Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7520
Gene name
LocationContig_80:16021..17773
Strand-
Gene length (bp)1752
Transcript length (bp)1752
Coding sequence length (bp)1752
Protein length (aa) 584

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.0E-11 20 284

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92341|STR3_SCHPO Siderophore iron transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=1 SV=1 1 552 1.0E-114
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 17 556 7.0E-50
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 11 532 7.0E-49
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 18 529 4.0E-46
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 24 531 2.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92341|STR3_SCHPO Siderophore iron transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=1 SV=1 1 552 1.0E-114
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 17 556 7.0E-50
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 11 532 7.0E-49
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 18 529 4.0E-46
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 24 531 2.0E-45
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 24 552 2.0E-42
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 24 531 2.0E-40
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 2 508 2.0E-40
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 24 551 4.0E-40
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 20 498 2.0E-35
sp|Q08299|ENB1_YEAST Siderophore iron transporter ENB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENB1 PE=1 SV=1 31 553 5.0E-35
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 21 529 7.0E-32
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 12 464 2.0E-16
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 70 475 3.0E-14
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 21 460 7.0E-14
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 21 465 4.0E-12
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 12 496 5.0E-12
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 29 318 1.0E-11
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 29 480 7.0E-10
sp|P25594|VBA3_YEAST Vacuolar basic amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA3 PE=1 SV=1 107 464 8.0E-10
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 18 184 1.0E-07
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 17 529 6.0E-07
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 1 304 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0044425 membrane part No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0031224 intrinsic component of membrane No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 10 28 18
2 83 105 22
3 138 160 22
4 167 189 22
5 233 255 22
6 267 289 22
7 339 361 22
8 400 419 19
9 434 456 22
10 506 528 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7520
MYQSGRSGKMLLWLVGISIGLTMFAYALDQGITSTILTTMASSTFGKHSSLAAVATASQIMRAISKPFIGKLADI
TSRPTTYLVILVFYVVGFAVAASSSTFAAYTVGICFTAVGKSGLDLLSDIIVGDLTPLQWRGFFGAALSIPFVVT
VPVNGFIAEAFVDKWRWGLAMFAIVVPVLLIPAIATLYAMQRRGESMGMVTMAASQRLRCEAAHQARGFAYWTSL
LRQGLIDIDIVGLVILGASFSLLLLPFTLATNTPGGWANTRIIVMLVVGAVLLVVFVVFEVYLAPKPLMTRRILR
NRTFLASVTIYTFNQTASSVRNTYFPSYIYIIKEWSSYTWTIFLGITTMGLCIMGPIVGLIQRRTHRYKSMMVFG
AVARLIGYGLLVQSDGTMVQDTARLALAQLIFCLGAFNIVGARVGSQASVPHDDMASMIALLSLWSTLGSSLGSA
VSSAIWTNEMLDRMRIEMPGVDEATILKIYGNIKKLRTSYDSKSPIRQGAIRAYAFVNGHIAIAALVLACMPLIA
TLFMPDFYLGKQQNAVTNTGLDGEKVDVGPRPCPHQGAQEQPKSLYRRWLAAYHKERV*
Coding >OphauB2|7520
ATGTATCAGTCAGGCAGATCCGGCAAGATGCTGCTCTGGCTGGTGGGCATCTCCATCGGTCTCACCATGTTTGCC
TATGCGCTGGACCAAGGCATCACGTCGACCATTTTGACCACAATGGCCAGCTCCACGTTTGGGAAGCACAGTTCG
CTGGCCGCCGTGGCAACGGCCAGTCAGATTATGCGGGCCATCAGCAAGCCCTTTATCGGCAAGCTGGCCGACATT
ACCTCGCGGCCCACTACCTATCTTGTCATCCTCGTCTTCTATGTGGTTGGCTTTGCCGTTGCAGCCAGCTCGAGC
ACCTTTGCTGCCTACACGGTGGGCATCTGCTTTACGGCCGTGGGCAAGTCGGGGCTCGACTTGCTGAGCGACATC
ATTGTTGGCGACTTGACTCCGCTGCAGTGGCGAGGCTTCTTTGGCGCTGCCCTGTCCATTCCCTTTGTTGTGACT
GTGCCTGTCAATGGCTTCATTGCCGAGGCCTTTGTCGACAAGTGGCGATGGGGGCTGGCCATGTTTGCCATTGTC
GTGCCCGTCTTGCTCATTCCAGCCATTGCCACGCTCTATGCAATGCAGCGTCGAGGGGAAAGCATGGGCATGGTC
ACCATGGCCGCCTCGCAGCGCCTGAGGTGCGAGGCCGCTCACCAGGCTCGCGGCTTCGCCTACTGGACCAGTCTC
CTACGCCAAGGACTCATCGACATTGACATTGTGGGCCTCGTCATTCTGGGAGCCTCCTTTTCACTCCTTCTACTC
CCCTTCACCTTGGCAACCAACACGCCCGGCGGCTGGGCCAACACGAGGATAATTGTCATGCTTGTCGTCGGAGCC
GTTTTGCTCGTCGTCTTTGTCGTCTTCGAGGTCTATCTAGCGCCCAAGCCGCTCATGACAAGACGCATTCTCAGG
AACCGCACCTTTCTTGCCTCGGTCACCATCTACACCTTTAACCAGACGGCCTCTTCGGTGCGCAACACCTATTTC
CCCTCATACATCTACATCATCAAGGAGTGGTCAAGCTATACATGGACCATTTTCCTAGGCATCACCACCATGGGG
CTCTGCATCATGGGGCCCATTGTTGGCCTTATCCAGAGACGCACCCACCGCTACAAGTCCATGATGGTCTTTGGC
GCTGTGGCCAGACTCATCGGCTACGGGCTGCTGGTGCAGTCCGACGGCACCATGGTGCAAGACACGGCCCGCCTT
GCGCTGGCCCAGCTCATCTTTTGCCTGGGCGCCTTCAACATTGTCGGGGCGCGCGTGGGCAGTCAAGCCTCGGTG
CCTCACGACGACATGGCTTCCATGATTGCCCTGCTCTCGCTGTGGTCCACCTTGGGCTCGTCGCTTGGCAGTGCT
GTGTCTTCGGCCATCTGGACAAACGAGATGCTCGACCGCATGCGCATCGAGATGCCTGGCGTCGACGAAGCCACC
ATCTTGAAGATATATGGCAATATCAAGAAGCTGCGCACCAGCTACGATTCCAAGAGCCCCATCAGACAGGGCGCC
ATCCGCGCCTATGCATTTGTCAACGGCCATATTGCTATTGCAGCCCTCGTCTTGGCGTGCATGCCTCTTATTGCC
ACCTTGTTTATGCCTGATTTTTACCTGGGCAAGCAGCAGAATGCCGTCACCAACACCGGTCTGGATGGCGAAAAG
GTCGACGTGGGGCCTCGGCCATGCCCCCATCAAGGCGCCCAAGAGCAGCCAAAGTCTTTGTATCGTAGGTGGCTC
GCTGCATACCACAAGGAGCGGGTGTGA
Transcript >OphauB2|7520
ATGTATCAGTCAGGCAGATCCGGCAAGATGCTGCTCTGGCTGGTGGGCATCTCCATCGGTCTCACCATGTTTGCC
TATGCGCTGGACCAAGGCATCACGTCGACCATTTTGACCACAATGGCCAGCTCCACGTTTGGGAAGCACAGTTCG
CTGGCCGCCGTGGCAACGGCCAGTCAGATTATGCGGGCCATCAGCAAGCCCTTTATCGGCAAGCTGGCCGACATT
ACCTCGCGGCCCACTACCTATCTTGTCATCCTCGTCTTCTATGTGGTTGGCTTTGCCGTTGCAGCCAGCTCGAGC
ACCTTTGCTGCCTACACGGTGGGCATCTGCTTTACGGCCGTGGGCAAGTCGGGGCTCGACTTGCTGAGCGACATC
ATTGTTGGCGACTTGACTCCGCTGCAGTGGCGAGGCTTCTTTGGCGCTGCCCTGTCCATTCCCTTTGTTGTGACT
GTGCCTGTCAATGGCTTCATTGCCGAGGCCTTTGTCGACAAGTGGCGATGGGGGCTGGCCATGTTTGCCATTGTC
GTGCCCGTCTTGCTCATTCCAGCCATTGCCACGCTCTATGCAATGCAGCGTCGAGGGGAAAGCATGGGCATGGTC
ACCATGGCCGCCTCGCAGCGCCTGAGGTGCGAGGCCGCTCACCAGGCTCGCGGCTTCGCCTACTGGACCAGTCTC
CTACGCCAAGGACTCATCGACATTGACATTGTGGGCCTCGTCATTCTGGGAGCCTCCTTTTCACTCCTTCTACTC
CCCTTCACCTTGGCAACCAACACGCCCGGCGGCTGGGCCAACACGAGGATAATTGTCATGCTTGTCGTCGGAGCC
GTTTTGCTCGTCGTCTTTGTCGTCTTCGAGGTCTATCTAGCGCCCAAGCCGCTCATGACAAGACGCATTCTCAGG
AACCGCACCTTTCTTGCCTCGGTCACCATCTACACCTTTAACCAGACGGCCTCTTCGGTGCGCAACACCTATTTC
CCCTCATACATCTACATCATCAAGGAGTGGTCAAGCTATACATGGACCATTTTCCTAGGCATCACCACCATGGGG
CTCTGCATCATGGGGCCCATTGTTGGCCTTATCCAGAGACGCACCCACCGCTACAAGTCCATGATGGTCTTTGGC
GCTGTGGCCAGACTCATCGGCTACGGGCTGCTGGTGCAGTCCGACGGCACCATGGTGCAAGACACGGCCCGCCTT
GCGCTGGCCCAGCTCATCTTTTGCCTGGGCGCCTTCAACATTGTCGGGGCGCGCGTGGGCAGTCAAGCCTCGGTG
CCTCACGACGACATGGCTTCCATGATTGCCCTGCTCTCGCTGTGGTCCACCTTGGGCTCGTCGCTTGGCAGTGCT
GTGTCTTCGGCCATCTGGACAAACGAGATGCTCGACCGCATGCGCATCGAGATGCCTGGCGTCGACGAAGCCACC
ATCTTGAAGATATATGGCAATATCAAGAAGCTGCGCACCAGCTACGATTCCAAGAGCCCCATCAGACAGGGCGCC
ATCCGCGCCTATGCATTTGTCAACGGCCATATTGCTATTGCAGCCCTCGTCTTGGCGTGCATGCCTCTTATTGCC
ACCTTGTTTATGCCTGATTTTTACCTGGGCAAGCAGCAGAATGCCGTCACCAACACCGGTCTGGATGGCGAAAAG
GTCGACGTGGGGCCTCGGCCATGCCCCCATCAAGGCGCCCAAGAGCAGCCAAAGTCTTTGTATCGTAGGTGGCTC
GCTGCATACCACAAGGAGCGGGTGTGA
Gene >OphauB2|7520
ATGTATCAGTCAGGCAGATCCGGCAAGATGCTGCTCTGGCTGGTGGGCATCTCCATCGGTCTCACCATGTTTGCC
TATGCGCTGGACCAAGGCATCACGTCGACCATTTTGACCACAATGGCCAGCTCCACGTTTGGGAAGCACAGTTCG
CTGGCCGCCGTGGCAACGGCCAGTCAGATTATGCGGGCCATCAGCAAGCCCTTTATCGGCAAGCTGGCCGACATT
ACCTCGCGGCCCACTACCTATCTTGTCATCCTCGTCTTCTATGTGGTTGGCTTTGCCGTTGCAGCCAGCTCGAGC
ACCTTTGCTGCCTACACGGTGGGCATCTGCTTTACGGCCGTGGGCAAGTCGGGGCTCGACTTGCTGAGCGACATC
ATTGTTGGCGACTTGACTCCGCTGCAGTGGCGAGGCTTCTTTGGCGCTGCCCTGTCCATTCCCTTTGTTGTGACT
GTGCCTGTCAATGGCTTCATTGCCGAGGCCTTTGTCGACAAGTGGCGATGGGGGCTGGCCATGTTTGCCATTGTC
GTGCCCGTCTTGCTCATTCCAGCCATTGCCACGCTCTATGCAATGCAGCGTCGAGGGGAAAGCATGGGCATGGTC
ACCATGGCCGCCTCGCAGCGCCTGAGGTGCGAGGCCGCTCACCAGGCTCGCGGCTTCGCCTACTGGACCAGTCTC
CTACGCCAAGGACTCATCGACATTGACATTGTGGGCCTCGTCATTCTGGGAGCCTCCTTTTCACTCCTTCTACTC
CCCTTCACCTTGGCAACCAACACGCCCGGCGGCTGGGCCAACACGAGGATAATTGTCATGCTTGTCGTCGGAGCC
GTTTTGCTCGTCGTCTTTGTCGTCTTCGAGGTCTATCTAGCGCCCAAGCCGCTCATGACAAGACGCATTCTCAGG
AACCGCACCTTTCTTGCCTCGGTCACCATCTACACCTTTAACCAGACGGCCTCTTCGGTGCGCAACACCTATTTC
CCCTCATACATCTACATCATCAAGGAGTGGTCAAGCTATACATGGACCATTTTCCTAGGCATCACCACCATGGGG
CTCTGCATCATGGGGCCCATTGTTGGCCTTATCCAGAGACGCACCCACCGCTACAAGTCCATGATGGTCTTTGGC
GCTGTGGCCAGACTCATCGGCTACGGGCTGCTGGTGCAGTCCGACGGCACCATGGTGCAAGACACGGCCCGCCTT
GCGCTGGCCCAGCTCATCTTTTGCCTGGGCGCCTTCAACATTGTCGGGGCGCGCGTGGGCAGTCAAGCCTCGGTG
CCTCACGACGACATGGCTTCCATGATTGCCCTGCTCTCGCTGTGGTCCACCTTGGGCTCGTCGCTTGGCAGTGCT
GTGTCTTCGGCCATCTGGACAAACGAGATGCTCGACCGCATGCGCATCGAGATGCCTGGCGTCGACGAAGCCACC
ATCTTGAAGATATATGGCAATATCAAGAAGCTGCGCACCAGCTACGATTCCAAGAGCCCCATCAGACAGGGCGCC
ATCCGCGCCTATGCATTTGTCAACGGCCATATTGCTATTGCAGCCCTCGTCTTGGCGTGCATGCCTCTTATTGCC
ACCTTGTTTATGCCTGATTTTTACCTGGGCAAGCAGCAGAATGCCGTCACCAACACCGGTCTGGATGGCGAAAAG
GTCGACGTGGGGCCTCGGCCATGCCCCCATCAAGGCGCCCAAGAGCAGCCAAAGTCTTTGTATCGTAGGTGGCTC
GCTGCATACCACAAGGAGCGGGTGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail