTTGCAGAGGGCCTGGCTAGTTGTAAACATTGCC
CAGGACAGCGTCGAAGTCTTGGTTCATCTCAATGCAACGACGGACATTTACTCGCGCCAGCAAAATGCCTTCAAC
TACTTTTTGCTGAGTGCCCTGGCCGTCATCTTTCTGTCGGTCTGCCACGCGCCCAACATCTTTACCGAGCCCTGC
CGCAAGTGCTTTCTTGACGCAGTTGAGCTAGTCAGGGGCTTTTCTCGGCACAGCGCCGTCAGTCGACGTTTGTGG
AAGAGCATCCGTGGCCTGCTGCCTCGTCTCAAGAGCCTTGGAATTCAGAGCAACTCGGCCGAGGGCAGCCAAGGC
GGCGAAGTGGCAGTAGTACAGCAGCAGACGAGTCCTGTCGCTGGCTCTACAGTTGGCGGCGGGCCCAATAATATG
CCCACTGCCGATACCATGGGAAGCGGCTCCGACTTTCGAGAATTATCGCATCCCGTCAGAGCAGAGAGCGGTGCA
GTGACTCTTTGGGACACACGAGCCAGCAGCGACATGATGGCCGACACGGATCTAAGCGGCTCAGTGCCTGACATG
TTTCAAATGCGCAACGATTTGTTGGATCTTTTTGATGCGCTCGGCCAGGGGCAGAGTTACCCTGGAGAGTTTGGC
ACCAATTTTTACAGCCCTGGTGAGACAGATGCCTTCAACCGTAGGCTTCAGGGGTTGATATAG
Gene >OphauB2|7554
ATGCATGGAGCAACAACCTCACCGGTCGATGCTCCTGATGCCGGGCCGCAGAAACGACCGTCTGTTGGCAGTGAG
GCACAGGCTCCTCGCCGCCCCAAGCGCGGCAAGTACACGCCTGTTGCCTGGTAAGGGCCTCGACTCTGCTGCTCA
TTGCTTTTTGCGCTTGTCCAGAGGCTGTCCAGAGGCTCATGAGGTGTCGTAGTGACGAGTGCAAGAAGAGAAAGC
TAAAATGCATCCCCGTCGACGAGGGGAGCTGCGAGCGCTGCATTGCCAGCGGCTTGACGTGCGCCTACGCTGCTG
GACCGTCTCAGGCTACTCGCAACAAGCATGAGAGGTGGGCAACCCCAGCTCAACCATTCATCAGCTCTCCATGGT
CCTCTCTACCCAAACTGGCTTTGCTAATACTCCACAGCCAGCAAGTCCGCACGCTCAGCGAAGACGTGGCTCAGC
TCCGCCAGCAAGTCGCCGATCTGGTTGGCACCGTCAAGACGCTCAAGGATGGCGTTCCTCTCCAACGGCCTCTCT
CAGCATCTGCTCATTCGCAAGATGCGCCCACGCTTGTCCAGTCACCCTCTACCTCTGGCGTGCCGCCCAAGGCGC
CTCAGTTTATTGGCCCTACGCGGCCGGCATATGGCTTGGTTGTTGGCGAGCGCTCTCTTACCCGAATGGGCATCC
CTACCTATGAATCGCCTCCTCCCAGCGGCGCCCAGTCCTCCAGCGAGGAGCCTGAGCCTCTGCCTCGTCCCCCTG
GCTCCATCACCAACGAGGCGGAATTTTGGCTCCACTGCACCCCGGCCGAGGTGGCCAGGCTACTCTCCGTCTTTG
AGGAGGAAGTCGAGTCGGTTTACCCCTTTATCGATATTGTCGAGCTCTCGTCGCGCGCAGAGCAAATCCTCGATG
TCATGCGTAACCGCCGGCCCTTGGACATGGCTGAAGGCCTCGAGCTGCCCGTAACCTTGCGCGATATTGAAATGA
CCAAGATTGCCGTTGCCACTGGCCTCGTCATTGAGGGCCATGGAAAGACTGAGCTGAGCACTGCCATGGCTGAGT
CTGTTGAGCGCCAAGTGTCGCGCATATCAAGTCCCGAGGTTGAACTTAAGGAGATTCAATTACTCACCATGCTGG
TATGTCTCTTGTCCTGGTCTTGTCTAATTGTCTCGTCTTTACCACGTGGTCTCTTTCCGCAAGGGCCTTTTAAGA
TGTGGCCTTGTTCTACCTTTTTCTTTAGCACCAGAGCATCTCTTACTGACGTTTTGAGGATTCAAGAGCATCTAT
TATTTCCACTGTGATGAAGATTTGCTCGCCTGGCGCACAATTGGAATCGCCGCCCGGGAGGCCCTTGAAATGGGA
CTTCACCGCCGCAAGAGTCTTCTTGACAACTTTAAAGATACAGGGTCGCGGCGTCTTGCCACTCGTGTCTTTTGG
TGTGTCTATGTTCTTGACCGCCGCTGGAGCTTTGGCACCAGCCTTTCCTTTGCTCTCGCGGACCGTGATATTGAC
CCTAATCTTCCCGAGCCGGCAAGTCATCCCCAAGCACTTTTCCAGACCTGAAACATGAGCAATGCGTCTTCTTAC
ATTTCCTTCTTTACCCCTCTGCAGGATGCCGACTTTTCCTACCTCAAGTGTATGGTGGGATATGCCCGGCTCTGC
TCCAAACTGTGGGAAGCCATACCACCGTTTGGCTCGCAGTCGCAATCGATTCCCGAGGATGCTGTCCAAGCCCTT
GATCTTCGTACTCAAGACTGGCTTGAATCTATTCCATCTCACCTCCGTCTACGGCACCCACGCCTCGGCCTCGCT
GCCCGATCCCAGCCGCGACTTTTGCAGCGGCTTCGGGCTTTGCTCTACCTGCGCGGCAATCACACCCGCATTTCC
ATCTACCAGCACTTTTTACTCAGTGCTTCGAGTATCATGGCTAATTTGCAGAGGGCCTGGCTAGTTGTAAACATT
GCCCAGGACAGCGTCGAAGTCTTGGTTCATCTCAATGCAACGACGGACATTTACTCGCGCCAGCAAAATGCCTTC
AACTACTTTTTGCTGAGTGCCCTGGCCGTCATCTTTCTGTCGGTCTGCCACGCGCCCAACATCTTTACCGAGCCC
TGCCGCAAGTGCTTTCTTGACGCAGTTGAGCTAGTCAGGGGCTTTTCTCGGCACAGCGCCGTCAGTCGACGTTTG
TGGAAGAGCATCCGTGGCCTGCTGCCTCGTCTCAAGAGCCTTGGAATTCAGAGCAACTCGGCCGAGGGCAGCCAA
GGCGGCGAAGTGGCAGTAGTACAGCAGCAGACGAGTCCTGTCGCTGGCTCTACAGTTGGCGGCGGGCCCAATAAT
ATGCCCACTGCCGATACCATGGGAAGCGGCTCCGACTTTCGAGAATTATCGCATCCCGTCAGAGCAGAGAGCGGT
GCAGTGACTCTTTGGGACACACGAGCCAGCAGCGACATGATGGCCGACACGGATCTAAGCGGCTCAGTGCCTGAC
ATGTTTCAAATGCGCAACGATTTGTTGGATCTTTTTGATGCGCTCGGCCAGGGGCAGAGTTACCCTGGAGAGTTT
GGCACCAATTTTTACAGCCCTGGTGAGACAGATGCCTTCAACCGTAGGCTTCAGGGGTTGATATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail