Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7551
Gene name
LocationContig_81:34043..36346
Strand+
Gene length (bp)2303
Transcript length (bp)2049
Coding sequence length (bp)2049
Protein length (aa) 683

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01179 Cu_amine_oxid Copper amine oxidase, enzyme domain 2.3E-159 252 652
PF02728 Cu_amine_oxidN3 Copper amine oxidase, N3 domain 7.6E-06 112 208

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12556|AMO1_ASPNG Copper amine oxidase 1 OS=Aspergillus niger GN=AO-I PE=1 SV=2 5 669 0.0E+00
sp|Q9P7F2|CAO1_SCHPO Copper amine oxidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cao1 PE=1 SV=1 8 664 3.0E-112
sp|P12807|AMO_PICAN Peroxisomal primary amine oxidase OS=Pichia angusta GN=AMO PE=1 SV=1 7 654 2.0E-101
sp|Q07123|AMO2_ARTS1 Copper methylamine oxidase OS=Arthrobacter sp. (strain P1) GN=maoII PE=1 SV=1 1 669 3.0E-100
sp|Q07121|AMO1_ARTS1 Primary amine oxidase OS=Arthrobacter sp. (strain P1) GN=maoI PE=1 SV=1 1 669 4.0E-100
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12556|AMO1_ASPNG Copper amine oxidase 1 OS=Aspergillus niger GN=AO-I PE=1 SV=2 5 669 0.0E+00
sp|Q9P7F2|CAO1_SCHPO Copper amine oxidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cao1 PE=1 SV=1 8 664 3.0E-112
sp|P12807|AMO_PICAN Peroxisomal primary amine oxidase OS=Pichia angusta GN=AMO PE=1 SV=1 7 654 2.0E-101
sp|Q07123|AMO2_ARTS1 Copper methylamine oxidase OS=Arthrobacter sp. (strain P1) GN=maoII PE=1 SV=1 1 669 3.0E-100
sp|Q07121|AMO1_ARTS1 Primary amine oxidase OS=Arthrobacter sp. (strain P1) GN=maoI PE=1 SV=1 1 669 4.0E-100
sp|P46881|PAOX_ARTGO Phenylethylamine oxidase OS=Arthrobacter globiformis PE=1 SV=1 164 657 1.0E-93
sp|Q59118|AMOH_ARTGO Histamine oxidase OS=Arthrobacter globiformis PE=1 SV=3 7 657 6.0E-87
sp|O42890|CAO2_SCHPO Copper amine oxidase-like protein cao2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cao2 PE=3 SV=1 8 665 6.0E-82
sp|P46883|AMO_ECOLI Primary amine oxidase OS=Escherichia coli (strain K12) GN=tynA PE=1 SV=1 6 652 2.0E-62
sp|P49250|AMO_ENTAE Primary amine oxidase OS=Enterobacter aerogenes GN=maoA PE=1 SV=1 6 652 2.0E-60
sp|P80695|AMO_KLEOK Primary amine oxidase OS=Klebsiella oxytoca (strain ATCC 8724 / DSM 4798 / JCM 20051 / NBRC 3318 / NRRL B-199 / KCTC 1686) GN=maoA PE=1 SV=2 6 652 1.0E-59
sp|Q8H1H9|AMO_ARATH Primary amine oxidase OS=Arabidopsis thaliana GN=At1g62810 PE=2 SV=1 7 652 5.0E-50
sp|Q43077|AMO_PEA Primary amine oxidase OS=Pisum sativum PE=1 SV=1 5 661 1.0E-46
sp|P49252|AMO_LENCU Primary amine oxidase (Fragment) OS=Lens culinaris PE=1 SV=3 251 660 1.0E-42
sp|H2A0M3|AMO_PINMG Putative amine oxidase [copper-containing] OS=Pinctada margaritifera PE=1 SV=1 246 652 2.0E-27
sp|O08590|AOC3_RAT Membrane primary amine oxidase OS=Rattus norvegicus GN=Aoc3 PE=1 SV=4 255 657 2.0E-22
sp|P19801|AOC1_HUMAN Amiloride-sensitive amine oxidase [copper-containing] OS=Homo sapiens GN=AOC1 PE=1 SV=4 181 652 1.0E-20
sp|Q5R9I0|AOC3_PONAB Membrane primary amine oxidase OS=Pongo abelii GN=AOC3 PE=2 SV=3 256 669 1.0E-20
sp|O75106|AOC2_HUMAN Retina-specific copper amine oxidase OS=Homo sapiens GN=AOC2 PE=1 SV=2 236 670 2.0E-20
sp|Q9TRC7|AOC1_PIG Amiloride-sensitive amine oxidase [copper-containing] OS=Sus scrofa GN=AOC1 PE=1 SV=3 253 652 3.0E-20
sp|Q16853|AOC3_HUMAN Membrane primary amine oxidase OS=Homo sapiens GN=AOC3 PE=1 SV=3 256 669 3.0E-20
sp|Q29437|AOCX_BOVIN Primary amine oxidase, liver isozyme OS=Bos taurus PE=1 SV=1 255 669 5.0E-19
sp|Q9TTK6|AOC3_BOVIN Membrane primary amine oxidase OS=Bos taurus GN=AOC3 PE=2 SV=3 255 669 1.0E-18
sp|Q812C9|AOC2_MOUSE Retina-specific copper amine oxidase OS=Mus musculus GN=Aoc2 PE=2 SV=2 257 670 7.0E-18
sp|O46406|AOCY_BOVIN Primary amine oxidase, lung isozyme OS=Bos taurus PE=2 SV=1 255 669 4.0E-17
sp|O70423|AOC3_MOUSE Membrane primary amine oxidase OS=Mus musculus GN=Aoc3 PE=1 SV=3 182 652 5.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0005507 copper ion binding Yes
GO:0009308 amine metabolic process Yes
GO:0008131 primary amine oxidase activity Yes
GO:0048038 quinone binding Yes
GO:0046872 metal ion binding No
GO:0046914 transition metal ion binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0006807 nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0043169 cation binding No
GO:0016638 oxidoreductase activity, acting on the CH-NH2 group of donors No
GO:0071704 organic substance metabolic process No
GO:0016641 oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor No
GO:0008152 metabolic process No
GO:0016491 oxidoreductase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup60
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6252
Ophiocordyceps australis map64 (Brazil) OphauB2|7551 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03843
Ophiocordyceps camponoti-floridani Ophcf2|06915
Ophiocordyceps camponoti-floridani Ophcf2|03099
Ophiocordyceps camponoti-rufipedis Ophun1|1382
Ophiocordyceps camponoti-rufipedis Ophun1|320
Ophiocordyceps camponoti-rufipedis Ophun1|3694
Ophiocordyceps kimflemingae Ophio5|4618
Ophiocordyceps kimflemingae Ophio5|5158
Ophiocordyceps kimflemingae Ophio5|5967
Ophiocordyceps kimflemingae Ophio5|6024
Ophiocordyceps subramaniannii Hirsu2|9792
Ophiocordyceps subramaniannii Hirsu2|1941
Ophiocordyceps subramaniannii Hirsu2|10669
Ophiocordyceps subramaniannii Hirsu2|9801
Ophiocordyceps subramaniannii Hirsu2|10668

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7551
MVGTIPHPLSDLTIEETNHARDVVVQLHPGTVIEFRMIFLLEPPKEQVKRFLEVEHSGRLTSSTPRPHRLAQARY
DVIGGPQAVEYHESVIDLRTSQRINHQVVGGADSHPGLTLHEFENVVQCVQNSSLFQQKLQNIQLPKGFELVIEP
WPYGGPDEADGLTRYFQALCFARDTASKNPDSNFYAHPIPLIPIMDYRKGELVRIDEPATGGKGDPLSGRSHKKA
IIDHCRAAEYVPELLPNGLRKDVKPLTVQQPEGPSFSVSDANLIQWQKWSMRVTFNPREGAVLHDVRYDGRDVFY
RLSISDMTVPYADPRAPYHRKQAFDFGDGGLGHAVNNLTLGCDCLGVIKYFDGVLTNVKGDAHVTKNVICLHEQD
NGINWKHTNWRTGRAVVTRRRELVVQFIITLANYEYIFAFKFDQAAGIAIEARATGVVSVVNIDEGKTAPWGNVV
SNGALAQNHQHIFCARIDPAVDGHSNTVVQEESLPLSMDARTNPKGNAYEVRQTPITTSTGLDLAPFNNRTFKVQ
NLAKKNPVSGKPVGYKITAPPTQLLLADPKSTQAQRALFAQHHLWVTKYKDDELYAGGRYTLLSRREVGGVADAA
ARNDDVLDSDLVVWSVFGLTHNPRVEDWPVMPVEIIQVLLTPADFFTENPSLDVPSNKDIGSRKTDGCCAQRDGK
QGEKSRL*
Coding >OphauB2|7551
ATGGTTGGCACAATCCCACATCCGCTATCCGATCTCACGATTGAGGAGACGAACCATGCACGCGACGTTGTTGTC
CAGCTGCACCCGGGGACAGTGATTGAATTTCGCATGATTTTTCTCCTTGAGCCGCCCAAGGAGCAAGTGAAGCGA
TTTTTAGAAGTCGAGCACAGCGGCAGGCTCACCAGCTCGACCCCACGGCCACACCGGCTCGCGCAGGCCCGCTAC
GATGTCATTGGCGGCCCCCAAGCAGTCGAATACCACGAGTCGGTAATTGACTTGCGTACCTCGCAGCGAATAAAC
CACCAGGTCGTTGGAGGAGCTGATAGTCATCCCGGTCTCACATTACACGAGTTCGAAAATGTCGTTCAGTGCGTC
CAAAACTCTTCGCTCTTCCAGCAAAAGCTCCAAAACATTCAGTTGCCAAAGGGCTTCGAATTGGTCATTGAGCCC
TGGCCATACGGCGGCCCTGATGAAGCCGATGGTCTAACACGCTACTTTCAAGCCCTGTGCTTTGCCCGTGACACT
GCCAGCAAAAATCCCGACTCCAACTTTTATGCTCACCCTATTCCCCTCATCCCCATCATGGATTATCGCAAGGGC
GAGCTTGTGCGCATCGATGAACCGGCAACGGGTGGCAAGGGCGATCCGCTGTCTGGACGGTCTCATAAGAAAGCC
ATTATTGACCACTGCCGCGCGGCCGAGTATGTGCCAGAGCTGTTACCCAATGGCTTGCGCAAGGACGTCAAGCCC
CTGACTGTACAACAACCCGAGGGGCCGAGTTTCTCAGTATCCGATGCCAACTTGATTCAATGGCAGAAGTGGTCC
ATGAGGGTTACGTTTAACCCCCGCGAGGGTGCCGTGCTACACGATGTTCGTTATGATGGACGCGACGTTTTTTAC
AGATTGAGCATTAGCGACATGACGGTTCCCTACGCAGACCCGAGAGCCCCCTACCACCGCAAGCAGGCCTTTGAC
TTTGGCGATGGCGGCCTGGGCCATGCAGTCAACAACCTCACTCTTGGCTGCGACTGCCTTGGCGTCATCAAGTAT
TTTGATGGCGTCCTCACAAACGTCAAGGGCGATGCGCATGTGACCAAGAACGTCATTTGTCTGCACGAGCAAGAC
AATGGCATCAACTGGAAGCACACCAATTGGCGGACCGGTCGCGCAGTAGTGACGCGCCGTCGGGAGCTAGTGGTG
CAGTTTATTATTACGCTGGCCAATTACGAATACATATTTGCCTTTAAATTTGATCAGGCAGCAGGGATTGCCATT
GAGGCGCGGGCGACGGGCGTGGTGTCTGTTGTCAATATTGACGAGGGCAAGACGGCTCCCTGGGGCAATGTGGTG
AGCAACGGAGCGCTAGCGCAAAATCACCAGCACATTTTTTGCGCTCGCATCGACCCAGCCGTTGATGGCCACTCA
AATACCGTGGTGCAGGAGGAGAGTCTTCCTCTTTCGATGGATGCGCGGACCAATCCCAAGGGCAATGCCTATGAA
GTGCGCCAGACACCCATTACAACTTCGACTGGCTTGGATTTGGCCCCGTTCAACAATAGAACCTTCAAGGTGCAA
AACTTGGCAAAGAAGAACCCTGTGAGCGGCAAGCCAGTTGGCTACAAGATTACGGCGCCCCCGACGCAGCTGCTA
CTGGCGGATCCCAAGAGCACCCAGGCGCAAAGAGCCTTGTTTGCGCAGCATCACTTATGGGTCACCAAGTACAAG
GACGACGAATTGTATGCAGGGGGCCGTTATACTCTGCTGAGCCGCCGAGAGGTTGGAGGAGTCGCAGATGCTGCA
GCTCGCAACGACGATGTGCTTGACTCGGACCTTGTGGTTTGGAGCGTCTTTGGCCTGACGCACAATCCACGTGTT
GAGGATTGGCCCGTCATGCCCGTTGAGATTATTCAGGTGCTGCTTACTCCAGCCGACTTTTTCACGGAGAACCCT
TCACTGGACGTGCCCTCGAACAAGGACATTGGCTCTCGCAAGACGGACGGTTGCTGCGCTCAAAGGGATGGCAAG
CAGGGAGAGAAGTCTCGTCTCTAG
Transcript >OphauB2|7551
ATGGTTGGCACAATCCCACATCCGCTATCCGATCTCACGATTGAGGAGACGAACCATGCACGCGACGTTGTTGTC
CAGCTGCACCCGGGGACAGTGATTGAATTTCGCATGATTTTTCTCCTTGAGCCGCCCAAGGAGCAAGTGAAGCGA
TTTTTAGAAGTCGAGCACAGCGGCAGGCTCACCAGCTCGACCCCACGGCCACACCGGCTCGCGCAGGCCCGCTAC
GATGTCATTGGCGGCCCCCAAGCAGTCGAATACCACGAGTCGGTAATTGACTTGCGTACCTCGCAGCGAATAAAC
CACCAGGTCGTTGGAGGAGCTGATAGTCATCCCGGTCTCACATTACACGAGTTCGAAAATGTCGTTCAGTGCGTC
CAAAACTCTTCGCTCTTCCAGCAAAAGCTCCAAAACATTCAGTTGCCAAAGGGCTTCGAATTGGTCATTGAGCCC
TGGCCATACGGCGGCCCTGATGAAGCCGATGGTCTAACACGCTACTTTCAAGCCCTGTGCTTTGCCCGTGACACT
GCCAGCAAAAATCCCGACTCCAACTTTTATGCTCACCCTATTCCCCTCATCCCCATCATGGATTATCGCAAGGGC
GAGCTTGTGCGCATCGATGAACCGGCAACGGGTGGCAAGGGCGATCCGCTGTCTGGACGGTCTCATAAGAAAGCC
ATTATTGACCACTGCCGCGCGGCCGAGTATGTGCCAGAGCTGTTACCCAATGGCTTGCGCAAGGACGTCAAGCCC
CTGACTGTACAACAACCCGAGGGGCCGAGTTTCTCAGTATCCGATGCCAACTTGATTCAATGGCAGAAGTGGTCC
ATGAGGGTTACGTTTAACCCCCGCGAGGGTGCCGTGCTACACGATGTTCGTTATGATGGACGCGACGTTTTTTAC
AGATTGAGCATTAGCGACATGACGGTTCCCTACGCAGACCCGAGAGCCCCCTACCACCGCAAGCAGGCCTTTGAC
TTTGGCGATGGCGGCCTGGGCCATGCAGTCAACAACCTCACTCTTGGCTGCGACTGCCTTGGCGTCATCAAGTAT
TTTGATGGCGTCCTCACAAACGTCAAGGGCGATGCGCATGTGACCAAGAACGTCATTTGTCTGCACGAGCAAGAC
AATGGCATCAACTGGAAGCACACCAATTGGCGGACCGGTCGCGCAGTAGTGACGCGCCGTCGGGAGCTAGTGGTG
CAGTTTATTATTACGCTGGCCAATTACGAATACATATTTGCCTTTAAATTTGATCAGGCAGCAGGGATTGCCATT
GAGGCGCGGGCGACGGGCGTGGTGTCTGTTGTCAATATTGACGAGGGCAAGACGGCTCCCTGGGGCAATGTGGTG
AGCAACGGAGCGCTAGCGCAAAATCACCAGCACATTTTTTGCGCTCGCATCGACCCAGCCGTTGATGGCCACTCA
AATACCGTGGTGCAGGAGGAGAGTCTTCCTCTTTCGATGGATGCGCGGACCAATCCCAAGGGCAATGCCTATGAA
GTGCGCCAGACACCCATTACAACTTCGACTGGCTTGGATTTGGCCCCGTTCAACAATAGAACCTTCAAGGTGCAA
AACTTGGCAAAGAAGAACCCTGTGAGCGGCAAGCCAGTTGGCTACAAGATTACGGCGCCCCCGACGCAGCTGCTA
CTGGCGGATCCCAAGAGCACCCAGGCGCAAAGAGCCTTGTTTGCGCAGCATCACTTATGGGTCACCAAGTACAAG
GACGACGAATTGTATGCAGGGGGCCGTTATACTCTGCTGAGCCGCCGAGAGGTTGGAGGAGTCGCAGATGCTGCA
GCTCGCAACGACGATGTGCTTGACTCGGACCTTGTGGTTTGGAGCGTCTTTGGCCTGACGCACAATCCACGTGTT
GAGGATTGGCCCGTCATGCCCGTTGAGATTATTCAGGTGCTGCTTACTCCAGCCGACTTTTTCACGGAGAACCCT
TCACTGGACGTGCCCTCGAACAAGGACATTGGCTCTCGCAAGACGGACGGTTGCTGCGCTCAAAGGGATGGCAAG
CAGGGAGAGAAGTCTCGTCTCTAG
Gene >OphauB2|7551
ATGGTTGGCACAATCCCACATCCGCTATCCGATCTCACGATTGAGGAGACGAACCATGCACGCGACGTTGTTGTC
CAGCTGCACCCGGGGACAGTGATTGAATTTCGCATGATTTTTCTCCTTGAGCCGCCCAAGGAGCAAGTGAAGCGA
TTTTTAGAAGTCGAGCACAGCGGCAGGCTCACCAGCTCGACCCCACGGCCACACCGGCTCGCGCAGGCCCGCTAC
GATGTCATTGGCGGCCCCCAAGCAGTCGAATACCACGAGTCGGTAATTGACTTGCGTACCTCGCAGCGAATAAAC
CACCAGGTCGTTGGAGGAGCTGATAGTCATCCCGGTCTCACATTGTGAGTCTGAATTTGCTTTTTTTTTCTTTGG
CTGCTGCTGTCATGCGTACTGACGACTTTCAACTTTAACCAGACACGAGTTCGAAAATGTCGTTCAGTGCGTCCA
AAACTCTTCGCTCTTCCAGCAAAAGCTCCAAAACATTCAGTTGCCAAAGGGCTTCGAATTGGTCATTGAGCCCTG
GCCATACGGCGGCCCTGATGAAGCCGATGGTCTAACACGCTACTTTCAAGCCCTGTGCTTTGCCCGTGACACTGC
CAGCAAAAATCCCGACTCCAACTTTTATGCTCACCCTATTCCCCTCATCCCCATCATGGATTATCGCAAGGGCGA
GCTTGTGCGCATCGATGAACCGGCAACGGGTGGCAAGGGCGATCCGCTGTCTGGACGGTCTCATAAGAAAGCCAT
TATTGACCACTGCCGCGCGGCCGAGTATGTGCCAGAGCTGTTACCCAATGGCTTGCGCAAGGACGTCAAGCCCCT
GACTGTACAACAACCCGAGGGGCCGAGTTTCTCAGTATCCGATGCCAACTTGATTCAATGGCAGAAGTGGTCCAT
GAGGGTTACGTTTAACCCCCGCGAGGGTGCCGTGCTACACGATGTTCGTTATGATGGACGCGACGTTTTTTACAG
ATTGAGCATTAGCGACATGGTACGAAGACTGGCTTCCACGGGCGTCATGAAGTGTGCAAAGCTAACACGACGGTA
GACGGTTCCCTACGCAGACCCGAGAGCCCCCTACCACCGCAAGCAGGCCTTTGACTTTGGCGATGGCGGCCTGGG
CCATGCAGTCAACAACCTCACTCTTGGCTGCGACTGCCTTGGCGTCATCAAGGTATGCCATTACCACTTTAGCCT
AGTTTTACCTGCATGCTGACAAATGGCAACGAATAGTATTTTGATGGCGTCCTCACAAACGTCAAGGGCGATGCG
CATGTGACCAAGAACGTCATTTGTCTGCACGAGCAAGACAATGGCATCAACTGGAAGCACACCAATTGGCGGACC
GGTCGCGCAGTAGTGACGCGCCGTCGGGAGCTAGTGGTGCAGTTTATTATTACGCTGGCCAATTACGAATACATA
TTTGCCTTTAAATTTGATCAGGCAGCAGGGATTGCCATTGAGGCGCGGGCGACGGGCGTGGTGTCTGTTGTCAAT
ATTGACGAGGGCAAGACGGCTCCCTGGGGCAATGTGGTGAGCAACGGAGCGCTAGCGCAAAATCACCAGCACATT
TTTTGCGCTCGCATCGACCCAGCCGTTGATGGCCACTCAAATACCGTGGTGCAGGAGGAGAGTCTTCCTCTTTCG
ATGGATGCGCGGACCAATCCCAAGGGCAATGCCTATGAAGTGCGCCAGACACCCATTACAACTTCGACTGGCTTG
GATTTGGCCCCGTTCAACAATAGAACCTTCAAGGTGCAAAACTTGGCAAAGAAGAACCCTGTGAGCGGCAAGCCA
GTTGGCTACAAGATTACGGCGCCCCCGACGCAGCTGCTACTGGCGGATCCCAAGAGCACCCAGGCGCAAAGAGCC
TTGTTTGCGCAGCATCACTTATGGGTCACCAAGTACAAGGACGACGAATTGTATGCAGGGGGCCGTTATACTCTG
CTGAGCCGCCGAGAGGTTGGAGGAGTCGCAGATGCTGCAGCTCGCAACGACGATGTGCTTGACTCGGACCTTGTG
GTTTGGAGCGTCTTTGGCCTGACGCACAATCCACGTGTTGAGGATTGGCCCGTCATGTCAGTTTTTGAACATGGA
TTACTCCTACTCTAGTGGAATGATGCTGACTTTTGACATGTTGCAGGCCCGTTGAGATTATTCAGGTGCTGCTTA
CTCCAGCCGACTTTTTCACGGAGAACCCTTCACTGGACGTGCCCTCGAACAAGGACATTGGCTCTCGCAAGACGG
ACGGTTGCTGCGCTCAAAGGGATGGCAAGCAGGGAGAGAAGTCTCGTCTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail