Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7523
Gene name
LocationContig_80:25822..39937
Strand+
Gene length (bp)14115
Transcript length (bp)13941
Coding sequence length (bp)13941
Protein length (aa) 4647

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 1.1E-59 208 620
PF00501 AMP-binding AMP-binding enzyme 3.9E-61 1327 1748
PF00501 AMP-binding AMP-binding enzyme 1.7E-63 2464 2844
PF00668 Condensation Condensation domain 4.6E-14 883 1190
PF00668 Condensation Condensation domain 4.1E-14 1980 2295
PF00668 Condensation Condensation domain 3.8E-12 3134 3421
PF00550 PP-binding Phosphopantetheine attachment site 2.3E-07 1879 1943
PF00550 PP-binding Phosphopantetheine attachment site 1.9E-05 3554 3618
PF00550 PP-binding Phosphopantetheine attachment site 1.5E-04 4088 4152

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 144 4619 0.0E+00
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1323 3473 1.0E-162
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 204 3049 3.0E-139
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 208 2998 1.0E-137
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 204 3253 8.0E-122
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 144 4619 0.0E+00
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1323 3473 1.0E-162
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 204 3049 3.0E-139
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 208 2998 1.0E-137
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 204 3253 8.0E-122
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 208 2952 4.0E-121
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 204 3082 1.0E-120
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1055 3614 7.0E-120
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 204 3253 3.0E-118
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 236 2407 8.0E-112
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1354 3249 2.0E-104
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1002 3056 1.0E-102
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 204 2953 1.0E-101
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 995 3068 2.0E-99
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 204 1945 6.0E-99
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 994 3036 1.0E-98
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1002 3253 2.0E-98
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1002 3253 1.0E-97
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 204 2300 1.0E-97
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 946 3060 4.0E-96
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 204 2322 8.0E-95
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 995 2952 9.0E-94
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 267 2002 1.0E-93
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 204 2300 8.0E-93
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1829 4009 9.0E-93
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 204 2293 9.0E-92
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 975 3047 2.0E-91
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 204 2317 1.0E-90
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1001 2954 2.0E-88
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 204 2157 3.0E-87
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 1323 3043 8.0E-84
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 1353 2954 9.0E-84
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1113 3051 3.0E-83
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 177 1850 5.0E-83
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 208 2149 2.0E-82
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1002 3384 3.0E-80
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 121 2290 4.0E-80
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 1323 3069 5.0E-77
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 234 1940 2.0E-76
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1224 2952 2.0E-75
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1001 2952 2.0E-74
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1224 2952 1.0E-73
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 234 2293 7.0E-71
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1352 3058 1.0E-70
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1350 2952 2.0E-70
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 233 1932 1.0E-66
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 770 1919 2.0E-64
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1300 3250 2.0E-64
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 1321 2952 2.0E-63
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 995 1925 5.0E-63
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2464 3245 4.0E-62
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 862 2150 1.0E-57
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 208 2038 5.0E-57
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 933 1950 7.0E-57
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2466 3403 4.0E-56
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 840 2038 8.0E-56
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1002 2343 8.0E-56
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 204 725 1.0E-54
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 995 2317 2.0E-54
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 863 1858 2.0E-54
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 200 1188 9.0E-54
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 204 796 1.0E-53
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 885 2288 2.0E-53
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1956 2970 8.0E-53
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 204 1183 1.0E-52
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 859 2149 2.0E-52
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2464 3393 3.0E-52
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1001 2290 7.0E-52
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 183 835 1.0E-51
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 187 795 2.0E-51
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 995 1946 2.0E-50
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 973 1919 4.0E-50
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 204 795 6.0E-50
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1310 2300 7.0E-50
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 207 1188 1.0E-49
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1092 1908 2.0E-49
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 203 801 2.0E-49
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1310 2300 2.0E-49
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 204 790 2.0E-49
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1002 1939 4.0E-49
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 208 1143 1.0E-48
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 984 1847 1.0E-48
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 974 1943 2.0E-48
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1956 2960 2.0E-48
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 848 1981 3.0E-48
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1321 1849 3.0E-48
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 990 1849 9.0E-48
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1002 1919 2.0E-47
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 275 1185 5.0E-47
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 204 722 6.0E-47
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1375 2423 8.0E-47
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 204 722 1.0E-46
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 1323 1945 2.0E-46
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1001 1945 2.0E-46
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2397 3411 5.0E-46
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 208 721 8.0E-46
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 204 797 9.0E-46
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 186 1141 1.0E-45
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 975 2149 1.0E-45
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1479 2974 1.0E-45
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 208 725 1.0E-45
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 200 797 4.0E-45
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1283 1939 5.0E-45
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1970 3249 6.0E-45
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 204 797 7.0E-45
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2464 3074 9.0E-45
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1956 3269 1.0E-44
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 205 722 1.0E-44
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 208 722 2.0E-44
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 918 2290 3.0E-44
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 204 797 5.0E-44
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1062 1928 6.0E-44
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 1323 2162 6.0E-44
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 204 722 7.0E-44
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 1310 2290 7.0E-44
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 196 725 7.0E-44
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2464 3055 8.0E-44
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1321 1849 8.0E-44
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1323 2293 1.0E-43
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 203 722 1.0E-43
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 1310 2290 1.0E-43
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1310 2293 2.0E-43
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1001 1939 3.0E-43
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 204 790 3.0E-43
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1001 2193 3.0E-43
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1979 3391 4.0E-43
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 1002 2057 4.0E-43
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1956 2952 4.0E-43
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2471 3393 8.0E-43
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1257 2296 1.0E-42
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 236 721 1.0E-42
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 2464 3031 3.0E-42
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 204 795 3.0E-42
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1979 2952 3.0E-42
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1353 1861 4.0E-42
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 989 1941 4.0E-42
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2465 3407 5.0E-42
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 204 721 5.0E-42
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 204 1122 6.0E-42
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 971 2293 8.0E-42
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 204 722 8.0E-42
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 975 1939 9.0E-42
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 204 764 1.0E-41
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 974 1949 1.0E-41
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 204 722 2.0E-41
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 198 722 2.0E-41
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 997 1847 2.0E-41
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 208 727 2.0E-41
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 235 1176 2.0E-41
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 1001 2288 2.0E-41
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 236 727 4.0E-41
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 994 1939 4.0E-41
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 203 722 4.0E-41
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 212 728 4.0E-41
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2464 3036 5.0E-41
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 2464 3031 5.0E-41
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 235 1176 6.0E-41
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 209 728 7.0E-41
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2466 2952 7.0E-41
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 2464 3031 9.0E-41
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 204 722 1.0E-40
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 204 722 2.0E-40
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 235 1174 2.0E-40
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 198 764 2.0E-40
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1253 1847 3.0E-40
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 1847 3250 3.0E-40
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 203 721 3.0E-40
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 204 797 3.0E-40
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 1003 1847 3.0E-40
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 233 722 3.0E-40
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 204 722 4.0E-40
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 208 722 4.0E-40
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 204 721 6.0E-40
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 1005 2154 8.0E-40
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 208 796 9.0E-40
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2464 3036 9.0E-40
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2466 3071 1.0E-39
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2458 3392 1.0E-39
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2466 2952 1.0E-39
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 208 722 1.0E-39
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1312 2210 2.0E-39
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1312 2210 2.0E-39
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 204 721 2.0E-39
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2115 3020 3.0E-39
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 204 722 5.0E-39
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 204 722 5.0E-39
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 1354 2290 6.0E-39
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2458 3300 7.0E-39
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2408 3253 1.0E-38
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2451 3075 1.0E-38
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1057 1847 1.0E-38
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 209 728 1.0E-38
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1189 1954 2.0E-38
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 202 725 3.0E-38
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 203 722 3.0E-38
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1353 1847 3.0E-38
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2463 3245 6.0E-38
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2465 3405 7.0E-38
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2421 3253 7.0E-38
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2464 3021 7.0E-38
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1353 2037 1.0E-37
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2465 3405 1.0E-37
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 1323 1847 1.0E-37
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2466 3036 2.0E-37
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1255 1946 2.0E-37
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2466 3394 3.0E-37
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 222 729 3.0E-37
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 1323 1847 3.0E-37
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2459 3240 4.0E-37
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 236 720 4.0E-37
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 128 795 4.0E-37
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1113 1939 6.0E-37
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 1323 1847 6.0E-37
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 222 729 7.0E-37
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 264 813 8.0E-37
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 236 722 9.0E-37
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2451 3055 9.0E-37
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 222 729 9.0E-37
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2449 2858 1.0E-36
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 222 729 1.0E-36
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 210 722 2.0E-36
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 975 2332 4.0E-36
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 356 1177 4.0E-36
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 204 676 4.0E-36
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2466 3036 5.0E-36
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2414 2952 5.0E-36
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 143 797 6.0E-36
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 210 722 6.0E-36
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 2464 3057 7.0E-36
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 210 722 1.0E-35
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 222 729 1.0E-35
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 222 729 1.0E-35
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2464 2955 2.0E-35
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 2464 3057 2.0E-35
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1319 2142 3.0E-35
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 204 1031 3.0E-35
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 234 1036 3.0E-35
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1323 1761 3.0E-35
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 204 725 4.0E-35
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 203 722 5.0E-35
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1001 1861 6.0E-35
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 204 1031 6.0E-35
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 199 721 6.0E-35
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 2464 3057 6.0E-35
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 204 721 1.0E-34
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2459 3066 1.0E-34
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 208 748 1.0E-34
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2466 3253 1.0E-34
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 1979 2952 2.0E-34
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 2453 2970 2.0E-34
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1969 3250 3.0E-34
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2405 2972 4.0E-34
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 208 722 5.0E-34
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 208 722 5.0E-34
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 208 789 5.0E-34
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 1353 1859 7.0E-34
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 191 721 9.0E-34
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 191 721 1.0E-33
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1354 2321 1.0E-33
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 1979 3253 2.0E-33
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 204 725 2.0E-33
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2459 3020 2.0E-33
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 236 721 2.0E-33
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1296 2162 3.0E-33
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 354 765 5.0E-33
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 354 765 5.0E-33
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 278 765 5.0E-33
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 1316 1931 7.0E-33
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1055 1848 7.0E-33
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1354 2287 1.0E-32
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 204 797 1.0E-32
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1354 2287 2.0E-32
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 208 722 2.0E-32
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2421 3391 3.0E-32
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 204 722 3.0E-32
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2448 3043 3.0E-32
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2422 2952 3.0E-32
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 204 721 4.0E-32
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 204 721 4.0E-32
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 118 722 5.0E-32
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2473 3464 5.0E-32
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1983 3034 5.0E-32
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 118 722 6.0E-32
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 203 722 6.0E-32
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 236 721 9.0E-32
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 275 720 1.0E-31
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2463 3109 1.0E-31
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 1283 1866 2.0E-31
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 1283 1866 2.0E-31
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 204 721 2.0E-31
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 204 721 2.0E-31
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 204 721 2.0E-31
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 201 799 2.0E-31
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 235 722 2.0E-31
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 235 721 2.0E-31
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 216 724 3.0E-31
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 204 721 3.0E-31
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 188 721 3.0E-31
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 1354 1847 3.0E-31
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 214 727 4.0E-31
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2463 2971 5.0E-31
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 204 721 5.0E-31
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 236 721 5.0E-31
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 204 721 6.0E-31
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 204 721 6.0E-31
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 204 721 6.0E-31
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 204 721 6.0E-31
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 204 721 7.0E-31
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 204 721 8.0E-31
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 1354 1847 8.0E-31
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2466 3057 9.0E-31
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 209 721 1.0E-30
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1327 2149 1.0E-30
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2472 3392 1.0E-30
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 1354 1847 1.0E-30
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2466 2954 1.0E-30
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1353 1849 2.0E-30
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 206 721 2.0E-30
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 206 721 2.0E-30
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 235 729 2.0E-30
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 1354 2293 2.0E-30
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 204 721 2.0E-30
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 204 721 2.0E-30
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 214 727 2.0E-30
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 201 783 2.0E-30
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 1347 1847 2.0E-30
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2466 3261 2.0E-30
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 128 812 2.0E-30
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 1353 1849 3.0E-30
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 206 721 6.0E-30
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 206 721 6.0E-30
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 206 721 6.0E-30
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1323 1919 6.0E-30
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 206 721 7.0E-30
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 206 721 7.0E-30
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 206 721 7.0E-30
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 206 721 7.0E-30
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 216 721 8.0E-30
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 206 721 8.0E-30
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1321 1920 8.0E-30
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2473 3384 8.0E-30
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2458 3029 1.0E-29
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2466 2977 1.0E-29
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 236 721 1.0E-29
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 235 729 1.0E-29
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 235 729 1.0E-29
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 235 729 1.0E-29
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2473 3384 1.0E-29
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2458 3180 2.0E-29
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 216 721 2.0E-29
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 2488 2952 3.0E-29
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 2488 2952 3.0E-29
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 2488 2952 3.0E-29
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 216 721 3.0E-29
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 216 721 3.0E-29
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 216 721 3.0E-29
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 216 721 3.0E-29
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 216 721 3.0E-29
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 216 721 3.0E-29
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 216 721 3.0E-29
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 216 721 3.0E-29
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 216 721 3.0E-29
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 216 721 3.0E-29
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 216 721 3.0E-29
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 216 721 3.0E-29
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 216 721 3.0E-29
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 236 721 3.0E-29
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 2488 2952 4.0E-29
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 2488 2952 5.0E-29
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 2449 2872 5.0E-29
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 208 641 5.0E-29
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 2488 2952 6.0E-29
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 236 721 6.0E-29
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 234 722 7.0E-29
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2472 3079 7.0E-29
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 2488 2952 9.0E-29
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 2488 2952 1.0E-28
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 2488 2952 1.0E-28
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 2488 2952 1.0E-28
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 2488 2952 1.0E-28
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 2488 2952 1.0E-28
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 2488 2952 1.0E-28
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 2488 2952 1.0E-28
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 1323 1847 2.0E-28
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 1323 1847 2.0E-28
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 1323 1847 2.0E-28
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 1323 1847 2.0E-28
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 1323 1847 2.0E-28
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 1323 1847 2.0E-28
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 1323 1847 2.0E-28
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 1323 1847 2.0E-28
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 1323 1847 2.0E-28
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 234 729 2.0E-28
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 234 729 2.0E-28
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 234 729 2.0E-28
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 234 729 2.0E-28
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 1323 1847 3.0E-28
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 1323 1847 4.0E-28
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 1323 1847 4.0E-28
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2473 3049 7.0E-28
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 2488 2952 8.0E-28
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 1323 1847 8.0E-28
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 234 729 8.0E-28
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 1323 1847 9.0E-28
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 1343 1849 9.0E-28
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2455 3248 1.0E-27
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2466 2952 1.0E-27
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2466 2954 1.0E-27
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 1091 1850 1.0E-27
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 234 729 1.0E-27
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 234 729 1.0E-27
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 2488 2952 2.0E-27
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 234 725 2.0E-27
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 204 795 2.0E-27
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 1353 1847 3.0E-27
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2458 2952 4.0E-27
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 216 721 4.0E-27
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 1343 1847 6.0E-27
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 1323 1847 2.0E-26
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 235 756 2.0E-26
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 2574 2952 2.0E-26
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 2574 2952 2.0E-26
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 261 797 2.0E-26
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 261 797 2.0E-26
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 261 797 2.0E-26
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 1343 1847 5.0E-26
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 1321 1948 6.0E-26
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 1321 1948 6.0E-26
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 236 791 7.0E-26
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 1321 1948 7.0E-26
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 2473 2952 9.0E-26
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 2464 3036 1.0E-25
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 2464 3036 1.0E-25
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2470 3078 1.0E-25
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2470 3078 1.0E-25
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 1352 1850 1.0E-25
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3558 4546 1.0E-25
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 231 722 2.0E-25
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 1352 1850 3.0E-25
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 1330 1850 7.0E-25
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 1321 1851 7.0E-25
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 2488 2954 8.0E-25
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 1354 1847 8.0E-25
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 1343 1847 9.0E-25
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 1352 1849 1.0E-24
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 1330 1850 1.0E-24
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 1330 1850 1.0E-24
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 1330 1850 1.0E-24
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 1330 1850 1.0E-24
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 1330 1850 1.0E-24
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 1330 1850 1.0E-24
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 1343 1847 1.0E-24
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 1323 1855 2.0E-24
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 1330 1850 3.0E-24
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 1330 1850 3.0E-24
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 1330 1850 3.0E-24
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 1330 1850 3.0E-24
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 1330 1850 3.0E-24
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 1330 1850 3.0E-24
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 1330 1850 3.0E-24
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 1330 1850 4.0E-24
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 1347 1847 5.0E-24
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 1347 1847 5.0E-24
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 1347 1847 5.0E-24
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 262 734 6.0E-24
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 1382 1849 8.0E-24
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 204 796 9.0E-24
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2458 3384 1.0E-23
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 1383 1847 1.0E-23
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 1383 1847 1.0E-23
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 2466 2955 1.0E-23
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 2488 2954 2.0E-23
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 1383 1847 2.0E-23
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 1383 1847 2.0E-23
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 1383 1847 2.0E-23
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 1343 1847 2.0E-23
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 1383 1847 3.0E-23
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 1383 1847 3.0E-23
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 1383 1847 3.0E-23
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 1383 1847 3.0E-23
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 1383 1847 3.0E-23
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 1383 1847 3.0E-23
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1343 1943 3.0E-23
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 1305 1939 2.0E-22
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 2488 2954 2.0E-22
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 1354 1847 3.0E-22
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2464 3045 7.0E-22
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 2473 2958 9.0E-22
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 2488 2958 1.0E-21
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2488 2952 2.0E-21
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 1353 1849 2.0E-21
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 2484 2952 2.0E-21
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 1343 1847 3.0E-21
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 1343 1847 3.0E-21
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 1343 1847 3.0E-21
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 2484 2952 3.0E-21
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 1343 1849 4.0E-21
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 281 641 4.0E-21
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 202 648 4.0E-21
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 2464 2955 5.0E-21
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 2484 2952 5.0E-21
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 1343 1847 1.0E-20
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 1343 1847 1.0E-20
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 1343 1847 1.0E-20
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 1343 1847 1.0E-20
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 2488 2952 1.0E-20
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 2484 2952 1.0E-20
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1327 1767 2.0E-20
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 2488 2958 2.0E-20
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 2472 3020 2.0E-20
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2575 3391 3.0E-20
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 1229 1925 3.0E-20
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 204 722 3.0E-20
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 2484 2952 3.0E-20
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 2466 3061 4.0E-20
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 1375 1939 4.0E-20
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 2473 2952 5.0E-20
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 850 1743 6.0E-20
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 2464 2861 6.0E-20
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 2471 2954 1.0E-19
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2431 2956 2.0E-19
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 1482 1814 2.0E-19
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 2488 2958 4.0E-19
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 2488 2958 4.0E-19
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 2488 2958 4.0E-19
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 2488 2958 4.0E-19
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 2488 2958 4.0E-19
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 2488 2958 4.0E-19
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 2424 2952 4.0E-19
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 1323 1925 4.0E-19
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 2488 2958 5.0E-19
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 356 805 5.0E-19
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 2488 2958 7.0E-19
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 2488 2958 7.0E-19
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 2488 2958 7.0E-19
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 2488 2958 7.0E-19
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 2488 2958 7.0E-19
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 2488 2958 7.0E-19
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 2488 2958 7.0E-19
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 2424 2952 1.0E-18
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 2424 2952 1.0E-18
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 2424 2952 1.0E-18
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 2424 2952 1.0E-18
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 1323 1925 1.0E-18
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2466 2857 2.0E-18
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 197 722 2.0E-18
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 2488 2958 2.0E-18
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 2473 2952 6.0E-18
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 2424 2952 6.0E-18
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 2424 2952 6.0E-18
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 2488 2954 1.0E-17
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 2466 3057 2.0E-17
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 2466 3057 2.0E-17
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 2466 3057 2.0E-17
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 1323 1920 3.0E-17
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 2460 2952 5.0E-17
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 2460 2952 5.0E-17
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 2460 2954 6.0E-17
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 2460 2952 8.0E-17
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2473 2955 1.0E-16
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 2484 2952 2.0E-16
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 2484 2952 2.0E-16
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 2484 2952 2.0E-16
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 2484 2952 2.0E-16
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 2484 2952 2.0E-16
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 2484 2952 2.0E-16
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 2484 2952 2.0E-16
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 2484 2952 2.0E-16
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 2484 2952 2.0E-16
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 2484 2952 2.0E-16
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 2465 2960 3.0E-16
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 2484 2952 5.0E-16
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 190 722 2.0E-15
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 2567 2967 2.0E-15
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 2465 2952 3.0E-15
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1354 1877 6.0E-15
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 229 721 7.0E-15
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 2458 2952 8.0E-15
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 2489 2898 2.0E-14
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 2439 2902 4.0E-14
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 208 814 6.0E-14
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 202 720 7.0E-14
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 355 851 8.0E-14
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 204 957 9.0E-14
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 1321 1758 2.0E-13
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 210 620 2.0E-13
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 1476 1955 4.0E-13
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 2442 3056 5.0E-13
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 1354 1848 1.0E-12
sp|Q8K0L3|ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus GN=Acsm2 PE=1 SV=1 229 734 2.0E-12
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 229 721 2.0E-12
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 204 627 3.0E-12
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 1339 1851 4.0E-12
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 336 720 7.0E-12
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 229 720 1.0E-11
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 2575 2957 1.0E-11
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 2575 2957 1.0E-11
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 2575 2957 1.0E-11
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 2575 2957 1.0E-11
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 2575 2957 1.0E-11
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 2575 2957 1.0E-11
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 2575 2957 2.0E-11
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 2575 2957 2.0E-11
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 4112 4526 2.0E-11
sp|P9WQ45|FAD25_MYCTU Putative fatty-acid--CoA ligase fadD25 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD25 PE=1 SV=1 208 720 3.0E-11
sp|P9WQ44|FAD25_MYCTO Putative fatty-acid--CoA ligase fadD25 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD25 PE=3 SV=1 208 720 3.0E-11
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 2488 2954 4.0E-11
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 210 720 5.0E-11
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 354 720 6.0E-11
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 2575 2957 6.0E-11
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 354 721 6.0E-11
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 354 721 6.0E-11
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 210 721 7.0E-11
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 229 720 9.0E-11
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 2574 2967 9.0E-11
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 224 727 1.0E-10
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 224 727 1.0E-10
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 2463 2956 1.0E-10
sp|Q6BS00|ACS2_DEBHA Acetyl-coenzyme A synthetase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS2 PE=3 SV=1 2466 2960 1.0E-10
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 228 720 2.0E-10
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 208 722 2.0E-10
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 2453 2846 2.0E-10
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 209 720 3.0E-10
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 209 721 4.0E-10
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 2466 2960 4.0E-10
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1979 2851 4.0E-10
sp|Q01576|ACSA_PHYB8 Acetyl-coenzyme A synthetase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=facA PE=2 SV=1 2574 2958 6.0E-10
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 2466 2895 7.0E-10
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 1365 1939 8.0E-10
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 230 734 9.0E-10
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 229 720 1.0E-09
sp|Q9SS01|AAE20_ARATH Benzoate--CoA ligase, peroxisomal OS=Arabidopsis thaliana GN=AAE20 PE=1 SV=1 208 718 1.0E-09
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 220 721 1.0E-09
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1802 2288 2.0E-09
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 228 720 2.0E-09
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 2575 2848 2.0E-09
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 354 721 3.0E-09
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 354 721 3.0E-09
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 2575 2956 3.0E-09
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 2466 2895 3.0E-09
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 2574 2997 4.0E-09
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 208 720 7.0E-09
sp|Q91VA0|ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus GN=Acsm1 PE=1 SV=1 230 721 9.0E-09
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 2466 2939 1.0E-08
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 347 735 1.0E-08
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 2466 2944 1.0E-08
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 352 721 1.0E-08
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 354 738 1.0E-08
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 2575 2957 1.0E-08
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 2458 2836 2.0E-08
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 211 721 2.0E-08
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 2575 2853 2.0E-08
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 2575 2853 2.0E-08
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 2575 2853 2.0E-08
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 2575 2853 2.0E-08
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 2575 2853 2.0E-08
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 2575 2853 2.0E-08
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 2575 2853 2.0E-08
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 2575 2853 2.0E-08
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 2575 2853 2.0E-08
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 2575 2853 2.0E-08
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 2575 2853 2.0E-08
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 2575 2853 2.0E-08
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 2575 2853 2.0E-08
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 206 721 2.0E-08
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 2575 2853 2.0E-08
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 2466 2895 3.0E-08
sp|P78773|ACSA_SCHPO Probable acetyl-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC191.02c PE=1 SV=2 2466 2958 3.0E-08
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 2575 2853 3.0E-08
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 2575 2853 3.0E-08
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 2575 2853 3.0E-08
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 331 721 4.0E-08
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 352 639 4.0E-08
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 2575 2853 4.0E-08
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 2575 2853 4.0E-08
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 4106 4388 5.0E-08
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 2575 2853 5.0E-08
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 2575 2853 5.0E-08
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 2575 2853 5.0E-08
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 2575 2853 5.0E-08
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 2575 2853 5.0E-08
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 2575 2853 5.0E-08
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 2575 2853 5.0E-08
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 2575 2853 5.0E-08
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 2575 2853 5.0E-08
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 2575 2853 5.0E-08
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 2575 2853 5.0E-08
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 2575 2853 5.0E-08
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 2575 2853 5.0E-08
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 2575 2853 5.0E-08
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 2575 2853 5.0E-08
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 2575 2853 6.0E-08
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 2575 2853 6.0E-08
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 2575 2853 6.0E-08
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 2575 2853 6.0E-08
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 1360 1850 7.0E-08
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 2575 2955 7.0E-08
sp|O53551|FAC17_MYCTU Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD17 PE=1 SV=1 246 725 8.0E-08
sp|Q7TWC5|FAC17_MYCBO Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD17 PE=3 SV=1 246 725 8.0E-08
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3085 3403 8.0E-08
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 2457 2895 8.0E-08
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 358 720 9.0E-08
sp|Q08AH1|ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 503 721 9.0E-08
sp|Q08AH3|ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 1479 1849 9.0E-08
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 1479 1849 1.0E-07
sp|Q9Y7B5|ACS2_KLULA Acetyl-coenzyme A synthetase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS2 PE=3 SV=2 2574 2956 1.0E-07
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 2575 2845 1.0E-07
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 2575 2959 1.0E-07
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 2575 2957 2.0E-07
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 209 720 2.0E-07
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 2465 2915 2.0E-07
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3150 3390 2.0E-07
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 354 729 3.0E-07
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 2458 2895 3.0E-07
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 349 721 3.0E-07
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 2466 2895 4.0E-07
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 354 719 5.0E-07
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 354 719 6.0E-07
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 354 719 6.0E-07
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 354 719 6.0E-07
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 354 719 6.0E-07
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 354 719 6.0E-07
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 2575 2853 6.0E-07
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 354 719 7.0E-07
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 354 719 7.0E-07
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 354 719 7.0E-07
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 354 719 7.0E-07
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 354 719 7.0E-07
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 2513 2956 7.0E-07
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3088 3397 7.0E-07
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 2457 2895 7.0E-07
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 354 719 8.0E-07
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 354 719 9.0E-07
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 354 719 9.0E-07
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 2457 2890 1.0E-06
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 1337 1760 1.0E-06
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 2575 2955 1.0E-06
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 2575 2955 1.0E-06
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 230 721 1.0E-06
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 2575 2944 2.0E-06
sp|Q27549|ACSA_CRYPV Acetyl-coenzyme A synthetase OS=Cryptosporidium parvum GN=ACS PE=3 SV=1 2466 2877 2.0E-06
sp|Q750T7|ACS2_ASHGO Acetyl-coenzyme A synthetase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS2 PE=3 SV=1 2574 2956 2.0E-06
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 2473 2915 2.0E-06
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 2465 2915 2.0E-06
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 2465 2915 3.0E-06
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 2473 2915 3.0E-06
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 2473 2915 3.0E-06
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 354 733 3.0E-06
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1680 2038 3.0E-06
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 1484 1853 5.0E-06
sp|Q1CUA3|ACSA_HELPH Acetyl-coenzyme A synthetase OS=Helicobacter pylori (strain HPAG1) GN=acsA PE=3 SV=1 2458 2872 5.0E-06
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 198 721 6.0E-06
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 2464 2659 6.0E-06
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 352 721 6.0E-06
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 4106 4492 7.0E-06
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 1352 1760 7.0E-06
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 2575 2845 7.0E-06
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 532 725 7.0E-06
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 2465 2915 8.0E-06
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 354 721 9.0E-06
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 354 727 9.0E-06
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 2462 2794 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7523
MSQLPVTRLGPLHCHQQQSPHELETPGPRVQDDAQLLRWQCCFEYKPDKDTCVEAFVRLVSQILVLQVGEAYCIQ
DSTRRGLILAHQNDDEHHASTFIKCQDGQDIPSDFSIGRGKVLQLHADDDSRHVWLEAQPNVVPREALAALGHML
QDLIVGLQQSQGKHLQRQWTQPSLLNIPPIARPLVLFPHEPVCSGRLDHEPALLHRQFEQRAAEIPERIALDFLV
DLESGKRIQYTYQQMDNAANALAAELAQSCAQSSIQTAAVLMGPSPELYISYLAALKAGVAFCPIPMHAPQARKE
VLMADLKPTVLLVATSTNSNPYQFGTSRVTIDVTGHLSSCNTKSGRRSLAAETDVAYILYTSGSSGMPKGVQVSH
IAASCTISALSAHCGFFAKAQSLSRPIRWFQGAAPTFDISLFEIFWTLGTGSTLCCAPREFTLQDINKAISHLNA
DITNITPSFANLLDPSLMRGLMVGGETLNTRLVQDFACHASSPGHDQVRLSNIYNGYGPTETAIYCIAQPHVPVG
QRGSVIGKPLATSGIMIVDERAKSLHPVPMGAIGELVVTGPQVSSAGYLNRPDETARVFVDDAQWGRAYRTGDRG
RIVWNDAGEPVVEFLGRISDGQVKLQGRRVELGEVDQVLASRVQGIREILSCVWTAPACSGSDRIVALVVLEPRD
GVVDFDLVRQRCLETAQRHLPDYMRPFRILQLEALPKSSSGKIDRRAASAYVQKAVGKSLESLPMVEPLSSPEDA
KMEQELLCILSEIVQNGWTMTATTALDEAGLDSLGAMRLLRNIRQRWPRCQDTRLNPPMALLLNSGASVRSVFFP
LAQEVDKEAETRGQLAKLSSRHMSEALDKLNLTSEADIDMILPTTCTQSQLAVSFAVNPQSYISHSVLRIKPGVS
AQALGEAVETVVYGQAIYRCAILAVENSLSPFIQVVLTPEAWHRLNEKTSRVVHRRARKASVSSEAQVWLDLAEK
NMSLDSQRLYHIQIVEPDSVSDSAGLLVISIAHCICDGASLEVLMSDIARQVAGLEPLPRHGIYNVVMEWASNVQ
TKTDELWQASLKGWEAQSLGSLSGNKAMSPSTHGHAMVEHVSALTWQALQDKSIALGASPLTILQASWALLLHCY
AETDTEEVVFGSVISGHSVSSHAPTFSVLPCRVALPANQTLRQLLDGLKRASRFTQSHRHTSFGLFKTLPYTTAL
ALQVYPQLDPEDAMPVPWTEIQRRAICYDLAMFVEIFPRGSDSLGHQQESSNVTLKLTYRQDNLSELAATCIVKQ
LGALTEVMLASHAQDIAQGLPAHMAEKLLSVQGTRNASGEKEQKIQLLHAQFEEQAVSSPNLLALSFYPSLDSPR
VDVSYAELEARANSLAEVLREEDVEIIPMCMHRSVELYVAVLAILKAGSAWCPIDETSPLQRRTSLIARTQSKVL
LTTTDSLPLVEPCLADKSLDGVRMVLVDQYAHVKTCAKPKARPGVLSLEYMRGQHLAYLLWTSGTTGEPKGVMMQ
HSAAAQAMRDLQSRVERCDKAGQVRTLQLSAYSFDVFVQDLFYTWGVAGCVVSGTRELILGRFVDFVWKSCPTHA
HLTPSFGASISVNDIKGSTLQHVTFIGEKLTEDVAEAWAAPGVTSRTYNTYGPAENAVVSTMRRFYAKGQDQAMA
ANVGFPLSQCTSYVVREVKTAQGKQDRWQLVPRYGVGELALGGAQMAKGYFADAAKTAKAFIEGGAAIQERIYLT
GDLVRLNDHGFEFLGRNDDLVKITGIRIELSEISAACAKVKKQEAAVEHVETLYLERPGSSNKVIVTFVSVKQDC
LDTVQLRSKVFQKARDLLPQYMVPGHVVILNTTMPRTVSNKVHRKALQELYRASNLKALTAEHDGKQQQQTWTQQ
QLSVLQVVANVGQVAVESLSPQDGLAGLGLNSLGLTKLVWKLRKQVKCHVGVVDLLRCQGIGELVDLVLKKLAPP
EEASWLARIKHVLTERLHGSMRPADTLYVLPATPMQEALIVETMMEPRAYWAHRVFDMSHLGGLDCHDLKEAWTA
VADKFDILRTIFVPLARLTVNNDNGGSIKWARQQGIHCTILQLVRKEPRVRWTWLASHHEANQDDDLSQWAQKLQ
MELAPTATVQPPWAVTYSERQGKLMLSMHHALYDRVSGELLMDTVAKLYRKQALDQDDAMVQLQRGMGLGLLPTA
SQRKEAASLWKKHLDKVRETTGPLNAALPDLTQSRQEQPCRILVATRSLPASLVTAPSSTRVPLPTLLQSAFGCI
LASYLELKAVVIGHNVSLRLLHSDLARVMGPAMATVPLVIRADSGSAEELWDIMACDSSTLLHSMHNLHPIDIRK
MINDGSGGKNIPFPGLFVYHPDSDNKRGAQDVFRQVETALTLHVEHPLALNVFEAQGTVELTGNGSCISQTQLDL
MLDQIIHQARAMTQSPQSRLDQLQNTMDHRLMSITGQGTTRLDIPKSTDPTERVSVFSRLASHEAGLEPDDVVAM
YMGRDIKSLAVTLAIFRAGYVYLALDEQLPKARKQVLISDSKAKLIVTTEQLSKDLDLSLESDAWVLMMPDGEND
VDVMLSWPASPPSRGSRETGHGGYLIYTSGSTGRPKGVRVSNANLCHFIAAISTRMTEASPVSARLGGTGKYLNL
TSRAFDPHLTQIFLPWSLGYRVVIGKDWTAMLGSLQQVINQLGITHFGSVPSVLTQLGLRPEEIASVKVVTTGGE
KASRELLDMWTNETECGDDKATLFNFYGPTEVTIGCVGQAVDRHSSSRSLGKPLAGLEALLLCPKTGMEQVIARR
GQAGELCMLGPQVALGYLNRPLEEGKSFQTTSLLGNGVRRMYRTGDMMRMMHDGTLEFLGRADQQAKIRGQRLEL
DEVVSFMKQSASREGQVEFAAVVLNHERVLGFAARRAVALVRGEVEAEPELLQKPGRAICRLLERLEQKCEAGLP
AFMVPTMVWVSRIPYLAASGKVDTKALAKLAQGFAACQQDGEHPKPQQNAARGHDGLEAMEKVVIAAIDEVMGGQ
GCRSGTQTTAASSLHGLGIDSLSALHLVSLLRERGFAQLTVADAMSSSSTVASMARLAGSVASWAPQQPMKMPVL
SRAHLGPAGAGLANVAIEAVVPCLPLQSALVAQSLLWLSANSHQVEGKDGEGAALKVPYVTQFSYRLPRGTQVAR
WIRAAEQVVASEAMLRSCFIQNGQMLQVVLKWPTRLSPFQGQQDAADMVAQISVRPPIRIQVGQDQDSGEVVMSF
KMHHALFDAVAIDVLGRRLEQSYEGRRLVGSRSLELLESVSSYCHDLDGQMETTRQQWQARLAKVCPCRVSGNGN
GNGYDETTGAMARWSQCLNCSAQDIKARSQHSVSTVLQLATALCLAHTTQQASVVYGFVTSLRPLLSHVTDGMDD
FIGPCLNTVVHTIRLDRGDETLPSLAHRVDEAHAAVCQGAMPLVSVEKVQRWAGCQGKLWDSLLSIKLVTPRRAL
EGRISPLCASVEGSSDMALAIDVDVHTNGTMVLSLSSAGALGQCQLEKLGRLFEKAVARCADENARVEHFVSLPK
EAHCEATTQDAEADAGPPEEPFQEAMACVQTAICRLLDVKASDVAGTTWLYQIGLDSINVFALVSLMNKMSNVQV
KADAVLKARSIQGVARLVYEAKRAPVPDRPRETTHDTTVQQLARDMMFVATPLQAGMLSASLAIADKAYTYTHGI
QLSADALAADTASLDCFLAAVRDTVQACEILRTHFIFSAHDEAPWIGVVSPTQQSHLVSWETFPSGRVKLVIHHA
LYDAASLEAMWDILHQHYLGHLQGRHGAVAEHLFRPFAAVVAAAQEDSVAFWSSLLQDYSYTPLHLSNDSLQASC
AFHFALGQHELSLVQARCRALGVTSKAAFELAWVKVLCQSLYRQADVVWGQVVSTAGALEHVPVGPTINTVPMRF
SLVDKDSSKVLSVAEALLGLQRLSDDARGTTAMASLSRIQTLWRMSSRDQQRVPATLFQSLFVFDAAAAPSTSRR
LFTPVEHETRARQGPVYDDYPLIVSFHMQGKALGVRLRAKTRTRDHVETLGKELEKTVKWLWECNLAEAALDVAH
MAEAAPALDLSPATPAPDLSPTTPAPDSSPCRQKTAHAILALTKTVLGAKSRGKHIGLRTRLVNAGLDSILAIRL
SGLLKEQLGIKASVFQLIKGASIHDVVESMTLATTASSEKPMRPLVTHSDELKPQIAKLLRLQDDAMMCILPVLA
GQRAHLEQWLHSGKRFLEAPWVYRVEHQPLDAATVASCWSELRRLHPILRSTFVCTGAKALLVQVTLSEQWAAQG
RGFLHVQDGSRPIEAVIHHHVVETNAMASDLMEPPARLSLLEGLDGKALVLRVHHALYDAWTMAMIEDDLDRLLA
SAGLCHDTAPSLQQVVCQIRDMRQPHAEQSFWREHLSGAHETVLSISNASTLSSAQGSNTRPLTAHDLSPLGRRF
KTTYSAAVVSSCMSNARLSAAIIVAYASALGRFTTTSRPTFGLSHASRALSSPDGTRTLDLTAARLPTLTLTPMC
VHLCRREKHLVDSVQHHLAQLTKFAQSDQVQQFCPRFNSYLNIVFARDSAQRPSPKMLRRHRLSEPLASHYWTVA
KPCHASDSAIQGLGTQHLCPQQFFFTILVSPSRDIKVTVSGDGGGDLAMVEQLVSYFGSELAQIVAHASLE*
Coding >OphauB2|7523
ATGTCTCAGCTACCCGTGACCCGGCTTGGGCCACTGCACTGTCACCAACAGCAGTCGCCCCATGAGCTAGAAACA
CCAGGCCCAAGAGTGCAAGACGATGCTCAACTGCTGCGCTGGCAATGTTGCTTTGAATACAAGCCCGACAAGGAC
ACATGTGTTGAAGCTTTTGTGAGGCTCGTCTCTCAAATCCTCGTCCTCCAAGTTGGCGAGGCCTACTGTATCCAA
GACTCGACACGCCGTGGTCTCATCTTGGCTCACCAAAACGACGACGAGCACCACGCTTCTACTTTTATCAAGTGC
CAAGATGGCCAAGATATCCCATCAGACTTTTCCATTGGCAGAGGAAAAGTCTTGCAGCTCCATGCTGATGATGAC
TCCCGACATGTATGGCTGGAAGCGCAGCCCAATGTTGTACCTAGAGAAGCTCTTGCGGCTCTGGGACATATGCTA
CAAGACCTCATTGTCGGCCTGCAGCAGAGTCAAGGGAAACATTTGCAGCGGCAATGGACGCAGCCTTCCCTGCTC
AATATTCCACCGATTGCGAGACCCTTGGTTTTATTTCCTCACGAGCCGGTCTGCTCGGGCCGTCTTGACCACGAG
CCAGCTCTGCTTCACCGCCAATTTGAGCAAAGAGCAGCAGAAATACCGGAAAGAATAGCGCTAGACTTTCTCGTG
GACCTTGAAAGCGGCAAGAGAATACAATACACCTATCAACAAATGGACAACGCCGCCAACGCACTGGCAGCTGAA
CTAGCTCAATCTTGCGCGCAGTCGAGTATTCAGACGGCTGCCGTGCTCATGGGACCCAGTCCAGAGCTTTACATC
AGCTACCTAGCGGCTCTCAAGGCTGGTGTGGCCTTTTGCCCTATTCCCATGCATGCCCCACAAGCCAGAAAAGAA
GTGTTGATGGCAGACCTGAAGCCAACAGTCCTCCTCGTGGCTACATCAACAAATTCAAACCCCTATCAATTTGGT
ACGTCAAGGGTAACGATTGACGTGACTGGCCATCTTTCATCATGCAATACCAAATCTGGGAGACGGTCCCTCGCC
GCCGAGACGGATGTGGCCTACATATTATACACGTCGGGAAGCAGTGGCATGCCAAAGGGAGTGCAAGTCAGCCAC
ATTGCTGCGTCTTGTACCATTTCAGCACTGAGTGCTCACTGCGGCTTCTTTGCGAAAGCACAATCACTATCCAGG
CCCATCAGGTGGTTCCAAGGTGCGGCTCCGACGTTTGACATTTCCCTGTTTGAAATATTCTGGACACTGGGCACC
GGCTCGACGCTCTGTTGCGCGCCGCGCGAGTTTACTCTTCAGGACATTAACAAGGCCATCAGCCACTTGAATGCC
GATATTACCAACATCACTCCCAGCTTTGCCAACCTTCTGGACCCATCGCTGATGCGCGGCCTTATGGTGGGCGGA
GAGACACTAAACACACGGCTCGTACAAGACTTTGCCTGCCACGCCTCTAGTCCTGGTCATGATCAAGTCAGACTT
AGCAACATCTACAACGGATATGGACCTACAGAAACAGCCATTTACTGCATTGCCCAGCCTCATGTCCCAGTAGGG
CAGCGAGGCTCTGTCATCGGCAAACCGCTAGCGACGAGTGGCATTATGATAGTGGACGAAAGAGCCAAGTCGTTG
CACCCTGTGCCTATGGGTGCAATAGGAGAGCTTGTAGTCACTGGCCCTCAAGTCAGCAGCGCAGGCTACCTCAAT
CGCCCTGACGAGACGGCTCGCGTCTTCGTGGACGATGCGCAATGGGGACGGGCGTACAGAACGGGCGACCGAGGC
CGGATTGTGTGGAACGACGCCGGCGAGCCCGTTGTAGAGTTTCTTGGTAGGATCTCGGATGGTCAGGTCAAGCTC
CAGGGAAGACGGGTGGAGCTAGGCGAGGTGGACCAGGTGCTGGCAAGCAGAGTGCAGGGCATACGGGAAATTCTG
TCCTGTGTCTGGACAGCTCCAGCCTGTTCGGGCTCGGACAGGATTGTGGCTCTTGTCGTCCTGGAGCCGCGTGAC
GGCGTCGTCGACTTTGATCTTGTTCGCCAGAGATGTCTTGAGACCGCACAGCGCCACCTTCCCGATTACATGAGG
CCCTTTCGCATCTTGCAGCTTGAGGCGCTGCCCAAATCTTCGTCTGGAAAGATTGATCGCAGGGCAGCTTCAGCT
TACGTGCAAAAGGCTGTTGGTAAAAGTCTTGAATCATTGCCAATGGTAGAGCCCTTGTCGAGCCCCGAAGACGCC
AAGATGGAACAAGAGCTCCTGTGCATTCTTTCAGAGATTGTACAAAATGGCTGGACCATGACGGCGACCACGGCC
CTCGATGAGGCTGGCCTGGACAGTCTAGGCGCCATGAGATTGTTGCGTAATATAAGGCAGAGATGGCCCCGATGC
CAGGACACACGTCTGAATCCACCAATGGCTTTGCTTCTCAACTCTGGAGCCAGCGTCCGCTCTGTATTTTTCCCT
CTGGCACAAGAAGTGGACAAGGAGGCCGAAACACGAGGCCAGCTCGCAAAACTGTCGTCGAGACACATGTCGGAA
GCCCTCGATAAGCTGAATCTCACTAGCGAGGCCGATATTGACATGATTTTGCCGACAACGTGCACCCAAAGTCAG
CTGGCAGTGAGCTTTGCCGTCAACCCTCAGAGCTATATTAGCCATTCTGTCTTGAGAATAAAGCCTGGCGTCTCA
GCCCAAGCTCTCGGCGAGGCTGTCGAGACTGTTGTGTATGGACAGGCCATCTACCGATGTGCAATCCTTGCCGTA
GAAAACTCTCTCTCTCCCTTTATTCAGGTAGTCCTGACACCTGAAGCTTGGCATCGGCTCAATGAGAAGACGAGT
CGGGTCGTGCATAGGAGAGCGAGGAAAGCCTCGGTTTCCAGTGAGGCACAGGTGTGGCTTGACTTGGCTGAGAAG
AATATGAGTCTGGATTCGCAGAGGTTGTACCACATTCAAATCGTTGAGCCAGACTCTGTTTCCGACAGCGCAGGC
CTCTTGGTTATCAGCATTGCCCACTGCATCTGCGACGGTGCCTCCCTCGAGGTGCTCATGAGCGACATAGCCAGA
CAGGTTGCTGGTCTAGAGCCTCTCCCCAGGCATGGCATATACAATGTTGTGATGGAATGGGCTTCGAATGTCCAA
ACCAAGACTGATGAGCTATGGCAAGCGTCGCTCAAGGGCTGGGAAGCCCAAAGTCTTGGTTCGCTCAGCGGCAAC
AAGGCCATGTCGCCTTCTACCCATGGTCACGCAATGGTGGAACACGTCAGCGCCTTGACCTGGCAGGCCTTGCAA
GACAAAAGCATTGCCCTTGGGGCCTCTCCCTTGACAATTCTCCAGGCTTCTTGGGCTCTACTGCTGCATTGTTAT
GCAGAGACGGATACAGAAGAAGTGGTATTTGGAAGCGTTATATCAGGTCACAGCGTCTCGTCGCACGCTCCCACG
TTTTCTGTGCTTCCTTGCCGGGTGGCGCTGCCTGCGAACCAGACCCTCCGCCAGCTCCTTGATGGCCTCAAACGT
GCCTCTCGTTTCACACAGAGCCACCGACACACGTCATTTGGCCTTTTCAAGACACTTCCATACACGACTGCGTTG
GCCTTGCAAGTATATCCTCAACTGGACCCTGAAGATGCCATGCCAGTTCCCTGGACCGAGATTCAGAGACGGGCG
ATATGCTACGATCTGGCCATGTTTGTCGAGATTTTCCCGCGGGGCTCTGACTCGCTAGGCCATCAACAAGAGTCG
AGCAACGTGACACTTAAACTCACATATCGTCAAGATAATCTTTCCGAGCTGGCAGCAACATGCATTGTGAAGCAG
CTTGGCGCACTAACAGAAGTCATGTTGGCTTCACATGCACAAGACATTGCTCAGGGGCTGCCCGCTCACATGGCT
GAAAAACTACTCTCTGTCCAGGGGACCAGGAATGCGAGTGGAGAGAAGGAACAAAAAATTCAGCTTCTACACGCC
CAATTTGAAGAGCAAGCCGTGTCAAGTCCTAATCTACTGGCCCTAAGCTTCTACCCGTCACTAGACTCGCCTCGA
GTCGATGTCAGCTATGCAGAGCTCGAGGCAAGAGCCAATAGCCTGGCAGAAGTGCTGCGAGAGGAGGATGTCGAA
ATTATACCCATGTGTATGCATCGCAGTGTTGAGCTTTATGTCGCCGTCTTGGCAATCTTGAAAGCCGGCTCAGCC
TGGTGTCCAATTGATGAGACGTCTCCCTTGCAGAGACGGACTTCGCTCATTGCCAGGACGCAGAGCAAAGTGTTG
CTGACAACAACGGACTCATTGCCCCTGGTAGAGCCGTGTCTCGCGGACAAGAGCCTCGATGGCGTGCGCATGGTT
CTCGTCGATCAGTACGCTCATGTCAAGACGTGTGCAAAGCCAAAAGCACGTCCTGGCGTCTTGTCTTTGGAGTAC
ATGAGGGGGCAGCATCTTGCCTATCTTCTGTGGACCTCTGGCACAACAGGAGAACCAAAAGGCGTCATGATGCAA
CACTCGGCAGCGGCCCAGGCCATGCGTGACTTGCAGAGCCGAGTCGAGCGTTGCGATAAAGCTGGGCAGGTCCGG
ACTCTGCAGCTCTCGGCCTACAGCTTTGACGTGTTTGTGCAGGATCTCTTCTACACATGGGGCGTGGCAGGCTGT
GTCGTGAGCGGCACCAGAGAGCTTATCCTGGGCAGATTTGTCGATTTTGTCTGGAAATCATGTCCGACACACGCC
CATCTCACACCGTCATTCGGAGCGAGCATCTCTGTCAATGACATCAAGGGCTCGACTCTACAGCATGTGACGTTT
ATTGGAGAGAAGCTGACAGAGGACGTTGCTGAAGCCTGGGCGGCGCCAGGCGTCACATCGCGCACCTACAACACA
TATGGACCGGCTGAGAATGCAGTCGTGTCTACCATGAGACGCTTCTATGCCAAGGGTCAGGACCAGGCCATGGCA
GCCAATGTAGGATTTCCCCTCAGCCAATGTACCTCGTATGTTGTCCGTGAGGTCAAGACAGCACAGGGCAAGCAG
GACCGCTGGCAGCTTGTTCCTCGATATGGGGTTGGCGAGCTGGCTCTGGGTGGCGCTCAAATGGCAAAGGGATAC
TTTGCTGACGCGGCCAAGACGGCCAAGGCCTTTATCGAGGGAGGAGCCGCCATCCAGGAACGCATCTACCTCACG
GGAGACTTGGTGCGCCTCAACGACCACGGCTTCGAGTTCCTGGGCCGAAATGACGACTTGGTCAAGATTACGGGC
ATCCGCATCGAGCTGAGCGAGATTAGCGCCGCCTGTGCCAAGGTCAAGAAGCAAGAAGCAGCCGTGGAACACGTC
GAGACATTATATCTCGAGCGTCCTGGAAGCAGCAACAAAGTCATTGTTACCTTTGTCTCGGTCAAGCAAGATTGC
CTTGACACGGTGCAGCTTAGATCCAAGGTGTTCCAGAAGGCTCGAGACCTGCTGCCACAGTACATGGTTCCCGGC
CACGTTGTTATTTTGAACACAACAATGCCGAGGACGGTGTCCAACAAGGTCCATCGCAAAGCACTGCAGGAATTG
TACAGGGCATCCAATCTGAAGGCTCTGACTGCAGAGCATGATGGCAAGCAGCAGCAGCAGACCTGGACCCAGCAA
CAGCTCTCAGTCCTCCAAGTCGTGGCAAACGTGGGCCAAGTGGCAGTCGAATCTCTGTCGCCCCAAGATGGCTTG
GCCGGCCTTGGTCTCAATTCTCTTGGTCTCACTAAGCTCGTATGGAAGTTGAGGAAACAAGTCAAGTGTCATGTT
GGAGTGGTGGACCTACTACGCTGTCAAGGCATTGGCGAGCTAGTCGACCTTGTCCTAAAAAAGCTGGCGCCACCC
GAAGAAGCCTCATGGCTGGCTCGGATCAAGCACGTCTTGACGGAGCGACTGCATGGCAGTATGCGACCAGCAGAC
ACCTTGTACGTGCTGCCGGCGACTCCAATGCAAGAGGCGCTCATTGTAGAGACCATGATGGAGCCTCGGGCCTAC
TGGGCGCACCGTGTATTTGACATGAGCCATCTAGGCGGCCTGGACTGCCACGACTTGAAAGAGGCCTGGACTGCC
GTCGCCGACAAGTTTGATATTCTCCGAACCATATTTGTTCCTCTGGCACGGCTCACTGTGAATAACGACAATGGT
GGCAGCATCAAATGGGCCCGTCAACAAGGAATTCATTGCACAATCCTCCAGTTGGTTCGCAAAGAGCCCAGGGTT
CGCTGGACATGGCTAGCTAGCCACCATGAAGCCAACCAAGACGATGATCTATCACAATGGGCTCAGAAGCTCCAG
ATGGAGCTGGCACCCACAGCAACAGTCCAGCCTCCTTGGGCCGTGACCTATTCTGAGCGCCAGGGCAAACTGATG
CTGAGTATGCACCACGCCCTTTACGACCGCGTTTCCGGGGAACTGCTCATGGACACGGTTGCCAAACTCTATCGG
AAGCAAGCCTTGGATCAAGACGACGCAATGGTGCAGCTCCAACGAGGCATGGGATTGGGATTGCTCCCCACAGCC
TCTCAAAGAAAAGAGGCTGCTTCATTATGGAAGAAGCATCTGGACAAGGTTAGAGAGACAACAGGTCCGCTCAAC
GCTGCCCTGCCCGACCTCACGCAGTCTCGACAAGAGCAGCCATGCAGAATTCTTGTGGCAACAAGATCGCTGCCC
GCTTCACTCGTTACAGCGCCATCGTCTACACGGGTCCCTCTTCCTACACTGCTCCAATCGGCGTTTGGATGCATT
CTGGCTTCATATTTGGAGCTCAAAGCCGTTGTCATTGGCCACAACGTCTCACTGAGGTTGCTACACTCAGATCTG
GCGCGCGTCATGGGCCCTGCCATGGCCACTGTTCCCCTCGTTATCCGTGCAGACAGTGGTTCGGCCGAGGAGCTT
TGGGACATCATGGCTTGCGACTCGTCGACCCTGTTGCATAGTATGCACAACCTACACCCTATTGACATTAGGAAA
ATGATCAATGACGGCAGTGGTGGCAAGAATATCCCCTTTCCAGGTCTTTTTGTTTATCACCCGGATTCAGACAAT
AAGCGCGGCGCTCAAGACGTATTTCGCCAAGTTGAAACAGCATTGACGCTACATGTAGAGCATCCTCTGGCCTTG
AATGTATTCGAGGCTCAAGGAACTGTGGAACTGACGGGGAATGGCAGCTGCATTTCACAGACACAGCTAGACCTC
ATGCTGGATCAAATAATCCATCAGGCTCGGGCCATGACTCAGTCACCCCAGAGTCGGCTTGATCAGCTTCAAAAT
ACAATGGACCACCGCCTCATGTCCATTACTGGCCAGGGCACTACTCGTCTTGATATCCCTAAGAGCACAGACCCA
ACAGAGAGAGTCTCTGTCTTCTCGAGGTTGGCGTCACATGAGGCTGGCCTTGAGCCAGACGACGTAGTCGCCATG
TACATGGGCAGAGACATCAAGTCGCTGGCCGTAACGCTGGCCATTTTCCGTGCCGGCTATGTCTACCTGGCATTA
GATGAGCAACTGCCCAAGGCTCGAAAACAAGTCCTCATTAGTGATTCCAAGGCGAAGCTCATTGTCACCACTGAG
CAGCTGTCCAAGGATCTAGACCTGAGTCTGGAAAGCGATGCCTGGGTCTTGATGATGCCAGATGGTGAGAATGAT
GTTGATGTCATGCTCTCTTGGCCTGCATCACCACCAAGTCGTGGAAGTCGTGAAACCGGCCACGGAGGCTATCTT
ATCTACACGTCTGGCTCTACAGGGCGTCCCAAAGGCGTCCGCGTATCCAATGCCAACTTGTGTCATTTCATTGCC
GCCATTAGCACTCGGATGACCGAGGCCTCTCCCGTATCAGCGCGTCTCGGGGGCACGGGCAAGTACCTCAACCTG
ACGTCTCGGGCCTTTGATCCACACCTGACGCAGATTTTTCTGCCCTGGAGCCTAGGCTATCGAGTTGTCATTGGC
AAGGACTGGACAGCCATGCTTGGCAGCTTGCAGCAAGTGATTAATCAACTAGGTATCACGCACTTTGGTTCTGTG
CCTTCTGTCCTGACGCAACTCGGATTACGGCCCGAGGAGATTGCCTCAGTCAAGGTGGTGACGACTGGAGGGGAA
AAGGCCTCAAGGGAGCTGCTTGACATGTGGACAAATGAGACAGAATGTGGCGACGACAAGGCTACTCTTTTCAAT
TTTTACGGACCGACTGAAGTCACGATAGGTTGTGTGGGCCAGGCGGTGGACCGTCATTCAAGCTCTCGCAGCCTT
GGAAAGCCACTGGCGGGTCTCGAGGCCCTGCTTCTATGTCCCAAGACCGGCATGGAGCAAGTCATTGCCAGGAGA
GGACAGGCCGGTGAGCTTTGCATGTTGGGCCCCCAGGTGGCCCTGGGCTATCTCAACAGGCCACTGGAGGAAGGC
AAGAGCTTCCAGACTACGTCGCTGCTGGGAAACGGCGTCAGAAGAATGTACCGAACAGGCGACATGATGAGGATG
ATGCACGACGGCACTCTCGAGTTCCTGGGCAGGGCGGACCAACAGGCCAAGATTCGGGGCCAGAGACTCGAGCTA
GATGAGGTTGTGTCGTTTATGAAACAAAGTGCCTCTAGAGAGGGTCAAGTCGAGTTTGCTGCTGTTGTCTTGAAT
CATGAACGGGTGCTGGGGTTTGCGGCTCGCAGAGCAGTTGCGCTTGTGAGAGGCGAGGTGGAAGCCGAACCTGAG
CTTCTCCAGAAGCCAGGCCGGGCGATATGCCGACTCCTCGAGAGACTGGAGCAGAAATGTGAGGCTGGATTGCCT
GCCTTTATGGTGCCCACCATGGTCTGGGTGTCTCGGATTCCATACCTTGCAGCCTCGGGCAAGGTAGACACCAAG
GCGTTGGCCAAGCTTGCTCAAGGCTTTGCCGCTTGCCAGCAAGATGGAGAGCACCCCAAGCCTCAGCAAAATGCT
GCTCGTGGCCATGATGGCTTGGAGGCCATGGAGAAAGTGGTTATAGCAGCCATAGACGAGGTTATGGGTGGCCAA
GGCTGTAGAAGCGGCACCCAGACAACGGCAGCAAGCAGCCTCCATGGCCTGGGCATCGACAGCCTGTCTGCTCTT
CATCTCGTGTCTCTGCTGCGGGAACGCGGCTTTGCCCAGCTCACCGTGGCCGACGCAATGTCCTCGTCAAGCACG
GTGGCCTCGATGGCTCGATTAGCCGGCAGCGTGGCCTCTTGGGCGCCTCAGCAGCCAATGAAAATGCCAGTCCTC
AGCAGGGCACATCTTGGTCCAGCAGGCGCGGGTCTGGCCAATGTGGCAATTGAGGCCGTTGTGCCCTGTCTGCCC
CTACAATCCGCCCTTGTAGCTCAGTCTCTGTTGTGGCTGAGCGCAAACAGCCACCAGGTTGAGGGTAAAGATGGA
GAGGGAGCGGCGCTCAAGGTGCCCTATGTGACGCAGTTTAGCTATCGCCTCCCTCGCGGCACCCAAGTGGCCAGA
TGGATCAGGGCAGCCGAACAAGTCGTTGCGTCCGAGGCCATGCTGAGAAGTTGCTTTATCCAGAATGGACAGATG
CTCCAGGTTGTTTTGAAATGGCCGACTCGCCTGTCACCATTTCAAGGCCAACAAGACGCGGCAGACATGGTGGCC
CAGATCAGCGTACGGCCGCCCATTAGAATCCAGGTCGGCCAAGACCAAGACTCGGGCGAGGTTGTCATGTCGTTC
AAGATGCATCACGCCTTGTTTGACGCGGTGGCTATTGACGTCTTGGGCAGGCGGCTGGAGCAGAGTTATGAGGGC
AGACGTCTTGTCGGCTCTAGGAGCCTCGAGCTTCTCGAGAGCGTCTCGAGCTACTGCCATGACTTGGACGGGCAA
ATGGAAACAACAAGGCAGCAGTGGCAGGCAAGGCTGGCCAAGGTGTGTCCGTGTCGCGTCAGTGGCAATGGCAAT
GGCAATGGCTATGACGAGACGACTGGCGCCATGGCTCGCTGGTCTCAATGTCTGAACTGCTCGGCCCAAGACATC
AAGGCTCGCTCTCAACACTCAGTCTCTACTGTTTTGCAGCTGGCAACGGCCCTTTGTCTGGCCCACACAACCCAG
CAAGCCTCCGTAGTATACGGCTTTGTCACGTCGCTGCGGCCTCTGCTCAGCCATGTCACCGACGGCATGGATGAC
TTTATCGGACCATGCCTCAACACGGTGGTGCATACGATCCGCCTGGACAGAGGAGACGAGACGCTGCCCAGTCTC
GCCCACCGAGTCGACGAGGCCCACGCAGCTGTCTGCCAGGGAGCCATGCCCCTGGTCAGTGTGGAAAAGGTGCAG
CGTTGGGCTGGATGCCAAGGCAAGCTGTGGGATAGCCTGCTGAGCATCAAGCTGGTGACGCCTCGACGGGCTCTC
GAGGGACGCATAAGCCCTCTATGTGCAAGTGTGGAGGGCAGCAGCGACATGGCTCTGGCCATTGACGTCGATGTG
CACACCAATGGCACAATGGTCTTGAGTCTCTCTTCGGCTGGGGCTCTGGGCCAATGCCAGCTGGAAAAGCTTGGC
CGGCTGTTTGAAAAGGCCGTGGCAAGGTGTGCTGATGAAAATGCCAGAGTGGAGCACTTTGTTTCCCTGCCCAAA
GAGGCTCATTGCGAGGCTACTACTCAAGACGCTGAGGCGGACGCAGGCCCACCTGAGGAGCCATTTCAAGAGGCC
ATGGCTTGCGTTCAAACAGCCATTTGTCGGCTCCTAGACGTCAAGGCCTCTGACGTGGCGGGCACGACTTGGCTC
TATCAGATTGGCCTCGACTCCATCAACGTCTTTGCTCTTGTCTCGCTCATGAACAAGATGAGCAATGTGCAGGTC
AAGGCTGATGCAGTGCTCAAGGCACGGAGCATCCAAGGCGTGGCAAGACTTGTCTACGAGGCCAAGAGGGCCCCT
GTGCCCGACAGGCCAAGAGAGACGACGCACGACACGACTGTGCAGCAGCTGGCCAGGGACATGATGTTTGTGGCA
ACTCCTCTCCAGGCAGGCATGCTGAGCGCATCTCTGGCCATTGCCGACAAGGCCTACACGTATACCCATGGCATC
CAGCTCTCGGCCGACGCTCTCGCAGCAGACACTGCCAGTCTTGACTGCTTCCTGGCCGCTGTCAGAGACACAGTG
CAGGCCTGTGAGATTCTCAGGACACACTTCATCTTTAGCGCCCATGACGAGGCGCCGTGGATTGGCGTGGTGTCG
CCGACGCAGCAGAGCCATCTGGTGAGCTGGGAGACGTTTCCGAGTGGAAGGGTAAAGCTCGTCATTCACCACGCT
CTCTACGACGCCGCTTCACTCGAGGCCATGTGGGATATCCTGCACCAGCACTACCTCGGGCATCTCCAAGGCCGT
CATGGCGCAGTGGCGGAGCATCTATTCAGGCCCTTTGCAGCAGTGGTTGCTGCAGCGCAGGAGGATTCAGTGGCC
TTTTGGTCCAGTCTGCTTCAAGACTACAGCTACACGCCGCTTCACCTTTCAAACGACTCTTTGCAGGCCTCGTGC
GCTTTCCACTTCGCCTTGGGCCAGCACGAGTTGTCTCTTGTGCAAGCAAGATGCAGAGCTCTCGGCGTGACAAGC
AAGGCGGCCTTTGAGCTGGCCTGGGTCAAGGTGCTGTGCCAGTCTCTCTACCGACAAGCCGATGTCGTGTGGGGA
CAAGTCGTCTCGACTGCTGGAGCACTTGAACATGTCCCTGTTGGCCCTACCATCAACACGGTCCCCATGCGCTTC
AGCCTGGTGGACAAGGATAGCTCCAAGGTGCTCAGCGTTGCAGAGGCTTTGCTTGGTCTGCAGCGACTGAGTGAC
GATGCAAGGGGCACGACGGCCATGGCGTCTTTGAGCCGAATTCAAACATTGTGGCGAATGTCAAGTCGGGACCAG
CAACGGGTTCCGGCGACGCTCTTCCAAAGCCTCTTTGTTTTTGATGCCGCGGCTGCACCGTCGACATCACGACGC
CTTTTTACGCCTGTTGAGCATGAGACACGGGCGAGGCAGGGCCCGGTATATGACGATTACCCCTTGATTGTCAGT
TTCCACATGCAAGGCAAGGCTCTTGGCGTGAGGCTGAGGGCGAAGACAAGGACAAGAGACCACGTCGAGACTCTG
GGCAAGGAGTTGGAGAAGACGGTCAAGTGGCTGTGGGAATGCAACTTGGCAGAGGCGGCCCTCGACGTTGCTCAC
ATGGCCGAGGCGGCACCAGCTCTAGACTTGAGCCCAGCGACGCCAGCTCCAGACTTGAGCCCAACGACGCCAGCT
CCAGACTCGAGCCCATGCAGGCAAAAGACTGCACACGCCATTCTCGCCCTCACAAAGACTGTGCTGGGCGCAAAG
AGTCGCGGCAAGCACATTGGCCTCAGGACAAGGCTCGTCAACGCGGGCCTCGACTCCATCTTGGCCATTCGCCTC
TCTGGGCTTCTCAAGGAGCAACTGGGCATCAAGGCCAGTGTCTTCCAGCTCATCAAGGGCGCCAGCATCCACGAT
GTGGTGGAGAGTATGACATTGGCTACCACAGCGAGCAGCGAGAAGCCCATGAGGCCTCTGGTGACGCACAGCGAC
GAGCTCAAGCCGCAGATAGCCAAGCTCCTGCGACTGCAAGACGACGCCATGATGTGCATCCTGCCCGTCCTCGCA
GGCCAGCGCGCACACCTGGAGCAGTGGCTACACAGCGGCAAGAGATTTCTCGAAGCGCCCTGGGTCTACCGCGTC
GAGCACCAGCCTCTCGACGCCGCCACAGTGGCGAGCTGCTGGTCCGAGCTTCGCCGCCTGCATCCAATTCTGCGA
AGCACCTTTGTGTGCACCGGCGCCAAGGCACTCCTGGTCCAAGTCACGCTGAGCGAGCAGTGGGCAGCTCAAGGA
CGAGGCTTTCTTCATGTCCAAGATGGCTCGAGGCCCATTGAAGCCGTAATTCACCACCACGTCGTCGAGACGAAT
GCCATGGCCTCGGACTTGATGGAGCCTCCGGCCCGCCTCTCCCTGCTCGAGGGCCTCGACGGCAAGGCGCTCGTG
CTCCGAGTCCACCACGCGCTATACGACGCCTGGACCATGGCCATGATTGAAGACGACTTGGACAGGCTGCTGGCC
TCTGCTGGCCTCTGCCATGACACGGCTCCGTCGCTGCAGCAAGTCGTCTGCCAGATCAGAGACATGAGGCAGCCC
CATGCCGAGCAGTCATTTTGGAGAGAGCACCTGTCTGGCGCCCACGAGACTGTGCTGTCCATTAGCAATGCGTCG
ACACTGTCCTCGGCCCAGGGCAGCAATACACGGCCTTTGACGGCTCACGACTTGTCTCCCTTGGGCCGCCGCTTC
AAGACGACCTACTCGGCCGCAGTAGTCTCGTCTTGCATGAGCAATGCACGCCTCTCGGCTGCCATTATTGTTGCC
TATGCATCAGCGCTGGGGCGCTTCACCACCACCTCGAGGCCCACCTTTGGCCTCAGCCACGCCTCTCGCGCGCTC
TCTTCCCCCGACGGAACAAGGACGCTCGACTTGACAGCCGCCCGCCTGCCCACGCTCACCCTGACGCCCATGTGT
GTCCACCTGTGCCGTCGAGAGAAGCATCTCGTTGACTCGGTGCAGCACCACCTTGCTCAACTCACCAAGTTTGCC
CAGTCAGACCAGGTGCAACAGTTTTGTCCCCGCTTCAACTCGTACCTTAATATTGTCTTTGCCAGAGACAGTGCC
CAGCGCCCCTCACCAAAGATGCTCCGTAGACACAGGCTCAGCGAGCCGCTGGCTTCGCATTACTGGACCGTCGCC
AAGCCCTGCCATGCTTCCGACTCTGCGATTCAGGGACTGGGCACACAGCACTTGTGTCCCCAGCAATTCTTCTTT
ACCATACTAGTCAGCCCCAGCCGAGATATCAAGGTCACCGTCAGTGGAGATGGCGGCGGCGACTTGGCCATGGTG
GAACAGTTGGTGTCGTACTTTGGCTCAGAGTTGGCGCAAATCGTAGCCCATGCATCCCTAGAATAG
Transcript >OphauB2|7523
ATGTCTCAGCTACCCGTGACCCGGCTTGGGCCACTGCACTGTCACCAACAGCAGTCGCCCCATGAGCTAGAAACA
CCAGGCCCAAGAGTGCAAGACGATGCTCAACTGCTGCGCTGGCAATGTTGCTTTGAATACAAGCCCGACAAGGAC
ACATGTGTTGAAGCTTTTGTGAGGCTCGTCTCTCAAATCCTCGTCCTCCAAGTTGGCGAGGCCTACTGTATCCAA
GACTCGACACGCCGTGGTCTCATCTTGGCTCACCAAAACGACGACGAGCACCACGCTTCTACTTTTATCAAGTGC
CAAGATGGCCAAGATATCCCATCAGACTTTTCCATTGGCAGAGGAAAAGTCTTGCAGCTCCATGCTGATGATGAC
TCCCGACATGTATGGCTGGAAGCGCAGCCCAATGTTGTACCTAGAGAAGCTCTTGCGGCTCTGGGACATATGCTA
CAAGACCTCATTGTCGGCCTGCAGCAGAGTCAAGGGAAACATTTGCAGCGGCAATGGACGCAGCCTTCCCTGCTC
AATATTCCACCGATTGCGAGACCCTTGGTTTTATTTCCTCACGAGCCGGTCTGCTCGGGCCGTCTTGACCACGAG
CCAGCTCTGCTTCACCGCCAATTTGAGCAAAGAGCAGCAGAAATACCGGAAAGAATAGCGCTAGACTTTCTCGTG
GACCTTGAAAGCGGCAAGAGAATACAATACACCTATCAACAAATGGACAACGCCGCCAACGCACTGGCAGCTGAA
CTAGCTCAATCTTGCGCGCAGTCGAGTATTCAGACGGCTGCCGTGCTCATGGGACCCAGTCCAGAGCTTTACATC
AGCTACCTAGCGGCTCTCAAGGCTGGTGTGGCCTTTTGCCCTATTCCCATGCATGCCCCACAAGCCAGAAAAGAA
GTGTTGATGGCAGACCTGAAGCCAACAGTCCTCCTCGTGGCTACATCAACAAATTCAAACCCCTATCAATTTGGT
ACGTCAAGGGTAACGATTGACGTGACTGGCCATCTTTCATCATGCAATACCAAATCTGGGAGACGGTCCCTCGCC
GCCGAGACGGATGTGGCCTACATATTATACACGTCGGGAAGCAGTGGCATGCCAAAGGGAGTGCAAGTCAGCCAC
ATTGCTGCGTCTTGTACCATTTCAGCACTGAGTGCTCACTGCGGCTTCTTTGCGAAAGCACAATCACTATCCAGG
CCCATCAGGTGGTTCCAAGGTGCGGCTCCGACGTTTGACATTTCCCTGTTTGAAATATTCTGGACACTGGGCACC
GGCTCGACGCTCTGTTGCGCGCCGCGCGAGTTTACTCTTCAGGACATTAACAAGGCCATCAGCCACTTGAATGCC
GATATTACCAACATCACTCCCAGCTTTGCCAACCTTCTGGACCCATCGCTGATGCGCGGCCTTATGGTGGGCGGA
GAGACACTAAACACACGGCTCGTACAAGACTTTGCCTGCCACGCCTCTAGTCCTGGTCATGATCAAGTCAGACTT
AGCAACATCTACAACGGATATGGACCTACAGAAACAGCCATTTACTGCATTGCCCAGCCTCATGTCCCAGTAGGG
CAGCGAGGCTCTGTCATCGGCAAACCGCTAGCGACGAGTGGCATTATGATAGTGGACGAAAGAGCCAAGTCGTTG
CACCCTGTGCCTATGGGTGCAATAGGAGAGCTTGTAGTCACTGGCCCTCAAGTCAGCAGCGCAGGCTACCTCAAT
CGCCCTGACGAGACGGCTCGCGTCTTCGTGGACGATGCGCAATGGGGACGGGCGTACAGAACGGGCGACCGAGGC
CGGATTGTGTGGAACGACGCCGGCGAGCCCGTTGTAGAGTTTCTTGGTAGGATCTCGGATGGTCAGGTCAAGCTC
CAGGGAAGACGGGTGGAGCTAGGCGAGGTGGACCAGGTGCTGGCAAGCAGAGTGCAGGGCATACGGGAAATTCTG
TCCTGTGTCTGGACAGCTCCAGCCTGTTCGGGCTCGGACAGGATTGTGGCTCTTGTCGTCCTGGAGCCGCGTGAC
GGCGTCGTCGACTTTGATCTTGTTCGCCAGAGATGTCTTGAGACCGCACAGCGCCACCTTCCCGATTACATGAGG
CCCTTTCGCATCTTGCAGCTTGAGGCGCTGCCCAAATCTTCGTCTGGAAAGATTGATCGCAGGGCAGCTTCAGCT
TACGTGCAAAAGGCTGTTGGTAAAAGTCTTGAATCATTGCCAATGGTAGAGCCCTTGTCGAGCCCCGAAGACGCC
AAGATGGAACAAGAGCTCCTGTGCATTCTTTCAGAGATTGTACAAAATGGCTGGACCATGACGGCGACCACGGCC
CTCGATGAGGCTGGCCTGGACAGTCTAGGCGCCATGAGATTGTTGCGTAATATAAGGCAGAGATGGCCCCGATGC
CAGGACACACGTCTGAATCCACCAATGGCTTTGCTTCTCAACTCTGGAGCCAGCGTCCGCTCTGTATTTTTCCCT
CTGGCACAAGAAGTGGACAAGGAGGCCGAAACACGAGGCCAGCTCGCAAAACTGTCGTCGAGACACATGTCGGAA
GCCCTCGATAAGCTGAATCTCACTAGCGAGGCCGATATTGACATGATTTTGCCGACAACGTGCACCCAAAGTCAG
CTGGCAGTGAGCTTTGCCGTCAACCCTCAGAGCTATATTAGCCATTCTGTCTTGAGAATAAAGCCTGGCGTCTCA
GCCCAAGCTCTCGGCGAGGCTGTCGAGACTGTTGTGTATGGACAGGCCATCTACCGATGTGCAATCCTTGCCGTA
GAAAACTCTCTCTCTCCCTTTATTCAGGTAGTCCTGACACCTGAAGCTTGGCATCGGCTCAATGAGAAGACGAGT
CGGGTCGTGCATAGGAGAGCGAGGAAAGCCTCGGTTTCCAGTGAGGCACAGGTGTGGCTTGACTTGGCTGAGAAG
AATATGAGTCTGGATTCGCAGAGGTTGTACCACATTCAAATCGTTGAGCCAGACTCTGTTTCCGACAGCGCAGGC
CTCTTGGTTATCAGCATTGCCCACTGCATCTGCGACGGTGCCTCCCTCGAGGTGCTCATGAGCGACATAGCCAGA
CAGGTTGCTGGTCTAGAGCCTCTCCCCAGGCATGGCATATACAATGTTGTGATGGAATGGGCTTCGAATGTCCAA
ACCAAGACTGATGAGCTATGGCAAGCGTCGCTCAAGGGCTGGGAAGCCCAAAGTCTTGGTTCGCTCAGCGGCAAC
AAGGCCATGTCGCCTTCTACCCATGGTCACGCAATGGTGGAACACGTCAGCGCCTTGACCTGGCAGGCCTTGCAA
GACAAAAGCATTGCCCTTGGGGCCTCTCCCTTGACAATTCTCCAGGCTTCTTGGGCTCTACTGCTGCATTGTTAT
GCAGAGACGGATACAGAAGAAGTGGTATTTGGAAGCGTTATATCAGGTCACAGCGTCTCGTCGCACGCTCCCACG
TTTTCTGTGCTTCCTTGCCGGGTGGCGCTGCCTGCGAACCAGACCCTCCGCCAGCTCCTTGATGGCCTCAAACGT
GCCTCTCGTTTCACACAGAGCCACCGACACACGTCATTTGGCCTTTTCAAGACACTTCCATACACGACTGCGTTG
GCCTTGCAAGTATATCCTCAACTGGACCCTGAAGATGCCATGCCAGTTCCCTGGACCGAGATTCAGAGACGGGCG
ATATGCTACGATCTGGCCATGTTTGTCGAGATTTTCCCGCGGGGCTCTGACTCGCTAGGCCATCAACAAGAGTCG
AGCAACGTGACACTTAAACTCACATATCGTCAAGATAATCTTTCCGAGCTGGCAGCAACATGCATTGTGAAGCAG
CTTGGCGCACTAACAGAAGTCATGTTGGCTTCACATGCACAAGACATTGCTCAGGGGCTGCCCGCTCACATGGCT
GAAAAACTACTCTCTGTCCAGGGGACCAGGAATGCGAGTGGAGAGAAGGAACAAAAAATTCAGCTTCTACACGCC
CAATTTGAAGAGCAAGCCGTGTCAAGTCCTAATCTACTGGCCCTAAGCTTCTACCCGTCACTAGACTCGCCTCGA
GTCGATGTCAGCTATGCAGAGCTCGAGGCAAGAGCCAATAGCCTGGCAGAAGTGCTGCGAGAGGAGGATGTCGAA
ATTATACCCATGTGTATGCATCGCAGTGTTGAGCTTTATGTCGCCGTCTTGGCAATCTTGAAAGCCGGCTCAGCC
TGGTGTCCAATTGATGAGACGTCTCCCTTGCAGAGACGGACTTCGCTCATTGCCAGGACGCAGAGCAAAGTGTTG
CTGACAACAACGGACTCATTGCCCCTGGTAGAGCCGTGTCTCGCGGACAAGAGCCTCGATGGCGTGCGCATGGTT
CTCGTCGATCAGTACGCTCATGTCAAGACGTGTGCAAAGCCAAAAGCACGTCCTGGCGTCTTGTCTTTGGAGTAC
ATGAGGGGGCAGCATCTTGCCTATCTTCTGTGGACCTCTGGCACAACAGGAGAACCAAAAGGCGTCATGATGCAA
CACTCGGCAGCGGCCCAGGCCATGCGTGACTTGCAGAGCCGAGTCGAGCGTTGCGATAAAGCTGGGCAGGTCCGG
ACTCTGCAGCTCTCGGCCTACAGCTTTGACGTGTTTGTGCAGGATCTCTTCTACACATGGGGCGTGGCAGGCTGT
GTCGTGAGCGGCACCAGAGAGCTTATCCTGGGCAGATTTGTCGATTTTGTCTGGAAATCATGTCCGACACACGCC
CATCTCACACCGTCATTCGGAGCGAGCATCTCTGTCAATGACATCAAGGGCTCGACTCTACAGCATGTGACGTTT
ATTGGAGAGAAGCTGACAGAGGACGTTGCTGAAGCCTGGGCGGCGCCAGGCGTCACATCGCGCACCTACAACACA
TATGGACCGGCTGAGAATGCAGTCGTGTCTACCATGAGACGCTTCTATGCCAAGGGTCAGGACCAGGCCATGGCA
GCCAATGTAGGATTTCCCCTCAGCCAATGTACCTCGTATGTTGTCCGTGAGGTCAAGACAGCACAGGGCAAGCAG
GACCGCTGGCAGCTTGTTCCTCGATATGGGGTTGGCGAGCTGGCTCTGGGTGGCGCTCAAATGGCAAAGGGATAC
TTTGCTGACGCGGCCAAGACGGCCAAGGCCTTTATCGAGGGAGGAGCCGCCATCCAGGAACGCATCTACCTCACG
GGAGACTTGGTGCGCCTCAACGACCACGGCTTCGAGTTCCTGGGCCGAAATGACGACTTGGTCAAGATTACGGGC
ATCCGCATCGAGCTGAGCGAGATTAGCGCCGCCTGTGCCAAGGTCAAGAAGCAAGAAGCAGCCGTGGAACACGTC
GAGACATTATATCTCGAGCGTCCTGGAAGCAGCAACAAAGTCATTGTTACCTTTGTCTCGGTCAAGCAAGATTGC
CTTGACACGGTGCAGCTTAGATCCAAGGTGTTCCAGAAGGCTCGAGACCTGCTGCCACAGTACATGGTTCCCGGC
CACGTTGTTATTTTGAACACAACAATGCCGAGGACGGTGTCCAACAAGGTCCATCGCAAAGCACTGCAGGAATTG
TACAGGGCATCCAATCTGAAGGCTCTGACTGCAGAGCATGATGGCAAGCAGCAGCAGCAGACCTGGACCCAGCAA
CAGCTCTCAGTCCTCCAAGTCGTGGCAAACGTGGGCCAAGTGGCAGTCGAATCTCTGTCGCCCCAAGATGGCTTG
GCCGGCCTTGGTCTCAATTCTCTTGGTCTCACTAAGCTCGTATGGAAGTTGAGGAAACAAGTCAAGTGTCATGTT
GGAGTGGTGGACCTACTACGCTGTCAAGGCATTGGCGAGCTAGTCGACCTTGTCCTAAAAAAGCTGGCGCCACCC
GAAGAAGCCTCATGGCTGGCTCGGATCAAGCACGTCTTGACGGAGCGACTGCATGGCAGTATGCGACCAGCAGAC
ACCTTGTACGTGCTGCCGGCGACTCCAATGCAAGAGGCGCTCATTGTAGAGACCATGATGGAGCCTCGGGCCTAC
TGGGCGCACCGTGTATTTGACATGAGCCATCTAGGCGGCCTGGACTGCCACGACTTGAAAGAGGCCTGGACTGCC
GTCGCCGACAAGTTTGATATTCTCCGAACCATATTTGTTCCTCTGGCACGGCTCACTGTGAATAACGACAATGGT
GGCAGCATCAAATGGGCCCGTCAACAAGGAATTCATTGCACAATCCTCCAGTTGGTTCGCAAAGAGCCCAGGGTT
CGCTGGACATGGCTAGCTAGCCACCATGAAGCCAACCAAGACGATGATCTATCACAATGGGCTCAGAAGCTCCAG
ATGGAGCTGGCACCCACAGCAACAGTCCAGCCTCCTTGGGCCGTGACCTATTCTGAGCGCCAGGGCAAACTGATG
CTGAGTATGCACCACGCCCTTTACGACCGCGTTTCCGGGGAACTGCTCATGGACACGGTTGCCAAACTCTATCGG
AAGCAAGCCTTGGATCAAGACGACGCAATGGTGCAGCTCCAACGAGGCATGGGATTGGGATTGCTCCCCACAGCC
TCTCAAAGAAAAGAGGCTGCTTCATTATGGAAGAAGCATCTGGACAAGGTTAGAGAGACAACAGGTCCGCTCAAC
GCTGCCCTGCCCGACCTCACGCAGTCTCGACAAGAGCAGCCATGCAGAATTCTTGTGGCAACAAGATCGCTGCCC
GCTTCACTCGTTACAGCGCCATCGTCTACACGGGTCCCTCTTCCTACACTGCTCCAATCGGCGTTTGGATGCATT
CTGGCTTCATATTTGGAGCTCAAAGCCGTTGTCATTGGCCACAACGTCTCACTGAGGTTGCTACACTCAGATCTG
GCGCGCGTCATGGGCCCTGCCATGGCCACTGTTCCCCTCGTTATCCGTGCAGACAGTGGTTCGGCCGAGGAGCTT
TGGGACATCATGGCTTGCGACTCGTCGACCCTGTTGCATAGTATGCACAACCTACACCCTATTGACATTAGGAAA
ATGATCAATGACGGCAGTGGTGGCAAGAATATCCCCTTTCCAGGTCTTTTTGTTTATCACCCGGATTCAGACAAT
AAGCGCGGCGCTCAAGACGTATTTCGCCAAGTTGAAACAGCATTGACGCTACATGTAGAGCATCCTCTGGCCTTG
AATGTATTCGAGGCTCAAGGAACTGTGGAACTGACGGGGAATGGCAGCTGCATTTCACAGACACAGCTAGACCTC
ATGCTGGATCAAATAATCCATCAGGCTCGGGCCATGACTCAGTCACCCCAGAGTCGGCTTGATCAGCTTCAAAAT
ACAATGGACCACCGCCTCATGTCCATTACTGGCCAGGGCACTACTCGTCTTGATATCCCTAAGAGCACAGACCCA
ACAGAGAGAGTCTCTGTCTTCTCGAGGTTGGCGTCACATGAGGCTGGCCTTGAGCCAGACGACGTAGTCGCCATG
TACATGGGCAGAGACATCAAGTCGCTGGCCGTAACGCTGGCCATTTTCCGTGCCGGCTATGTCTACCTGGCATTA
GATGAGCAACTGCCCAAGGCTCGAAAACAAGTCCTCATTAGTGATTCCAAGGCGAAGCTCATTGTCACCACTGAG
CAGCTGTCCAAGGATCTAGACCTGAGTCTGGAAAGCGATGCCTGGGTCTTGATGATGCCAGATGGTGAGAATGAT
GTTGATGTCATGCTCTCTTGGCCTGCATCACCACCAAGTCGTGGAAGTCGTGAAACCGGCCACGGAGGCTATCTT
ATCTACACGTCTGGCTCTACAGGGCGTCCCAAAGGCGTCCGCGTATCCAATGCCAACTTGTGTCATTTCATTGCC
GCCATTAGCACTCGGATGACCGAGGCCTCTCCCGTATCAGCGCGTCTCGGGGGCACGGGCAAGTACCTCAACCTG
ACGTCTCGGGCCTTTGATCCACACCTGACGCAGATTTTTCTGCCCTGGAGCCTAGGCTATCGAGTTGTCATTGGC
AAGGACTGGACAGCCATGCTTGGCAGCTTGCAGCAAGTGATTAATCAACTAGGTATCACGCACTTTGGTTCTGTG
CCTTCTGTCCTGACGCAACTCGGATTACGGCCCGAGGAGATTGCCTCAGTCAAGGTGGTGACGACTGGAGGGGAA
AAGGCCTCAAGGGAGCTGCTTGACATGTGGACAAATGAGACAGAATGTGGCGACGACAAGGCTACTCTTTTCAAT
TTTTACGGACCGACTGAAGTCACGATAGGTTGTGTGGGCCAGGCGGTGGACCGTCATTCAAGCTCTCGCAGCCTT
GGAAAGCCACTGGCGGGTCTCGAGGCCCTGCTTCTATGTCCCAAGACCGGCATGGAGCAAGTCATTGCCAGGAGA
GGACAGGCCGGTGAGCTTTGCATGTTGGGCCCCCAGGTGGCCCTGGGCTATCTCAACAGGCCACTGGAGGAAGGC
AAGAGCTTCCAGACTACGTCGCTGCTGGGAAACGGCGTCAGAAGAATGTACCGAACAGGCGACATGATGAGGATG
ATGCACGACGGCACTCTCGAGTTCCTGGGCAGGGCGGACCAACAGGCCAAGATTCGGGGCCAGAGACTCGAGCTA
GATGAGGTTGTGTCGTTTATGAAACAAAGTGCCTCTAGAGAGGGTCAAGTCGAGTTTGCTGCTGTTGTCTTGAAT
CATGAACGGGTGCTGGGGTTTGCGGCTCGCAGAGCAGTTGCGCTTGTGAGAGGCGAGGTGGAAGCCGAACCTGAG
CTTCTCCAGAAGCCAGGCCGGGCGATATGCCGACTCCTCGAGAGACTGGAGCAGAAATGTGAGGCTGGATTGCCT
GCCTTTATGGTGCCCACCATGGTCTGGGTGTCTCGGATTCCATACCTTGCAGCCTCGGGCAAGGTAGACACCAAG
GCGTTGGCCAAGCTTGCTCAAGGCTTTGCCGCTTGCCAGCAAGATGGAGAGCACCCCAAGCCTCAGCAAAATGCT
GCTCGTGGCCATGATGGCTTGGAGGCCATGGAGAAAGTGGTTATAGCAGCCATAGACGAGGTTATGGGTGGCCAA
GGCTGTAGAAGCGGCACCCAGACAACGGCAGCAAGCAGCCTCCATGGCCTGGGCATCGACAGCCTGTCTGCTCTT
CATCTCGTGTCTCTGCTGCGGGAACGCGGCTTTGCCCAGCTCACCGTGGCCGACGCAATGTCCTCGTCAAGCACG
GTGGCCTCGATGGCTCGATTAGCCGGCAGCGTGGCCTCTTGGGCGCCTCAGCAGCCAATGAAAATGCCAGTCCTC
AGCAGGGCACATCTTGGTCCAGCAGGCGCGGGTCTGGCCAATGTGGCAATTGAGGCCGTTGTGCCCTGTCTGCCC
CTACAATCCGCCCTTGTAGCTCAGTCTCTGTTGTGGCTGAGCGCAAACAGCCACCAGGTTGAGGGTAAAGATGGA
GAGGGAGCGGCGCTCAAGGTGCCCTATGTGACGCAGTTTAGCTATCGCCTCCCTCGCGGCACCCAAGTGGCCAGA
TGGATCAGGGCAGCCGAACAAGTCGTTGCGTCCGAGGCCATGCTGAGAAGTTGCTTTATCCAGAATGGACAGATG
CTCCAGGTTGTTTTGAAATGGCCGACTCGCCTGTCACCATTTCAAGGCCAACAAGACGCGGCAGACATGGTGGCC
CAGATCAGCGTACGGCCGCCCATTAGAATCCAGGTCGGCCAAGACCAAGACTCGGGCGAGGTTGTCATGTCGTTC
AAGATGCATCACGCCTTGTTTGACGCGGTGGCTATTGACGTCTTGGGCAGGCGGCTGGAGCAGAGTTATGAGGGC
AGACGTCTTGTCGGCTCTAGGAGCCTCGAGCTTCTCGAGAGCGTCTCGAGCTACTGCCATGACTTGGACGGGCAA
ATGGAAACAACAAGGCAGCAGTGGCAGGCAAGGCTGGCCAAGGTGTGTCCGTGTCGCGTCAGTGGCAATGGCAAT
GGCAATGGCTATGACGAGACGACTGGCGCCATGGCTCGCTGGTCTCAATGTCTGAACTGCTCGGCCCAAGACATC
AAGGCTCGCTCTCAACACTCAGTCTCTACTGTTTTGCAGCTGGCAACGGCCCTTTGTCTGGCCCACACAACCCAG
CAAGCCTCCGTAGTATACGGCTTTGTCACGTCGCTGCGGCCTCTGCTCAGCCATGTCACCGACGGCATGGATGAC
TTTATCGGACCATGCCTCAACACGGTGGTGCATACGATCCGCCTGGACAGAGGAGACGAGACGCTGCCCAGTCTC
GCCCACCGAGTCGACGAGGCCCACGCAGCTGTCTGCCAGGGAGCCATGCCCCTGGTCAGTGTGGAAAAGGTGCAG
CGTTGGGCTGGATGCCAAGGCAAGCTGTGGGATAGCCTGCTGAGCATCAAGCTGGTGACGCCTCGACGGGCTCTC
GAGGGACGCATAAGCCCTCTATGTGCAAGTGTGGAGGGCAGCAGCGACATGGCTCTGGCCATTGACGTCGATGTG
CACACCAATGGCACAATGGTCTTGAGTCTCTCTTCGGCTGGGGCTCTGGGCCAATGCCAGCTGGAAAAGCTTGGC
CGGCTGTTTGAAAAGGCCGTGGCAAGGTGTGCTGATGAAAATGCCAGAGTGGAGCACTTTGTTTCCCTGCCCAAA
GAGGCTCATTGCGAGGCTACTACTCAAGACGCTGAGGCGGACGCAGGCCCACCTGAGGAGCCATTTCAAGAGGCC
ATGGCTTGCGTTCAAACAGCCATTTGTCGGCTCCTAGACGTCAAGGCCTCTGACGTGGCGGGCACGACTTGGCTC
TATCAGATTGGCCTCGACTCCATCAACGTCTTTGCTCTTGTCTCGCTCATGAACAAGATGAGCAATGTGCAGGTC
AAGGCTGATGCAGTGCTCAAGGCACGGAGCATCCAAGGCGTGGCAAGACTTGTCTACGAGGCCAAGAGGGCCCCT
GTGCCCGACAGGCCAAGAGAGACGACGCACGACACGACTGTGCAGCAGCTGGCCAGGGACATGATGTTTGTGGCA
ACTCCTCTCCAGGCAGGCATGCTGAGCGCATCTCTGGCCATTGCCGACAAGGCCTACACGTATACCCATGGCATC
CAGCTCTCGGCCGACGCTCTCGCAGCAGACACTGCCAGTCTTGACTGCTTCCTGGCCGCTGTCAGAGACACAGTG
CAGGCCTGTGAGATTCTCAGGACACACTTCATCTTTAGCGCCCATGACGAGGCGCCGTGGATTGGCGTGGTGTCG
CCGACGCAGCAGAGCCATCTGGTGAGCTGGGAGACGTTTCCGAGTGGAAGGGTAAAGCTCGTCATTCACCACGCT
CTCTACGACGCCGCTTCACTCGAGGCCATGTGGGATATCCTGCACCAGCACTACCTCGGGCATCTCCAAGGCCGT
CATGGCGCAGTGGCGGAGCATCTATTCAGGCCCTTTGCAGCAGTGGTTGCTGCAGCGCAGGAGGATTCAGTGGCC
TTTTGGTCCAGTCTGCTTCAAGACTACAGCTACACGCCGCTTCACCTTTCAAACGACTCTTTGCAGGCCTCGTGC
GCTTTCCACTTCGCCTTGGGCCAGCACGAGTTGTCTCTTGTGCAAGCAAGATGCAGAGCTCTCGGCGTGACAAGC
AAGGCGGCCTTTGAGCTGGCCTGGGTCAAGGTGCTGTGCCAGTCTCTCTACCGACAAGCCGATGTCGTGTGGGGA
CAAGTCGTCTCGACTGCTGGAGCACTTGAACATGTCCCTGTTGGCCCTACCATCAACACGGTCCCCATGCGCTTC
AGCCTGGTGGACAAGGATAGCTCCAAGGTGCTCAGCGTTGCAGAGGCTTTGCTTGGTCTGCAGCGACTGAGTGAC
GATGCAAGGGGCACGACGGCCATGGCGTCTTTGAGCCGAATTCAAACATTGTGGCGAATGTCAAGTCGGGACCAG
CAACGGGTTCCGGCGACGCTCTTCCAAAGCCTCTTTGTTTTTGATGCCGCGGCTGCACCGTCGACATCACGACGC
CTTTTTACGCCTGTTGAGCATGAGACACGGGCGAGGCAGGGCCCGGTATATGACGATTACCCCTTGATTGTCAGT
TTCCACATGCAAGGCAAGGCTCTTGGCGTGAGGCTGAGGGCGAAGACAAGGACAAGAGACCACGTCGAGACTCTG
GGCAAGGAGTTGGAGAAGACGGTCAAGTGGCTGTGGGAATGCAACTTGGCAGAGGCGGCCCTCGACGTTGCTCAC
ATGGCCGAGGCGGCACCAGCTCTAGACTTGAGCCCAGCGACGCCAGCTCCAGACTTGAGCCCAACGACGCCAGCT
CCAGACTCGAGCCCATGCAGGCAAAAGACTGCACACGCCATTCTCGCCCTCACAAAGACTGTGCTGGGCGCAAAG
AGTCGCGGCAAGCACATTGGCCTCAGGACAAGGCTCGTCAACGCGGGCCTCGACTCCATCTTGGCCATTCGCCTC
TCTGGGCTTCTCAAGGAGCAACTGGGCATCAAGGCCAGTGTCTTCCAGCTCATCAAGGGCGCCAGCATCCACGAT
GTGGTGGAGAGTATGACATTGGCTACCACAGCGAGCAGCGAGAAGCCCATGAGGCCTCTGGTGACGCACAGCGAC
GAGCTCAAGCCGCAGATAGCCAAGCTCCTGCGACTGCAAGACGACGCCATGATGTGCATCCTGCCCGTCCTCGCA
GGCCAGCGCGCACACCTGGAGCAGTGGCTACACAGCGGCAAGAGATTTCTCGAAGCGCCCTGGGTCTACCGCGTC
GAGCACCAGCCTCTCGACGCCGCCACAGTGGCGAGCTGCTGGTCCGAGCTTCGCCGCCTGCATCCAATTCTGCGA
AGCACCTTTGTGTGCACCGGCGCCAAGGCACTCCTGGTCCAAGTCACGCTGAGCGAGCAGTGGGCAGCTCAAGGA
CGAGGCTTTCTTCATGTCCAAGATGGCTCGAGGCCCATTGAAGCCGTAATTCACCACCACGTCGTCGAGACGAAT
GCCATGGCCTCGGACTTGATGGAGCCTCCGGCCCGCCTCTCCCTGCTCGAGGGCCTCGACGGCAAGGCGCTCGTG
CTCCGAGTCCACCACGCGCTATACGACGCCTGGACCATGGCCATGATTGAAGACGACTTGGACAGGCTGCTGGCC
TCTGCTGGCCTCTGCCATGACACGGCTCCGTCGCTGCAGCAAGTCGTCTGCCAGATCAGAGACATGAGGCAGCCC
CATGCCGAGCAGTCATTTTGGAGAGAGCACCTGTCTGGCGCCCACGAGACTGTGCTGTCCATTAGCAATGCGTCG
ACACTGTCCTCGGCCCAGGGCAGCAATACACGGCCTTTGACGGCTCACGACTTGTCTCCCTTGGGCCGCCGCTTC
AAGACGACCTACTCGGCCGCAGTAGTCTCGTCTTGCATGAGCAATGCACGCCTCTCGGCTGCCATTATTGTTGCC
TATGCATCAGCGCTGGGGCGCTTCACCACCACCTCGAGGCCCACCTTTGGCCTCAGCCACGCCTCTCGCGCGCTC
TCTTCCCCCGACGGAACAAGGACGCTCGACTTGACAGCCGCCCGCCTGCCCACGCTCACCCTGACGCCCATGTGT
GTCCACCTGTGCCGTCGAGAGAAGCATCTCGTTGACTCGGTGCAGCACCACCTTGCTCAACTCACCAAGTTTGCC
CAGTCAGACCAGGTGCAACAGTTTTGTCCCCGCTTCAACTCGTACCTTAATATTGTCTTTGCCAGAGACAGTGCC
CAGCGCCCCTCACCAAAGATGCTCCGTAGACACAGGCTCAGCGAGCCGCTGGCTTCGCATTACTGGACCGTCGCC
AAGCCCTGCCATGCTTCCGACTCTGCGATTCAGGGACTGGGCACACAGCACTTGTGTCCCCAGCAATTCTTCTTT
ACCATACTAGTCAGCCCCAGCCGAGATATCAAGGTCACCGTCAGTGGAGATGGCGGCGGCGACTTGGCCATGGTG
GAACAGTTGGTGTCGTACTTTGGCTCAGAGTTGGCGCAAATCGTAGCCCATGCATCCCTAGAATAG
Gene >OphauB2|7523
ATGTCTCAGCTACCCGTGACCCGGCTTGGGCCACTGCACTGTCACCAACAGCAGTCGCCCCATGAGCTAGAAACA
CCAGGCCCAAGAGTGCAAGACGATGCTCAACTGCTGCGCTGGCAATGTTGCTTTGAATACAAGCCCGACAAGGAC
ACATGTGTTGAAGCTTTTGTGAGGCTCGTCTCTCAAATCCTCGTCCTCCAAGTTGGCGAGGCCTACTGTATCCAA
GACTCGACACGCCGTGGTCTCATCTTGGCTCACCAAAACGACGACGAGCACCACGCTTCTACTTTTATCAAGTGC
CAAGATGGCCAAGATATCCCATCAGACTTTTCCATTGGCAGAGGAAAAGTGAGTCAAGAGCAGAGTCTAGAGACG
TGCGCTGCATCATGGCTCTAATACCCATCTTAGGTCTTGCAGCTCCATGCTGATGATGACTCCCGACATGTATGG
CTGGAAGCGCAGCCCAATGTTGTACCTAGAGAAGCTCTTGCGGCTCTGGGACATATGCTACAAGACCTCATTGTC
GGCCTGCAGCAGAGTCAAGGGAAACATTTGCAGCGGCAATGGACGCAGCCTTCCCTGCTCAATATTCCACCGATT
GCGAGACCCTTGGTTTTATTTCCTCACGAGCCGGTCTGCTCGGGCCGTCTTGACCACGAGCCAGCTCTGCTTCAC
CGCCAATTTGAGCAAAGAGCAGCAGAAATACCGGAAAGAATAGCGCTAGACTTTCTCGTGGACCTTGAAAGCGGC
AAGAGAATACAATACACCTATCAACAAATGGACAACGCCGCCAACGCACTGGCAGCTGAACTAGCTCAATCTTGC
GCGCAGTCGAGTATTCAGACGGCTGCCGTGCTCATGGGACCCAGTCCAGAGCTTTACATCAGCTACCTAGCGGCT
CTCAAGGCTGGTGTGGCCTTTTGCCCTATTCCCATGCATGCCCCACAAGCCAGAAAAGAAGTGTTGATGGCAGAC
CTGAAGCCAACAGTCCTCCTCGTGGCTACATCAACAAATTCAAACCCCTATCAATTTGGTACGTCAAGGGTAACG
ATTGACGTGACTGGCCATCTTTCATCATGCAATACCAAATCTGGGAGACGGTCCCTCGCCGCCGAGACGGATGTG
GCCTACATATTATACACGTCGGGAAGCAGTGGCATGCCAAAGGGAGTGCAAGTCAGCCACATTGCTGCGTCTTGT
ACCATTTCAGCACTGAGTGCTCACTGCGGCTTCTTTGCGAAAGCACAATCACTATCCAGGCCCATCAGGTGGTTC
CAAGGTGCGGCTCCGACGTTTGACATTTCCCTGTTTGAAATATTCTGGACACTGGGCACCGGCTCGACGCTCTGT
TGCGCGCCGCGCGAGTTTACTCTTCAGGACATTAACAAGGCCATCAGCCACTTGAATGCCGATATTACCAACATC
ACTCCCAGCTTTGCCAACCTTCTGGACCCATCGCTGATGCGCGGCCTTATGGTGGGCGGAGAGACACTAAACACA
CGGCTCGTACAAGACTTTGCCTGCCACGCCTCTAGTCCTGGTCATGATCAAGTCAGACTTAGCAACATCTACAAC
GGATATGGACCTACAGAAACAGCCATTTACTGCATTGCCCAGCCTCATGTCCCAGTAGGGCAGCGAGGCTCTGTC
ATCGGCAAACCGCTAGCGACGAGTGGCATTATGATAGTGGACGAAAGAGCCAAGTCGTTGCACCCTGTGCCTATG
GGTGCAATAGGAGAGCTTGTAGTCACTGGCCCTCAAGTCAGCAGCGCAGGCTACCTCAATCGCCCTGACGAGACG
GCTCGCGTCTTCGTGGACGATGCGCAATGGGGACGGGCGTACAGAACGGGCGACCGAGGCCGGATTGTGTGGAAC
GACGCCGGCGAGCCCGTTGTAGAGTTTCTTGGTAGGATCTCGGATGGTCAGGTCAAGCTCCAGGGAAGACGGGTG
GAGCTAGGCGAGGTGGACCAGGTGCTGGCAAGCAGAGTGCAGGGCATACGGGAAATTCTGTCCTGTGTCTGGACA
GCTCCAGCCTGTTCGGGCTCGGACAGGATTGTGGCTCTTGTCGTCCTGGAGCCGCGTGACGGCGTCGTCGACTTT
GATCTTGTTCGCCAGAGATGTCTTGAGACCGCACAGCGCCACCTTCCCGATTACATGAGGCCCTTTCGCATCTTG
CAGCTTGAGGCGCTGCCCAAATCTTCGTCTGGAAAGATTGATCGCAGGGCAGCTTCAGCTTACGTGCAAAAGGCT
GTTGGTAAAAGTCTTGAATCATTGCCAATGGTAGAGCCCTTGTCGAGCCCCGAAGACGCCAAGATGGAACAAGAG
CTCCTGTGCATTCTTTCAGAGATTGTACAAAATGGCTGGACCATGACGGCGACCACGGCCCTCGATGAGGCTGGC
CTGGACAGTCTAGGCGCCATGAGATTGTTGCGTAATATAAGGCAGAGATGGCCCCGATGCCAGGACACACGTCTG
AATCCACCAATGGCTTTGCTTCTCAACTCTGGAGCCAGCGTCCGCTCTGTATTTTTCCCTCTGGCACAAGAAGTG
GACAAGGAGGCCGAAACACGAGGCCAGCTCGCAAAACTGTCGTCGAGACACATGTCGGAAGCCCTCGATAAGCTG
AATCTCACTAGCGAGGCCGATATTGACATGATTTTGCCGACAACGTGCACCCAAAGTCAGCTGGCAGTGAGCTTT
GCCGTCAACCCTCAGAGCTATATTAGCCATTCTGTCTTGAGAATAAAGCCTGGCGTCTCAGCCCAAGCTCTCGGC
GAGGCTGTCGAGACTGTTGTGTATGGACAGGCCATCTACCGATGTGCAATCCTTGCCGTAGAAAACTCTCTCTCT
CCCTTTATTCAGGTAGTCCTGACACCTGAAGCTTGGCATCGGCTCAATGAGAAGACGAGTCGGGTCGTGCATAGG
AGAGCGAGGAAAGCCTCGGTTTCCAGTGAGGCACAGGTGTGGCTTGACTTGGCTGAGAAGAATATGAGTCTGGAT
TCGCAGAGGTTGTACCACATTCAAATCGTTGAGCCAGACTCTGTTTCCGACAGCGCAGGCCTCTTGGTTATCAGC
ATTGCCCACTGCATCTGCGACGGTGCCTCCCTCGAGGTGCTCATGAGCGACATAGCCAGACAGGTTGCTGGTCTA
GAGCCTCTCCCCAGGCATGGCATATACAATGTTGTGATGGAATGGGCTTCGAATGTCCAAACCAAGACTGATGAG
CTATGGCAAGCGTCGCTCAAGGGCTGGGAAGCCCAAAGTCTTGGTTCGCTCAGCGGCAACAAGGCCATGTCGCCT
TCTACCCATGGTCACGCAATGGTGGAACACGTCAGCGCCTTGACCTGGCAGGCCTTGCAAGACAAAAGCATTGCC
CTTGGGGCCTCTCCCTTGACAATTCTCCAGGCTTCTTGGGCTCTACTGCTGCATTGTTATGCAGAGACGGATACA
GAAGAAGTGGTATTTGGAAGCGTTATATCAGGTCACAGCGTCTCGTCGCACGCTCCCACGTTTTCTGTGCTTCCT
TGCCGGGTGGCGCTGCCTGCGAACCAGACCCTCCGCCAGCTCCTTGATGGCCTCAAACGTGCCTCTCGTTTCACA
CAGAGCCACCGACACACGTCATTTGGCCTTTTCAAGACACTTCCATACACGACTGCGTTGGCCTTGCAAGTATAT
CCTCAACTGGACCCTGAAGATGCCATGCCAGTTCCCTGGACCGAGATTCAGAGACGGGCGATATGCTACGATCTG
GCCATGTTTGTCGAGATTTTCCCGCGGGGCTCTGACTCGCTAGGCCATCAACAAGAGTCGAGCAACGTGACACTT
AAACTCACATATCGTCAAGATAATCTTTCCGAGCTGGCAGCAACATGCATTGTGAAGCAGCTTGGCGCACTAACA
GAAGTCATGTTGGCTTCACATGCACAAGACATTGCTCAGGGGCTGCCCGCTCACATGGCTGAAAAACTACTCTCT
GTCCAGGGGACCAGGAATGCGAGTGGAGAGAAGGAACAAAAAATTCAGCTTCTACACGCCCAATTTGAAGAGCAA
GCCGTGTCAAGTCCTAATCTACTGGCCCTAAGCTTCTACCCGTCACTAGACTCGCCTCGAGTCGATGTCAGCTAT
GCAGAGCTCGAGGCAAGAGCCAATAGCCTGGCAGAAGTGCTGCGAGAGGAGGATGTCGAAATTATACCCATGTGT
ATGCATCGCAGTGTTGAGCTTTATGTCGCCGTCTTGGCAATCTTGAAAGCCGGCTCAGCCTGGTGTCCAATTGAT
GAGACGTCTCCCTTGCAGAGACGGACTTCGCTCATTGCCAGGACGCAGAGCAAAGTGTTGCTGACAACAACGGAC
TCATTGCCCCTGGTAGAGCCGTGTCTCGCGGACAAGAGCCTCGATGGCGTGCGCATGGTTCTCGTCGATCAGTAC
GCTCATGTCAAGACGTGTGCAAAGCCAAAAGCACGTCCTGGCGTCTTGTCTTTGGAGTACATGAGGGGGCAGCAT
CTTGCCTATCTTCTGTGGACCTCTGGCACAACAGGAGAACCAAAAGGCGTCATGATGCAACACTCGGCAGCGGCC
CAGGCCATGCGTGACTTGCAGAGCCGAGTCGAGCGTTGCGATAAAGCTGGGCAGGTCCGGACTCTGCAGCTCTCG
GCCTACAGCTTTGACGTGTTTGTGCAGGATCTCTTCTACACATGGGGCGTGGCAGGCTGTGTCGTGAGCGGCACC
AGAGAGCTTATCCTGGGCAGATTTGTCGATTTTGTCTGGAAATCATGTCCGACACACGCCCATCTCACACCGTCA
TTCGGAGCGAGCATCTCTGTCAATGACATCAAGGGCTCGACTCTACAGCATGTGACGTTTATTGGAGAGAAGCTG
ACAGAGGACGTTGCTGAAGCCTGGGCGGCGCCAGGCGTCACATCGCGCACCTACAACACATATGGACCGGCTGAG
AATGCAGTCGTGTCTACCATGAGACGCTTCTATGCCAAGGGTCAGGACCAGGCCATGGCAGCCAATGTAGGATTT
CCCCTCAGCCAATGTACCTCGTATGTTGTCCGTGAGGTCAAGACAGCACAGGGCAAGCAGGACCGCTGGCAGCTT
GTTCCTCGATATGGGGTTGGCGAGCTGGCTCTGGGTGGCGCTCAAATGGCAAAGGGATACTTTGCTGACGCGGCC
AAGACGGCCAAGGCCTTTATCGAGGGAGGAGCCGCCATCCAGGAACGCATCTACCTCACGGGAGACTTGGTGCGC
CTCAACGACCACGGCTTCGAGTTCCTGGGCCGAAATGACGACTTGGTCAAGATTACGGGCATCCGCATCGAGCTG
AGCGAGATTAGCGCCGCCTGTGCCAAGGTCAAGAAGCAAGAAGCAGCCGTGGAACACGTCGAGACATTATATCTC
GAGCGTCCTGGAAGCAGCAACAAAGTCATTGTTACCTTTGTCTCGGTCAAGCAAGATTGCCTTGACACGGTGCAG
CTTAGATCCAAGGTGTTCCAGAAGGCTCGAGACCTGCTGCCACAGTACATGGTTCCCGGCCACGTTGTTATTTTG
AACACAACAATGCCGAGGACGGTGTCCAACAAGGTCCATCGCAAAGCACTGCAGGAATTGTACAGGGCATCCAAT
CTGAAGGCTCTGACTGCAGAGCATGATGGCAAGCAGCAGCAGCAGACCTGGACCCAGCAACAGCTCTCAGTCCTC
CAAGTCGTGGCAAACGTGGGCCAAGTGGCAGTCGAATCTCTGTCGCCCCAAGATGGCTTGGCCGGCCTTGGTCTC
AATTCTCTTGGTCTCACTAAGCTCGTATGGAAGTTGAGGAAACAAGTCAAGTGTCATGTTGGAGTGGTGGACCTA
CTACGCTGTCAAGGCATTGGCGAGCTAGTCGACCTTGTCCTAAAAAAGCTGGCGCCACCCGAAGAAGCCTCATGG
CTGGCTCGGATCAAGCACGTCTTGACGGAGCGACTGCATGGCAGTATGCGACCAGCAGACACCTTGTACGTGCTG
CCGGCGACTCCAATGCAAGAGGCGCTCATTGTAGAGACCATGATGGAGCCTCGGGCCTACTGGGCGCACCGTGTA
TTTGACATGAGCCATCTAGGCGGCCTGGACTGCCACGACTTGAAAGAGGCCTGGACTGCCGTCGCCGACAAGTTT
GATATTCTCCGAACCATATTTGTTCCTCTGGCACGGCTCACTGTGAATAACGACAATGGTGGCAGCATCAAATGG
GCCCGTCAACAAGGAATTCATTGCACAATCCTCCAGTTGGTTCGCAAAGAGCCCAGGGTTCGCTGGACATGGCTA
GCTAGCCACCATGAAGCCAACCAAGACGATGATCTATCACAATGGGCTCAGAAGCTCCAGATGGAGCTGGCACCC
ACAGCAACAGTCCAGCCTCCTTGGGCCGTGACCTATTCTGAGCGCCAGGGCAAACTGATGCTGAGTATGCACCAC
GCCCTTTACGACCGCGTTTCCGGGGAACTGCTCATGGACACGGTTGCCAAACTCTATCGGAAGCAAGCCTTGGAT
CAAGACGACGCAATGGTGCAGCTCCAACGAGGCATGGGATTGGGATTGCTCCCCACAGCCTCTCAAAGAAAAGAG
GCTGCTTCATTATGGAAGAAGCATCTGGACAAGGTTAGAGAGACAACAGGTCCGCTCAACGCTGCCCTGCCCGAC
CTCACGCAGTCTCGACAAGAGCAGCCATGCAGAATTCTTGTGGCAACAAGATCGCTGCCCGCTTCACTCGTTACA
GCGCCATCGTCTACACGGGTCCCTCTTCCTACACTGCTCCAATCGGCGTTTGGATGCATTCTGGCTTCATATTTG
GAGCTCAAAGCCGTTGTCATTGGCCACAACGTCTCACTGAGGTTGCTACACTCAGATCTGGCGCGCGTCATGGGC
CCTGCCATGGCCACTGTTCCCCTCGTTATCCGTGCAGACAGTGGTTCGGCCGAGGAGCTTTGGGACATCATGGCT
TGCGACTCGTCGACCCTGTTGCATAGTATGCACAACCTACACCCTATTGACATTAGGAAAATGATCAATGACGGC
AGTGGTGGCAAGAATATCCCCTTTCCAGGTCTTTTTGTTTATCACCCGGATTCAGACAATAAGCGCGGCGCTCAA
GACGTATTTCGCCAAGTTGAAACAGCATTGACGCTACATGTAGAGCATCCTCTGGCCTTGAATGTATTCGAGGCT
CAAGGAACTGTGGAACTGACGGGGAATGGCAGCTGCATTTCACAGACACAGCTAGACCTCATGCTGGATCAAATA
ATCCATCAGGCTCGGGCCATGACTCAGTCACCCCAGAGTCGGCTTGATCAGCTTCAAAATACAATGGACCACCGC
CTCATGTCCATTACTGGCCAGGGCACTACTCGTCTTGATATCCCTAAGAGCACAGACCCAACAGAGAGAGTCTCT
GTCTGTGCGTTGGAGAATCCTGAATGGATTGCGGCCGAGCAAGTCATTTATCACAACGCTGGGATAGTTTCAAAA
ACCATTACTTATACTCGGTTGGAAATACTAACCAACATCATAGTCTCGAGGTTGGCGTCACATGAGGCTGGCCTT
GAGCCAGACGACGTAGTCGCCATGTACATGGGCAGAGACATCAAGTCGCTGGCCGTAACGCTGGCCATTTTCCGT
GCCGGCTATGTCTACCTGGCATTAGATGAGCAACTGCCCAAGGCTCGAAAACAAGTCCTCATTAGTGATTCCAAG
GCGAAGCTCATTGTCACCACTGAGCAGCTGTCCAAGGATCTAGACCTGAGTCTGGAAAGCGATGCCTGGGTCTTG
ATGATGCCAGATGGTGAGAATGATGTTGATGTCATGCTCTCTTGGCCTGCATCACCACCAAGTCGTGGAAGTCGT
GAAACCGGCCACGGAGGCTATCTTATCTACACGTCTGGCTCTACAGGGCGTCCCAAAGGCGTCCGCGTATCCAAT
GCCAACTTGTGTCATTTCATTGCCGCCATTAGCACTCGGATGACCGAGGCCTCTCCCGTATCAGCGCGTCTCGGG
GGCACGGGCAAGTACCTCAACCTGACGTCTCGGGCCTTTGATCCACACCTGACGCAGATTTTTCTGCCCTGGAGC
CTAGGCTATCGAGTTGTCATTGGCAAGGACTGGACAGCCATGCTTGGCAGCTTGCAGCAAGTGATTAATCAACTA
GGTATCACGCACTTTGGTTCTGTGCCTTCTGTCCTGACGCAACTCGGATTACGGCCCGAGGAGATTGCCTCAGTC
AAGGTGGTGACGACTGGAGGGGAAAAGGCCTCAAGGGAGCTGCTTGACATGTGGACAAATGAGACAGAATGTGGC
GACGACAAGGCTACTCTTTTCAATTTTTACGGACCGACTGAAGTCACGATAGGTTGTGTGGGCCAGGCGGTGGAC
CGTCATTCAAGCTCTCGCAGCCTTGGAAAGCCACTGGCGGGTCTCGAGGCCCTGCTTCTATGTCCCAAGACCGGC
ATGGAGCAAGTCATTGCCAGGAGAGGACAGGCCGGTGAGCTTTGCATGTTGGGCCCCCAGGTGGCCCTGGGCTAT
CTCAACAGGCCACTGGAGGAAGGCAAGAGCTTCCAGACTACGTCGCTGCTGGGAAACGGCGTCAGAAGAATGTAC
CGAACAGGCGACATGATGAGGATGATGCACGACGGCACTCTCGAGTTCCTGGGCAGGGCGGACCAACAGGCCAAG
ATTCGGGGCCAGAGACTCGAGCTAGATGAGGTTGTGTCGTTTATGAAACAAAGTGCCTCTAGAGAGGGTCAAGTC
GAGTTTGCTGCTGTTGTCTTGAATCATGAACGGGTGCTGGGGTTTGCGGCTCGCAGAGCAGTTGCGCTTGTGAGA
GGCGAGGTGGAAGCCGAACCTGAGCTTCTCCAGAAGCCAGGCCGGGCGATATGCCGACTCCTCGAGAGACTGGAG
CAGAAATGTGAGGCTGGATTGCCTGCCTTTATGGTGCCCACCATGGTCTGGGTGTCTCGGATTCCATACCTTGCA
GCCTCGGGCAAGGTAGACACCAAGGCGTTGGCCAAGCTTGCTCAAGGCTTTGCCGCTTGCCAGCAAGATGGAGAG
CACCCCAAGCCTCAGCAAAATGCTGCTCGTGGCCATGATGGCTTGGAGGCCATGGAGAAAGTGGTTATAGCAGCC
ATAGACGAGGTTATGGGTGGCCAAGGCTGTAGAAGCGGCACCCAGACAACGGCAGCAAGCAGCCTCCATGGCCTG
GGCATCGACAGCCTGTCTGCTCTTCATCTCGTGTCTCTGCTGCGGGAACGCGGCTTTGCCCAGCTCACCGTGGCC
GACGCAATGTCCTCGTCAAGCACGGTGGCCTCGATGGCTCGATTAGCCGGCAGCGTGGCCTCTTGGGCGCCTCAG
CAGCCAATGAAAATGCCAGTCCTCAGCAGGGCACATCTTGGTCCAGCAGGCGCGGGTCTGGCCAATGTGGCAATT
GAGGCCGTTGTGCCCTGTCTGCCCCTACAATCCGCCCTTGTAGCTCAGTCTCTGTTGTGGCTGAGCGCAAACAGC
CACCAGGTTGAGGGTAAAGATGGAGAGGGAGCGGCGCTCAAGGTGCCCTATGTGACGCAGTTTAGCTATCGCCTC
CCTCGCGGCACCCAAGTGGCCAGATGGATCAGGGCAGCCGAACAAGTCGTTGCGTCCGAGGCCATGCTGAGAAGT
TGCTTTATCCAGAATGGACAGATGCTCCAGGTTGTTTTGAAATGGCCGACTCGCCTGTCACCATTTCAAGGCCAA
CAAGACGCGGCAGACATGGTGGCCCAGATCAGCGTACGGCCGCCCATTAGAATCCAGGTCGGCCAAGACCAAGAC
TCGGGCGAGGTTGTCATGTCGTTCAAGATGCATCACGCCTTGTTTGACGCGGTGGCTATTGACGTCTTGGGCAGG
CGGCTGGAGCAGAGTTATGAGGGCAGACGTCTTGTCGGCTCTAGGAGCCTCGAGCTTCTCGAGAGCGTCTCGAGC
TACTGCCATGACTTGGACGGGCAAATGGAAACAACAAGGCAGCAGTGGCAGGCAAGGCTGGCCAAGGTGTGTCCG
TGTCGCGTCAGTGGCAATGGCAATGGCAATGGCTATGACGAGACGACTGGCGCCATGGCTCGCTGGTCTCAATGT
CTGAACTGCTCGGCCCAAGACATCAAGGCTCGCTCTCAACACTCAGTCTCTACTGTTTTGCAGCTGGCAACGGCC
CTTTGTCTGGCCCACACAACCCAGCAAGCCTCCGTAGTATACGGCTTTGTCACGTCGCTGCGGCCTCTGCTCAGC
CATGTCACCGACGGCATGGATGACTTTATCGGACCATGCCTCAACACGGTGGTGCATACGATCCGCCTGGACAGA
GGAGACGAGACGCTGCCCAGTCTCGCCCACCGAGTCGACGAGGCCCACGCAGCTGTCTGCCAGGGAGCCATGCCC
CTGGTCAGTGTGGAAAAGGTGCAGCGTTGGGCTGGATGCCAAGGCAAGCTGTGGGATAGCCTGCTGAGCATCAAG
CTGGTGACGCCTCGACGGGCTCTCGAGGGACGCATAAGCCCTCTATGTGCAAGTGTGGAGGGCAGCAGCGACATG
GCTCTGGCCATTGACGTCGATGTGCACACCAATGGCACAATGGTCTTGAGTCTCTCTTCGGCTGGGGCTCTGGGC
CAATGCCAGCTGGAAAAGCTTGGCCGGCTGTTTGAAAAGGCCGTGGCAAGGTGTGCTGATGAAAATGCCAGAGTG
GAGCACTTTGTTTCCCTGCCCAAAGAGGCTCATTGCGAGGCTACTACTCAAGACGCTGAGGCGGACGCAGGCCCA
CCTGAGGAGCCATTTCAAGAGGCCATGGCTTGCGTTCAAACAGCCATTTGTCGGCTCCTAGACGTCAAGGCCTCT
GACGTGGCGGGCACGACTTGGCTCTATCAGATTGGCCTCGACTCCATCAACGTCTTTGCTCTTGTCTCGCTCATG
AACAAGATGAGCAATGTGCAGGTCAAGGCTGATGCAGTGCTCAAGGCACGGAGCATCCAAGGCGTGGCAAGACTT
GTCTACGAGGCCAAGAGGGCCCCTGTGCCCGACAGGCCAAGAGAGACGACGCACGACACGACTGTGCAGCAGCTG
GCCAGGGACATGATGTTTGTGGCAACTCCTCTCCAGGCAGGCATGCTGAGCGCATCTCTGGCCATTGCCGACAAG
GCCTACACGTATACCCATGGCATCCAGCTCTCGGCCGACGCTCTCGCAGCAGACACTGCCAGTCTTGACTGCTTC
CTGGCCGCTGTCAGAGACACAGTGCAGGCCTGTGAGATTCTCAGGACACACTTCATCTTTAGCGCCCATGACGAG
GCGCCGTGGATTGGCGTGGTGTCGCCGACGCAGCAGAGCCATCTGGTGAGCTGGGAGACGTTTCCGAGTGGAAGG
GTAAAGCTCGTCATTCACCACGCTCTCTACGACGCCGCTTCACTCGAGGCCATGTGGGATATCCTGCACCAGCAC
TACCTCGGGCATCTCCAAGGCCGTCATGGCGCAGTGGCGGAGCATCTATTCAGGCCCTTTGCAGCAGTGGTTGCT
GCAGCGCAGGAGGATTCAGTGGCCTTTTGGTCCAGTCTGCTTCAAGACTACAGCTACACGCCGCTTCACCTTTCA
AACGACTCTTTGCAGGCCTCGTGCGCTTTCCACTTCGCCTTGGGCCAGCACGAGTTGTCTCTTGTGCAAGCAAGA
TGCAGAGCTCTCGGCGTGACAAGCAAGGCGGCCTTTGAGCTGGCCTGGGTCAAGGTGCTGTGCCAGTCTCTCTAC
CGACAAGCCGATGTCGTGTGGGGACAAGTCGTCTCGACTGCTGGAGCACTTGAACATGTCCCTGTTGGCCCTACC
ATCAACACGGTCCCCATGCGCTTCAGCCTGGTGGACAAGGATAGCTCCAAGGTGCTCAGCGTTGCAGAGGCTTTG
CTTGGTCTGCAGCGACTGAGTGACGATGCAAGGGGCACGACGGCCATGGCGTCTTTGAGCCGAATTCAAACATTG
TGGCGAATGTCAAGTCGGGACCAGCAACGGGTTCCGGCGACGCTCTTCCAAAGCCTCTTTGTTTTTGATGCCGCG
GCTGCACCGTCGACATCACGACGCCTTTTTACGCCTGTTGAGCATGAGACACGGGCGAGGCAGGGCCCGGTATAT
GACGATTACCCCTTGATTGTCAGTTTCCACATGCAAGGCAAGGCTCTTGGCGTGAGGCTGAGGGCGAAGACAAGG
ACAAGAGACCACGTCGAGACTCTGGGCAAGGAGTTGGAGAAGACGGTCAAGTGGCTGTGGGAATGCAACTTGGCA
GAGGCGGCCCTCGACGTTGCTCACATGGCCGAGGCGGCACCAGCTCTAGACTTGAGCCCAGCGACGCCAGCTCCA
GACTTGAGCCCAACGACGCCAGCTCCAGACTCGAGCCCATGCAGGCAAAAGACTGCACACGCCATTCTCGCCCTC
ACAAAGACTGTGCTGGGCGCAAAGAGTCGCGGCAAGCACATTGGCCTCAGGACAAGGCTCGTCAACGCGGGCCTC
GACTCCATCTTGGCCATTCGCCTCTCTGGGCTTCTCAAGGAGCAACTGGGCATCAAGGCCAGTGTCTTCCAGCTC
ATCAAGGGCGCCAGCATCCACGATGTGGTGGAGAGTATGACATTGGCTACCACAGCGAGCAGCGAGAAGCCCATG
AGGCCTCTGGTGACGCACAGCGACGAGCTCAAGCCGCAGATAGCCAAGCTCCTGCGACTGCAAGACGACGCCATG
ATGTGCATCCTGCCCGTCCTCGCAGGCCAGCGCGCACACCTGGAGCAGTGGCTACACAGCGGCAAGAGATTTCTC
GAAGCGCCCTGGGTCTACCGCGTCGAGCACCAGCCTCTCGACGCCGCCACAGTGGCGAGCTGCTGGTCCGAGCTT
CGCCGCCTGCATCCAATTCTGCGAAGCACCTTTGTGTGCACCGGCGCCAAGGCACTCCTGGTCCAAGTCACGCTG
AGCGAGCAGTGGGCAGCTCAAGGACGAGGCTTTCTTCATGTCCAAGATGGCTCGAGGCCCATTGAAGCCGTAATT
CACCACCACGTCGTCGAGACGAATGCCATGGCCTCGGACTTGATGGAGCCTCCGGCCCGCCTCTCCCTGCTCGAG
GGCCTCGACGGCAAGGCGCTCGTGCTCCGAGTCCACCACGCGCTATACGACGCCTGGACCATGGCCATGATTGAA
GACGACTTGGACAGGCTGCTGGCCTCTGCTGGCCTCTGCCATGACACGGCTCCGTCGCTGCAGCAAGTCGTCTGC
CAGATCAGAGACATGAGGCAGCCCCATGCCGAGCAGTCATTTTGGAGAGAGCACCTGTCTGGCGCCCACGAGACT
GTGCTGTCCATTAGCAATGCGTCGACACTGTCCTCGGCCCAGGGCAGCAATACACGGCCTTTGACGGCTCACGAC
TTGTCTCCCTTGGGCCGCCGCTTCAAGACGACCTACTCGGCCGCAGTAGTCTCGTCTTGCATGAGCAATGCACGC
CTCTCGGCTGCCATTATTGTTGCCTATGCATCAGCGCTGGGGCGCTTCACCACCACCTCGAGGCCCACCTTTGGC
CTCAGCCACGCCTCTCGCGCGCTCTCTTCCCCCGACGGAACAAGGACGCTCGACTTGACAGCCGCCCGCCTGCCC
ACGCTCACCCTGACGCCCATGTGTGTCCACCTGTGCCGTCGAGAGAAGCATCTCGTTGACTCGGTGCAGCACCAC
CTTGCTCAACTCACCAAGTTTGCCCAGTCAGACCAGGTGCAACAGTTTTGTCCCCGCTTCAACTCGTACCTTAAT
ATTGTCTTTGCCAGAGACAGTGCCCAGCGCCCCTCACCAAAGATGCTCCGTAGACACAGGCTCAGCGAGCCGCTG
GCTTCGCATTACTGGACCGTCGCCAAGCCCTGCCATGCTTCCGACTCTGCGATTCAGGGACTGGGCACACAGCAC
TTGTGTCCCCAGCAATTCTTCTTTACCATACTAGTCAGCCCCAGCCGAGATATCAAGGTCACCGTCAGTGGAGAT
GGCGGCGGCGACTTGGCCATGGTGGAACAGTTGGTGTCGTACTTTGGCTCAGAGTTGGCGCAAATCGTAGCCCAT
GCATCCCTAGAATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail