Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7517
Gene name
LocationContig_80:4890..7120
Strand+
Gene length (bp)2230
Transcript length (bp)2067
Coding sequence length (bp)2067
Protein length (aa) 689

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02204 VPS9 Vacuolar sorting protein 9 (VPS9) domain 1.6E-25 259 360

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94388|VPS92_SCHPO Vacuolar protein sorting-associated protein 9b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps902 PE=1 SV=1 80 356 3.0E-17
sp|Q9LT31|VPS9A_ARATH Vacuolar protein sorting-associated protein 9A OS=Arabidopsis thaliana GN=VPS9A PE=1 SV=1 198 368 8.0E-12
sp|Q9JM13|RABX5_MOUSE Rab5 GDP/GTP exchange factor OS=Mus musculus GN=Rabgef1 PE=1 SV=1 170 391 1.0E-09
sp|O18973|RABX5_BOVIN Rab5 GDP/GTP exchange factor OS=Bos taurus GN=RABGEF1 PE=1 SV=1 170 381 2.0E-09
sp|O74396|VPS91_SCHPO Vacuolar protein sorting-associated protein 9a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps901 PE=1 SV=3 220 364 6.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7517
MLVLLSLQRLMASPAFVTSRSPSFPQPPRRDSDVVAAPKRAHSFANGSQRSDVPDAFETRDTLDIDHGADGPRAS
VDLDDLPIELISLTDSFLDSLDAKVHPTPPNIERLSQLFQEFYSLAASHIATHTNALATRQSREASAPPASSISS
AASRLRSLGSKERWSRHEAEQQMITADELASRKRARKALESKRVLLEEAVERRLCQGIYDRIYRHRSTQDEAHDD
KLRSKTAALALVGIGPGDLGVDLGQDTTVRQWLHQARANLTEMSQSRYPLGKLNHLKAAHKSIVETLAHLHPSAS
ADEVMPMLIYTLITMPPERLHIISDLHFVQSFRWEPKLTGEAAYCLTNLEAAISFLQNVDLATLRDDEHPSGPPK
PRPSHTPTPRAETFPPAYNQPTSDSDHAPKTASTPSTPGLKAPEPEAPKRRRLSDLVNTPAQAIGAASDAVISTA
DQGLKTISSSLGDSYSFLLGKLRERQPGPKEAMVVPRTLDDARKLVTTPPPTDDDDTTSVDDAHVAAPAKRPSAR
GRDSVLGMIAGRRDASVESCRSASSSSKKVLFADNGNKPPAPSTTSPAPAVLDQVRNLGSSLNPMARLSNIGGFR
PFARTPSLSSPAKHIGPTADGGDLASAFPDIAAALPPKPTPRLAPPLRRFMEMQSPGDLRLSDVIDLLRDYRRLA
GALKDMDAFDDST*
Coding >OphauB2|7517
ATGCTAGTCCTCTTGTCGCTGCAGCGTCTCATGGCTTCTCCGGCCTTTGTCACGTCGCGCTCGCCCTCGTTTCCG
CAGCCCCCGAGGCGAGACAGCGACGTCGTGGCAGCGCCCAAGCGGGCACACAGCTTTGCCAACGGCTCGCAGCGC
AGCGACGTTCCGGATGCCTTTGAGACGAGGGACACGCTGGACATTGACCATGGGGCCGACGGGCCGCGGGCTTCG
GTCGATCTCGACGACCTCCCCATTGAGCTCATTAGCCTGACTGACAGCTTCCTCGACTCGCTCGACGCAAAAGTC
CATCCCACGCCGCCAAACATTGAGCGCCTGTCCCAGCTCTTCCAAGAGTTCTACAGCCTGGCCGCTTCCCATATA
GCCACCCACACAAACGCCTTGGCCACGCGCCAGAGTCGCGAGGCTTCAGCGCCGCCCGCCTCGTCCATCTCGTCG
GCTGCCAGCCGTCTGCGCTCTCTTGGCTCCAAGGAGCGATGGTCGAGACACGAGGCCGAGCAGCAGATGATTACG
GCCGACGAGCTGGCCAGCCGAAAACGCGCCCGAAAGGCGCTCGAGTCGAAGCGAGTGCTGCTGGAAGAGGCGGTG
GAACGCAGGCTCTGCCAGGGCATCTATGACCGCATCTACCGCCACCGCAGCACCCAGGACGAGGCGCACGACGAC
AAGCTCCGCTCCAAAACTGCAGCTCTCGCCCTCGTCGGCATCGGCCCGGGCGACTTGGGCGTCGACCTCGGCCAA
GACACAACGGTGCGCCAATGGCTGCACCAGGCCCGCGCCAACCTGACGGAAATGAGCCAGTCGAGATATCCCCTC
GGCAAGCTCAACCACCTCAAGGCCGCGCACAAGAGCATCGTGGAGACGCTGGCCCACTTGCACCCCTCGGCCTCG
GCTGACGAGGTGATGCCCATGCTCATCTACACTCTCATCACCATGCCGCCCGAGCGCCTCCACATCATCAGCGAT
CTTCACTTTGTCCAGAGCTTCCGATGGGAGCCCAAGCTCACGGGCGAGGCCGCCTACTGCCTGACCAACCTCGAG
GCCGCCATTAGCTTCCTGCAAAACGTGGATCTGGCCACCTTGCGCGACGACGAGCATCCCTCGGGCCCGCCCAAA
CCACGGCCCTCGCACACACCAACGCCCCGCGCCGAAACCTTCCCCCCCGCCTACAATCAGCCCACAAGCGACAGC
GACCACGCGCCCAAGACGGCCTCGACGCCCTCGACGCCCGGCCTCAAAGCCCCCGAGCCAGAGGCGCCCAAGCGC
CGCCGCCTTAGCGACTTGGTCAACACGCCCGCCCAGGCCATTGGGGCTGCCAGCGACGCCGTCATCAGCACCGCC
GACCAGGGCCTCAAGACCATCTCCAGCAGCCTCGGCGACAGCTACTCCTTCCTCCTCGGCAAGCTGCGCGAGCGC
CAGCCCGGCCCCAAGGAAGCCATGGTGGTGCCGCGCACTCTGGACGATGCCCGCAAGCTCGTCACCACGCCGCCG
CCCACGGATGACGACGACACCACGAGCGTCGACGACGCCCATGTTGCTGCCCCCGCCAAGCGTCCCTCGGCCCGA
GGCAGAGACAGCGTCCTCGGCATGATTGCCGGCCGTCGAGACGCCAGCGTCGAAAGTTGCCGCAGCGCCAGCTCC
TCCTCCAAAAAGGTGCTCTTTGCCGACAATGGTAATAAGCCGCCCGCCCCGTCCACCACCAGCCCCGCTCCCGCT
GTCCTCGACCAGGTGCGCAATCTCGGCAGCTCCTTGAACCCCATGGCCCGTCTCTCCAACATTGGCGGCTTCAGG
CCCTTTGCCCGCACTCCCTCGCTCTCCTCCCCTGCAAAGCACATTGGGCCAACCGCAGACGGCGGCGACTTGGCA
TCGGCCTTTCCTGACATTGCTGCCGCCCTGCCCCCCAAACCCACTCCTCGCCTCGCTCCGCCTCTTCGTCGCTTC
ATGGAAATGCAGAGCCCTGGCGACCTGCGTCTAAGCGACGTCATTGACCTCCTTCGAGACTATCGCCGCCTTGCT
GGCGCTCTCAAAGACATGGACGCCTTTGACGATTCAACTTGA
Transcript >OphauB2|7517
ATGCTAGTCCTCTTGTCGCTGCAGCGTCTCATGGCTTCTCCGGCCTTTGTCACGTCGCGCTCGCCCTCGTTTCCG
CAGCCCCCGAGGCGAGACAGCGACGTCGTGGCAGCGCCCAAGCGGGCACACAGCTTTGCCAACGGCTCGCAGCGC
AGCGACGTTCCGGATGCCTTTGAGACGAGGGACACGCTGGACATTGACCATGGGGCCGACGGGCCGCGGGCTTCG
GTCGATCTCGACGACCTCCCCATTGAGCTCATTAGCCTGACTGACAGCTTCCTCGACTCGCTCGACGCAAAAGTC
CATCCCACGCCGCCAAACATTGAGCGCCTGTCCCAGCTCTTCCAAGAGTTCTACAGCCTGGCCGCTTCCCATATA
GCCACCCACACAAACGCCTTGGCCACGCGCCAGAGTCGCGAGGCTTCAGCGCCGCCCGCCTCGTCCATCTCGTCG
GCTGCCAGCCGTCTGCGCTCTCTTGGCTCCAAGGAGCGATGGTCGAGACACGAGGCCGAGCAGCAGATGATTACG
GCCGACGAGCTGGCCAGCCGAAAACGCGCCCGAAAGGCGCTCGAGTCGAAGCGAGTGCTGCTGGAAGAGGCGGTG
GAACGCAGGCTCTGCCAGGGCATCTATGACCGCATCTACCGCCACCGCAGCACCCAGGACGAGGCGCACGACGAC
AAGCTCCGCTCCAAAACTGCAGCTCTCGCCCTCGTCGGCATCGGCCCGGGCGACTTGGGCGTCGACCTCGGCCAA
GACACAACGGTGCGCCAATGGCTGCACCAGGCCCGCGCCAACCTGACGGAAATGAGCCAGTCGAGATATCCCCTC
GGCAAGCTCAACCACCTCAAGGCCGCGCACAAGAGCATCGTGGAGACGCTGGCCCACTTGCACCCCTCGGCCTCG
GCTGACGAGGTGATGCCCATGCTCATCTACACTCTCATCACCATGCCGCCCGAGCGCCTCCACATCATCAGCGAT
CTTCACTTTGTCCAGAGCTTCCGATGGGAGCCCAAGCTCACGGGCGAGGCCGCCTACTGCCTGACCAACCTCGAG
GCCGCCATTAGCTTCCTGCAAAACGTGGATCTGGCCACCTTGCGCGACGACGAGCATCCCTCGGGCCCGCCCAAA
CCACGGCCCTCGCACACACCAACGCCCCGCGCCGAAACCTTCCCCCCCGCCTACAATCAGCCCACAAGCGACAGC
GACCACGCGCCCAAGACGGCCTCGACGCCCTCGACGCCCGGCCTCAAAGCCCCCGAGCCAGAGGCGCCCAAGCGC
CGCCGCCTTAGCGACTTGGTCAACACGCCCGCCCAGGCCATTGGGGCTGCCAGCGACGCCGTCATCAGCACCGCC
GACCAGGGCCTCAAGACCATCTCCAGCAGCCTCGGCGACAGCTACTCCTTCCTCCTCGGCAAGCTGCGCGAGCGC
CAGCCCGGCCCCAAGGAAGCCATGGTGGTGCCGCGCACTCTGGACGATGCCCGCAAGCTCGTCACCACGCCGCCG
CCCACGGATGACGACGACACCACGAGCGTCGACGACGCCCATGTTGCTGCCCCCGCCAAGCGTCCCTCGGCCCGA
GGCAGAGACAGCGTCCTCGGCATGATTGCCGGCCGTCGAGACGCCAGCGTCGAAAGTTGCCGCAGCGCCAGCTCC
TCCTCCAAAAAGGTGCTCTTTGCCGACAATGGTAATAAGCCGCCCGCCCCGTCCACCACCAGCCCCGCTCCCGCT
GTCCTCGACCAGGTGCGCAATCTCGGCAGCTCCTTGAACCCCATGGCCCGTCTCTCCAACATTGGCGGCTTCAGG
CCCTTTGCCCGCACTCCCTCGCTCTCCTCCCCTGCAAAGCACATTGGGCCAACCGCAGACGGCGGCGACTTGGCA
TCGGCCTTTCCTGACATTGCTGCCGCCCTGCCCCCCAAACCCACTCCTCGCCTCGCTCCGCCTCTTCGTCGCTTC
ATGGAAATGCAGAGCCCTGGCGACCTGCGTCTAAGCGACGTCATTGACCTCCTTCGAGACTATCGCCGCCTTGCT
GGCGCTCTCAAAGACATGGACGCCTTTGACGATTCAACTTGA
Gene >OphauB2|7517
ATGCTAGTCCTCTTGTCGCTGCAGCGTCTCATGGCTTCTCCGGCCTTTGTCACGTCGCGCTCGCCCTCGTTTCCG
CAGCCCCCGAGGCGAGACAGCGACGTCGTGGCAGCGCCCAAGCGGGCACACAGCTTTGCCAACGGCTCGCAGCGC
AGCGACGTTCCGGATGCCTTTGAGACGAGGGACACGCTGGACATTGACCATGGGGCCGACGGGCCGCGGGCTTCG
GTCGATCTCGACGACCTCCCCATTGAGCTCATTAGCCTGACTGACAGGTAGGGAGGGGCCACTGGCGCTGGGCTT
GACCTTGGCCTTGACCTCGTCTTGACCTCGTCTTGACCTCGTCTTGGGGCTGACACGCCGTGACGCCACAGCTTC
CTCGACTCGCTCGACGCAAAAGTCCATCCCACGCCGCCAAACATTGAGCGCCTGTCCCAGCTCTTCCAAGAGTTC
TACAGCCTGGCCGCTTCCCATATAGCCACCCACACAAACGCCTTGGCCACGCGCCAGAGTCGCGAGGCTTCAGCG
CCGCCCGCCTCGTCCATCTCGTCGGCTGCCAGCCGTCTGCGCTCTCTTGGCTCCAAGGAGCGATGGTCGAGACAC
GAGGCCGAGCAGCAGATGATTACGGCCGACGAGCTGGCCAGCCGAAAACGCGCCCGAAAGGCGCTCGAGTCGAAG
CGAGTGCTGCTGGAAGAGGCGGTGGAACGCAGGCTCTGCCAGGGCATCTATGACCGCATCTACCGCCACCGCAGC
ACCCAGGACGAGGCGCACGACGACAAGCTCCGCTCCAAAACTGCAGCTCTCGCCCTCGTCGGCATCGGCCCGGGC
GACTTGGGCGTCGACCTCGGCCAAGACACAACGGTGCGCCAATGGCTGCACCAGGCCCGCGCCAACCTGACGGAA
ATGAGCCAGTCGAGATATCCCCTCGGCAAGCTCAACCACCTCAAGGCCGCGCACAAGAGCATCGTGGAGACGCTG
GCCCACTTGCACCCCTCGGCCTCGGCTGACGAGGTGATGCCCATGCTCATCTACACTCTCATCACCATGCCGCCC
GAGCGCCTCCACATCATCAGCGATCTTCACTTTGTCCAGAGCTTCCGATGGGAGCCCAAGCTCACGGGCGAGGCC
GCCTACTGCCTGACCAACCTCGAGGCCGCCATTAGCTTCCTGCAAAACGTGGATCTGGCCACCTTGCGCGACGAC
GAGCATCCCTCGGGCCCGCCCAAACCACGGCCCTCGCACACACCAACGCCCCGCGCCGAAACCTTCCCCCCCGCC
TACAATCAGCCCACAAGCGACAGCGACCACGCGCCCAAGACGGCCTCGACGCCCTCGACGCCCGGCCTCAAAGCC
CCCGAGCCAGAGGCGCCCAAGCGCCGCCGCCTTAGCGACTTGGTCAACACGCCCGCCCAGGCCATTGGGGCTGCC
AGCGACGCCGTCATCAGCACCGCCGACCAGGGCCTCAAGACCATCTCCAGCAGCCTCGGCGACAGCTACTCCTTC
CTCCTCGGCAAGCTGCGCGAGCGCCAGCCCGGCCCCAAGGAAGCCATGGTGGTGCCGCGCACTCTGGACGATGCC
CGCAAGCTCGTCACCACGCCGCCGCCCACGGATGACGACGACACCACGAGCGTCGACGACGCCCATGTTGCTGCC
CCCGCCAAGCGTCCCTCGGCCCGAGGCAGAGACAGCGTCCTCGGCATGATTGCCGGCCGTCGAGACGCCAGCGTC
GAAAGTTGCCGCAGCGCCAGCTCCTCCTCCAAAAAGGTGCTCTTTGCCGACAATGGTAATAAGCCGCCCGCCCCG
TCCACCACCAGCCCCGCTCCCGCTGTCCTCGACCAGGTGCGCAATCTCGGCAGCTCCTTGAACCCCATGGCCCGT
CTCTCCAACATTGGCGGCTTCAGGCCCTTTGCCCGCACTCCCTCGCTCTCCTCCCCTGCAAAGCACATTGGGCCA
ACCGCAGACGGCGGCGACTTGGCATCGGTACTTGCTGCCCAAATTCTCTCCCATGGCCCGCCGCTTGCTTTTCTA
ACCATGCTCTCCACAGGCCTTTCCTGACATTGCTGCCGCCCTGCCCCCCAAACCCACTCCTCGCCTCGCTCCGCC
TCTTCGTCGCTTCATGGAAATGCAGAGCCCTGGCGACCTGCGTCTAAGCGACGTCATTGACCTCCTTCGAGACTA
TCGCCGCCTTGCTGGCGCTCTCAAAGACATGGACGCCTTTGACGATTCAACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail