Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7524
Gene name
LocationContig_80:41185..41679
Strand+
Gene length (bp)494
Transcript length (bp)369
Coding sequence length (bp)369
Protein length (aa) 123

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05495 zf-CHY CHY zinc finger 8.7E-12 2 71

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O43034|YGU5_SCHPO Uncharacterized protein C3B9.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B9.05 PE=3 SV=2 1 96 8.0E-32

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0005488 binding No
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0046872 metal ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7524
MCKHILNAQVAIRSPCCRKWFDCAECHREQESHPLLQSFEMTFACKKCKKCFRKDAQEFEESDEYCPHCDNHFVL
PAKTPQAALSVESEDVRMDNKMLRDDRVKQQQAKTIFDPDNHANKLG*
Coding >OphauB2|7524
ATGTGCAAACACATTCTCAACGCTCAAGTGGCGATCCGATCACCATGCTGCCGCAAATGGTTCGACTGCGCCGAA
TGCCACCGTGAACAAGAATCCCACCCGCTCTTACAGTCGTTCGAAATGACGTTTGCCTGCAAAAAGTGCAAAAAG
TGCTTCCGCAAAGACGCTCAGGAATTCGAAGAGAGCGACGAGTATTGCCCCCACTGCGATAACCATTTTGTCCTC
CCGGCAAAAACACCCCAGGCTGCTCTATCCGTCGAGAGTGAAGATGTGCGCATGGACAACAAGATGCTCAGAGAT
GACCGCGTCAAGCAGCAACAAGCCAAGACCATTTTCGACCCAGATAACCATGCAAACAAGTTGGGTTAA
Transcript >OphauB2|7524
ATGTGCAAACACATTCTCAACGCTCAAGTGGCGATCCGATCACCATGCTGCCGCAAATGGTTCGACTGCGCCGAA
TGCCACCGTGAACAAGAATCCCACCCGCTCTTACAGTCGTTCGAAATGACGTTTGCCTGCAAAAAGTGCAAAAAG
TGCTTCCGCAAAGACGCTCAGGAATTCGAAGAGAGCGACGAGTATTGCCCCCACTGCGATAACCATTTTGTCCTC
CCGGCAAAAACACCCCAGGCTGCTCTATCCGTCGAGAGTGAAGATGTGCGCATGGACAACAAGATGCTCAGAGAT
GACCGCGTCAAGCAGCAACAAGCCAAGACCATTTTCGACCCAGATAACCATGCAAACAAGTTGGGTTAA
Gene >OphauB2|7524
ATGTGGTATGCTGCACAGCTTACTACCGCTCCAACGACACTGACCCGCCCCCCTTGGCGCAGCAAACACATTCTC
AACGCTCAAGTGGCGATCCGATCACCATGCTGTACTCACCCTGCCATCCCCTCCGCCCCTTGTTTCCAGCCTTGA
TTCTGACTCTCTCTTCTCCTTCAGGCCGCAAATGGTTCGACTGCGCCGAATGCCACCGTGAACAAGAATCCCACC
CGCTCTTACAGTCGTTCGAAATGACGTTTGCCTGCAAAAAGTGCAAAAAGTGCTTCCGCAAAGACGCTCAGGAAT
TCGAAGAGAGCGACGAGTATTGCCCCCACTGCGATAACCATTTTGTCCTCCCGGCAAAAACACCCCAGGCTGCTC
TATCCGTCGAGAGTGAAGATGTGCGCATGGACAACAAGATGCTCAGAGATGACCGCGTCAAGCAGCAACAAGCCA
AGACCATTTTCGACCCAGATAACCATGCAAACAAGTTGGGTTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail