Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7519
Gene name
LocationContig_80:13015..15499
Strand-
Gene length (bp)2484
Transcript length (bp)2484
Coding sequence length (bp)2484
Protein length (aa) 828

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16203 ERCC3_RAD25_C ERCC3/RAD25/XPB C-terminal helicase 1.4E-124 521 756
PF13625 Helicase_C_3 Helicase conserved C-terminal domain 1.3E-33 101 225
PF04851 ResIII Type III restriction enzyme, res subunit 9.4E-15 338 495
PF00271 Helicase_C Helicase conserved C-terminal domain 8.2E-11 565 671

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00578|RAD25_YEAST DNA repair helicase RAD25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSL2 PE=1 SV=1 73 803 0.0E+00
sp|A9CRJ7|RAD25_ENTBH Probable DNA repair helicase RAD25 homolog OS=Enterocytozoon bieneusi (strain H348) GN=RAD25 PE=3 SV=1 293 752 0.0E+00
sp|C4V922|RAD25_NOSCE Probable DNA repair helicase RAD25 homolog OS=Nosema ceranae (strain BRL01) GN=RAD25 PE=3 SV=1 91 796 0.0E+00
sp|Q8SSK1|RAD25_ENCCU Probable DNA repair helicase RAD25 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=RAD25 PE=3 SV=2 89 807 0.0E+00
sp|Q6E6J3|RAD25_ANTLO Probable DNA repair helicase RAD25 homolog OS=Antonospora locustae GN=RAD25 PE=3 SV=1 89 743 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00578|RAD25_YEAST DNA repair helicase RAD25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSL2 PE=1 SV=1 73 803 0.0E+00
sp|A9CRJ7|RAD25_ENTBH Probable DNA repair helicase RAD25 homolog OS=Enterocytozoon bieneusi (strain H348) GN=RAD25 PE=3 SV=1 293 752 0.0E+00
sp|C4V922|RAD25_NOSCE Probable DNA repair helicase RAD25 homolog OS=Nosema ceranae (strain BRL01) GN=RAD25 PE=3 SV=1 91 796 0.0E+00
sp|Q8SSK1|RAD25_ENCCU Probable DNA repair helicase RAD25 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=RAD25 PE=3 SV=2 89 807 0.0E+00
sp|Q6E6J3|RAD25_ANTLO Probable DNA repair helicase RAD25 homolog OS=Antonospora locustae GN=RAD25 PE=3 SV=1 89 743 0.0E+00
sp|Q38861|XPB1_ARATH DNA repair helicase XPB1 OS=Arabidopsis thaliana GN=XPB1 PE=2 SV=3 84 816 0.0E+00
sp|Q9FUG4|XPB2_ARATH DNA repair helicase XPB2 OS=Arabidopsis thaliana GN=XPB2 PE=2 SV=1 84 816 0.0E+00
sp|Q5ZKK7|ERCC3_CHICK TFIIH basal transcription factor complex helicase XPB subunit OS=Gallus gallus GN=ERCC3 PE=2 SV=1 81 800 0.0E+00
sp|Q7ZVV1|ERCC3_DANRE TFIIH basal transcription factor complex helicase XPB subunit OS=Danio rerio GN=ercc3 PE=2 SV=1 81 792 0.0E+00
sp|Q02870|ERCC3_DROME DNA excision repair protein haywire OS=Drosophila melanogaster GN=hay PE=1 SV=2 81 796 0.0E+00
sp|Q1RMT1|ERCC3_BOVIN TFIIH basal transcription factor complex helicase XPB subunit OS=Bos taurus GN=ERCC3 PE=2 SV=1 81 792 0.0E+00
sp|Q5RA62|ERCC3_PONAB TFIIH basal transcription factor complex helicase XPB subunit OS=Pongo abelii GN=ERCC3 PE=2 SV=1 81 803 0.0E+00
sp|P19447|ERCC3_HUMAN TFIIH basal transcription factor complex helicase XPB subunit OS=Homo sapiens GN=ERCC3 PE=1 SV=1 81 803 0.0E+00
sp|Q60HG1|ERCC3_MACFA TFIIH basal transcription factor complex helicase XPB subunit OS=Macaca fascicularis GN=ERCC3 PE=2 SV=1 81 803 0.0E+00
sp|P49135|ERCC3_MOUSE TFIIH basal transcription factor complex helicase XPB subunit OS=Mus musculus GN=Ercc3 PE=2 SV=1 81 817 0.0E+00
sp|Q4G005|ERCC3_RAT TFIIH basal transcription factor complex helicase XPB subunit OS=Rattus norvegicus GN=Ercc3 PE=1 SV=1 81 817 0.0E+00
sp|O00835|ERCC3_DICDI TFIIH basal transcription factor complex helicase repB subunit OS=Dictyostelium discoideum GN=repB PE=2 SV=1 91 792 0.0E+00
sp|O13768|ERCC3_SCHPO Probable DNA repair helicase ercc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ercc3 PE=1 SV=1 80 816 0.0E+00
sp|Q9HPZ2|RAD25_HALSA Putative DNA helicase Rad25 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rad25 PE=3 SV=2 295 708 6.0E-41
sp|Q5V5F7|RAD25_HALMA Putative DNA helicase Rad25 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rad25 PE=3 SV=2 303 708 8.0E-37
sp|A9CRJ7|RAD25_ENTBH Probable DNA repair helicase RAD25 homolog OS=Enterocytozoon bieneusi (strain H348) GN=RAD25 PE=3 SV=1 91 227 1.0E-25
sp|Q914K8|Y022_SIFVH Putative helicase 22 OS=Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) GN=SIFV0022 PE=3 SV=1 330 679 6.0E-11
sp|Q5UQ46|YL396_MIMIV Putative ATP-dependent RNA helicase L396 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L396 PE=3 SV=1 332 611 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0005524 ATP binding Yes
GO:0003677 DNA binding Yes
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0003676 nucleic acid binding No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2674
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|598
Ophiocordyceps australis map64 (Brazil) OphauB2|7519 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04912
Ophiocordyceps camponoti-rufipedis Ophun1|4462
Ophiocordyceps kimflemingae Ophio5|8290
Ophiocordyceps subramaniannii Hirsu2|4152

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7519
MPPKRKAAPAAQGSIKAGKTSRVSTPGVVTPRSLESNEELDDDDGPVDELLERDIDNNIDRFSLEKYQKKHVVRE
PLHHIFGDRDFSYLELKKDHQNRPLWIDPQKGRIILESFNSLAEQAQDFLITIAEPLSRPTFMHEYALTTHSLYA
AVSVGLSPRDIINTLDRFLKTPLPDEIRDFITSCTQSYGKVKLVLKNTKYYVESPDPNMLQTLLKNPKIGPLRVQ
GTEEITTSAAPKIGGLVIPGTKNAAGVKQASDLQQRSGEQAQEQLPEGDLLTNLNEEDDEEQEVTHSFEIADKDV
ETVQKECLNLGYPVLEEYDFRRDEVNANLDIDLKPGTQIRPYQEKSLSKMFGNGRAKSGLIVLPCGAGKTLVGIT
AACTIKKGVIVLCTSSMSVVQWRQEFLKWSNINPDDIVAFTSDSKGSVFTGSTGIIVTTYSMVTQSRARSYDAEK
MMKFLTGREWGLMLLDEVHVVPANIFRKVTSSIKTHSKLGLTATLLREDDKISDLNFLIGPKLFEANWMELSQQG
HIARVQCAEVWCPMPTEFYDEYLRAPSRKKNLLYIMNPRKFQACQYLVNYHESRGDKIIVFSDNVYALKAYALKL
NKVFIFGGTGQAERLQVLENFQHNPHVNTLFLSKIGDTSLDLPEATCLIQISSHYGSRRQEAQRLGRILRAKRRN
DEGFNAFFYSLVSKDTQEMYFSSKRQAFLVDQGYAFKVITQLANIEQTPQLAFATASERRELLQKVLVENETMED
EDITDDLFHSGSMGRKRKRGAARRTAGTLGELSGGQDMAYIEQNKRVNQALKKGKSKKESSSFFKKIGRENARRA
AQ*
Coding >OphauB2|7519
ATGCCTCCCAAACGCAAGGCTGCTCCAGCCGCGCAAGGCAGCATAAAGGCTGGAAAGACATCACGAGTCTCGACG
CCCGGCGTTGTCACTCCACGAAGCCTCGAAAGCAACGAAGAGTTGGACGACGATGACGGGCCCGTAGACGAACTA
CTCGAACGGGATATCGACAACAACATTGACCGCTTTTCCCTCGAAAAATACCAGAAAAAGCATGTTGTTCGTGAA
CCACTGCACCACATCTTTGGAGACCGAGACTTCTCCTACCTGGAGCTCAAGAAGGATCACCAAAACCGCCCGCTC
TGGATCGATCCGCAAAAGGGCAGAATCATTCTCGAGAGTTTTAATTCGCTGGCCGAACAAGCACAAGACTTCCTC
ATTACTATTGCAGAACCTCTTTCACGCCCGACTTTTATGCACGAATATGCCCTGACAACGCACAGCCTCTACGCT
GCCGTCTCTGTAGGGCTGTCACCTCGAGATATCATCAACACGCTGGATCGATTCCTCAAGACGCCACTCCCCGAC
GAGATTCGAGACTTCATAACGAGCTGCACGCAGAGCTATGGCAAGGTCAAGCTGGTGCTCAAGAATACAAAATAC
TACGTCGAGTCGCCCGACCCCAACATGCTGCAGACACTGCTCAAGAACCCCAAGATTGGGCCTTTGCGAGTTCAA
GGAACAGAGGAGATTACTACTTCGGCTGCGCCCAAGATTGGGGGTCTTGTCATTCCAGGAACCAAGAATGCGGCT
GGGGTCAAGCAAGCCAGCGATTTACAACAAAGAAGTGGCGAACAGGCACAAGAACAGCTCCCAGAAGGAGACTTG
CTTACAAACCTCAATGAGGAAGACGACGAGGAACAAGAAGTTACGCACTCGTTTGAGATTGCCGACAAGGACGTG
GAAACGGTGCAAAAAGAATGCCTCAACCTTGGATATCCTGTCTTGGAAGAATACGACTTTCGGCGCGACGAGGTT
AATGCCAATCTCGACATTGACCTCAAGCCGGGCACGCAGATTCGGCCGTACCAGGAAAAGAGCCTCAGCAAGATG
TTTGGCAATGGTCGCGCAAAGAGCGGTCTCATTGTCTTGCCCTGCGGCGCTGGCAAGACGCTCGTGGGCATTACG
GCTGCCTGCACCATCAAAAAGGGTGTCATCGTGCTGTGTACCAGCTCCATGTCAGTCGTTCAGTGGAGACAAGAA
TTTCTGAAGTGGTCCAATATCAATCCAGACGACATTGTGGCCTTCACTTCAGACTCCAAGGGCAGCGTCTTCACG
GGCAGCACAGGCATCATTGTCACAACGTACTCAATGGTGACACAGTCGAGAGCGCGCTCGTATGACGCCGAGAAA
ATGATGAAGTTCTTGACAGGCCGCGAATGGGGCCTGATGCTACTCGACGAGGTGCACGTGGTGCCAGCCAATATT
TTTCGCAAGGTGACATCGTCCATCAAGACGCACTCCAAGCTGGGCCTAACAGCCACGCTGCTGCGAGAAGACGAC
AAAATTTCCGATCTCAACTTTCTCATCGGCCCCAAGCTGTTTGAGGCCAACTGGATGGAGCTTTCTCAACAAGGC
CATATTGCTAGGGTGCAGTGTGCCGAGGTGTGGTGTCCCATGCCCACAGAGTTTTACGACGAGTACCTTCGGGCT
CCATCACGCAAAAAGAACTTGCTCTACATCATGAACCCCCGCAAGTTCCAGGCCTGCCAGTACCTTGTTAATTAT
CACGAGTCACGCGGAGACAAAATCATTGTCTTTTCCGATAATGTCTACGCGCTCAAGGCATACGCGCTCAAGCTC
AACAAGGTCTTCATTTTTGGTGGGACAGGCCAAGCAGAGCGCTTGCAGGTCTTGGAAAACTTTCAACACAACCCA
CATGTCAACACACTGTTTCTCTCCAAGATTGGTGATACATCGCTAGACTTACCAGAGGCTACGTGCCTGATTCAA
ATCTCGTCGCACTATGGTTCTCGCCGTCAGGAAGCTCAACGTCTGGGCCGCATCCTTCGGGCCAAACGGCGCAAC
GATGAGGGCTTCAACGCATTCTTCTATTCTCTCGTGTCCAAGGACACGCAAGAAATGTACTTTTCATCAAAGCGG
CAGGCATTTCTCGTCGACCAGGGATACGCATTCAAGGTGATTACACAGCTGGCCAACATTGAACAAACACCCCAA
CTGGCCTTTGCAACAGCAAGTGAACGGCGCGAACTCCTGCAAAAGGTCTTGGTGGAAAATGAGACGATGGAGGAT
GAGGACATTACAGACGACTTGTTTCACAGTGGTAGCATGGGACGAAAGAGGAAGAGGGGCGCAGCACGGCGGACG
GCTGGCACCCTGGGCGAGTTAAGTGGCGGGCAAGACATGGCGTATATTGAGCAGAACAAGAGGGTCAACCAGGCG
CTCAAGAAGGGCAAGTCGAAGAAGGAGAGCAGTTCCTTTTTCAAGAAGATAGGGCGTGAAAACGCAAGGCGGGCA
GCGCAGTAA
Transcript >OphauB2|7519
ATGCCTCCCAAACGCAAGGCTGCTCCAGCCGCGCAAGGCAGCATAAAGGCTGGAAAGACATCACGAGTCTCGACG
CCCGGCGTTGTCACTCCACGAAGCCTCGAAAGCAACGAAGAGTTGGACGACGATGACGGGCCCGTAGACGAACTA
CTCGAACGGGATATCGACAACAACATTGACCGCTTTTCCCTCGAAAAATACCAGAAAAAGCATGTTGTTCGTGAA
CCACTGCACCACATCTTTGGAGACCGAGACTTCTCCTACCTGGAGCTCAAGAAGGATCACCAAAACCGCCCGCTC
TGGATCGATCCGCAAAAGGGCAGAATCATTCTCGAGAGTTTTAATTCGCTGGCCGAACAAGCACAAGACTTCCTC
ATTACTATTGCAGAACCTCTTTCACGCCCGACTTTTATGCACGAATATGCCCTGACAACGCACAGCCTCTACGCT
GCCGTCTCTGTAGGGCTGTCACCTCGAGATATCATCAACACGCTGGATCGATTCCTCAAGACGCCACTCCCCGAC
GAGATTCGAGACTTCATAACGAGCTGCACGCAGAGCTATGGCAAGGTCAAGCTGGTGCTCAAGAATACAAAATAC
TACGTCGAGTCGCCCGACCCCAACATGCTGCAGACACTGCTCAAGAACCCCAAGATTGGGCCTTTGCGAGTTCAA
GGAACAGAGGAGATTACTACTTCGGCTGCGCCCAAGATTGGGGGTCTTGTCATTCCAGGAACCAAGAATGCGGCT
GGGGTCAAGCAAGCCAGCGATTTACAACAAAGAAGTGGCGAACAGGCACAAGAACAGCTCCCAGAAGGAGACTTG
CTTACAAACCTCAATGAGGAAGACGACGAGGAACAAGAAGTTACGCACTCGTTTGAGATTGCCGACAAGGACGTG
GAAACGGTGCAAAAAGAATGCCTCAACCTTGGATATCCTGTCTTGGAAGAATACGACTTTCGGCGCGACGAGGTT
AATGCCAATCTCGACATTGACCTCAAGCCGGGCACGCAGATTCGGCCGTACCAGGAAAAGAGCCTCAGCAAGATG
TTTGGCAATGGTCGCGCAAAGAGCGGTCTCATTGTCTTGCCCTGCGGCGCTGGCAAGACGCTCGTGGGCATTACG
GCTGCCTGCACCATCAAAAAGGGTGTCATCGTGCTGTGTACCAGCTCCATGTCAGTCGTTCAGTGGAGACAAGAA
TTTCTGAAGTGGTCCAATATCAATCCAGACGACATTGTGGCCTTCACTTCAGACTCCAAGGGCAGCGTCTTCACG
GGCAGCACAGGCATCATTGTCACAACGTACTCAATGGTGACACAGTCGAGAGCGCGCTCGTATGACGCCGAGAAA
ATGATGAAGTTCTTGACAGGCCGCGAATGGGGCCTGATGCTACTCGACGAGGTGCACGTGGTGCCAGCCAATATT
TTTCGCAAGGTGACATCGTCCATCAAGACGCACTCCAAGCTGGGCCTAACAGCCACGCTGCTGCGAGAAGACGAC
AAAATTTCCGATCTCAACTTTCTCATCGGCCCCAAGCTGTTTGAGGCCAACTGGATGGAGCTTTCTCAACAAGGC
CATATTGCTAGGGTGCAGTGTGCCGAGGTGTGGTGTCCCATGCCCACAGAGTTTTACGACGAGTACCTTCGGGCT
CCATCACGCAAAAAGAACTTGCTCTACATCATGAACCCCCGCAAGTTCCAGGCCTGCCAGTACCTTGTTAATTAT
CACGAGTCACGCGGAGACAAAATCATTGTCTTTTCCGATAATGTCTACGCGCTCAAGGCATACGCGCTCAAGCTC
AACAAGGTCTTCATTTTTGGTGGGACAGGCCAAGCAGAGCGCTTGCAGGTCTTGGAAAACTTTCAACACAACCCA
CATGTCAACACACTGTTTCTCTCCAAGATTGGTGATACATCGCTAGACTTACCAGAGGCTACGTGCCTGATTCAA
ATCTCGTCGCACTATGGTTCTCGCCGTCAGGAAGCTCAACGTCTGGGCCGCATCCTTCGGGCCAAACGGCGCAAC
GATGAGGGCTTCAACGCATTCTTCTATTCTCTCGTGTCCAAGGACACGCAAGAAATGTACTTTTCATCAAAGCGG
CAGGCATTTCTCGTCGACCAGGGATACGCATTCAAGGTGATTACACAGCTGGCCAACATTGAACAAACACCCCAA
CTGGCCTTTGCAACAGCAAGTGAACGGCGCGAACTCCTGCAAAAGGTCTTGGTGGAAAATGAGACGATGGAGGAT
GAGGACATTACAGACGACTTGTTTCACAGTGGTAGCATGGGACGAAAGAGGAAGAGGGGCGCAGCACGGCGGACG
GCTGGCACCCTGGGCGAGTTAAGTGGCGGGCAAGACATGGCGTATATTGAGCAGAACAAGAGGGTCAACCAGGCG
CTCAAGAAGGGCAAGTCGAAGAAGGAGAGCAGTTCCTTTTTCAAGAAGATAGGGCGTGAAAACGCAAGGCGGGCA
GCGCAGTAA
Gene >OphauB2|7519
ATGCCTCCCAAACGCAAGGCTGCTCCAGCCGCGCAAGGCAGCATAAAGGCTGGAAAGACATCACGAGTCTCGACG
CCCGGCGTTGTCACTCCACGAAGCCTCGAAAGCAACGAAGAGTTGGACGACGATGACGGGCCCGTAGACGAACTA
CTCGAACGGGATATCGACAACAACATTGACCGCTTTTCCCTCGAAAAATACCAGAAAAAGCATGTTGTTCGTGAA
CCACTGCACCACATCTTTGGAGACCGAGACTTCTCCTACCTGGAGCTCAAGAAGGATCACCAAAACCGCCCGCTC
TGGATCGATCCGCAAAAGGGCAGAATCATTCTCGAGAGTTTTAATTCGCTGGCCGAACAAGCACAAGACTTCCTC
ATTACTATTGCAGAACCTCTTTCACGCCCGACTTTTATGCACGAATATGCCCTGACAACGCACAGCCTCTACGCT
GCCGTCTCTGTAGGGCTGTCACCTCGAGATATCATCAACACGCTGGATCGATTCCTCAAGACGCCACTCCCCGAC
GAGATTCGAGACTTCATAACGAGCTGCACGCAGAGCTATGGCAAGGTCAAGCTGGTGCTCAAGAATACAAAATAC
TACGTCGAGTCGCCCGACCCCAACATGCTGCAGACACTGCTCAAGAACCCCAAGATTGGGCCTTTGCGAGTTCAA
GGAACAGAGGAGATTACTACTTCGGCTGCGCCCAAGATTGGGGGTCTTGTCATTCCAGGAACCAAGAATGCGGCT
GGGGTCAAGCAAGCCAGCGATTTACAACAAAGAAGTGGCGAACAGGCACAAGAACAGCTCCCAGAAGGAGACTTG
CTTACAAACCTCAATGAGGAAGACGACGAGGAACAAGAAGTTACGCACTCGTTTGAGATTGCCGACAAGGACGTG
GAAACGGTGCAAAAAGAATGCCTCAACCTTGGATATCCTGTCTTGGAAGAATACGACTTTCGGCGCGACGAGGTT
AATGCCAATCTCGACATTGACCTCAAGCCGGGCACGCAGATTCGGCCGTACCAGGAAAAGAGCCTCAGCAAGATG
TTTGGCAATGGTCGCGCAAAGAGCGGTCTCATTGTCTTGCCCTGCGGCGCTGGCAAGACGCTCGTGGGCATTACG
GCTGCCTGCACCATCAAAAAGGGTGTCATCGTGCTGTGTACCAGCTCCATGTCAGTCGTTCAGTGGAGACAAGAA
TTTCTGAAGTGGTCCAATATCAATCCAGACGACATTGTGGCCTTCACTTCAGACTCCAAGGGCAGCGTCTTCACG
GGCAGCACAGGCATCATTGTCACAACGTACTCAATGGTGACACAGTCGAGAGCGCGCTCGTATGACGCCGAGAAA
ATGATGAAGTTCTTGACAGGCCGCGAATGGGGCCTGATGCTACTCGACGAGGTGCACGTGGTGCCAGCCAATATT
TTTCGCAAGGTGACATCGTCCATCAAGACGCACTCCAAGCTGGGCCTAACAGCCACGCTGCTGCGAGAAGACGAC
AAAATTTCCGATCTCAACTTTCTCATCGGCCCCAAGCTGTTTGAGGCCAACTGGATGGAGCTTTCTCAACAAGGC
CATATTGCTAGGGTGCAGTGTGCCGAGGTGTGGTGTCCCATGCCCACAGAGTTTTACGACGAGTACCTTCGGGCT
CCATCACGCAAAAAGAACTTGCTCTACATCATGAACCCCCGCAAGTTCCAGGCCTGCCAGTACCTTGTTAATTAT
CACGAGTCACGCGGAGACAAAATCATTGTCTTTTCCGATAATGTCTACGCGCTCAAGGCATACGCGCTCAAGCTC
AACAAGGTCTTCATTTTTGGTGGGACAGGCCAAGCAGAGCGCTTGCAGGTCTTGGAAAACTTTCAACACAACCCA
CATGTCAACACACTGTTTCTCTCCAAGATTGGTGATACATCGCTAGACTTACCAGAGGCTACGTGCCTGATTCAA
ATCTCGTCGCACTATGGTTCTCGCCGTCAGGAAGCTCAACGTCTGGGCCGCATCCTTCGGGCCAAACGGCGCAAC
GATGAGGGCTTCAACGCATTCTTCTATTCTCTCGTGTCCAAGGACACGCAAGAAATGTACTTTTCATCAAAGCGG
CAGGCATTTCTCGTCGACCAGGGATACGCATTCAAGGTGATTACACAGCTGGCCAACATTGAACAAACACCCCAA
CTGGCCTTTGCAACAGCAAGTGAACGGCGCGAACTCCTGCAAAAGGTCTTGGTGGAAAATGAGACGATGGAGGAT
GAGGACATTACAGACGACTTGTTTCACAGTGGTAGCATGGGACGAAAGAGGAAGAGGGGCGCAGCACGGCGGACG
GCTGGCACCCTGGGCGAGTTAAGTGGCGGGCAAGACATGGCGTATATTGAGCAGAACAAGAGGGTCAACCAGGCG
CTCAAGAAGGGCAAGTCGAAGAAGGAGAGCAGTTCCTTTTTCAAGAAGATAGGGCGTGAAAACGCAAGGCGGGCA
GCGCAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail