Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7501
Gene name
LocationContig_8:283072..284370
Strand+
Gene length (bp)1298
Transcript length (bp)915
Coding sequence length (bp)915
Protein length (aa) 305

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00153 Mito_carr Mitochondrial carrier protein 7.8E-08 126 204
PF00153 Mito_carr Mitochondrial carrier protein 2.0E-14 212 296

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38988|GGC1_YEAST Mitochondrial GTP/GDP carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GGC1 PE=1 SV=1 10 304 1.0E-153
sp|O74439|YJE9_SCHPO Uncharacterized mitochondrial carrier C1682.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1682.09c PE=3 SV=1 10 303 1.0E-152
sp|Q99297|ODC2_YEAST Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC2 PE=1 SV=1 25 282 1.0E-11
sp|Q9BQT8|ODC_HUMAN Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens GN=SLC25A21 PE=1 SV=1 18 282 1.0E-11
sp|Q55E45|MCFE_DICDI Mitochondrial substrate carrier family protein E OS=Dictyostelium discoideum GN=mcfE PE=3 SV=1 8 282 4.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38988|GGC1_YEAST Mitochondrial GTP/GDP carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GGC1 PE=1 SV=1 10 304 1.0E-153
sp|O74439|YJE9_SCHPO Uncharacterized mitochondrial carrier C1682.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1682.09c PE=3 SV=1 10 303 1.0E-152
sp|Q99297|ODC2_YEAST Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC2 PE=1 SV=1 25 282 1.0E-11
sp|Q9BQT8|ODC_HUMAN Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens GN=SLC25A21 PE=1 SV=1 18 282 1.0E-11
sp|Q55E45|MCFE_DICDI Mitochondrial substrate carrier family protein E OS=Dictyostelium discoideum GN=mcfE PE=3 SV=1 8 282 4.0E-11
sp|Q86AV5|MCFX_DICDI Mitochondrial substrate carrier family protein X OS=Dictyostelium discoideum GN=mcfX PE=3 SV=1 10 282 4.0E-11
sp|Q8BZ09|ODC_MOUSE Mitochondrial 2-oxodicarboxylate carrier OS=Mus musculus GN=Slc25a21 PE=1 SV=1 1 282 5.0E-11
sp|Q54MZ4|MCFB_DICDI Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 143 296 7.0E-11
sp|Q6DFK2|S2540_XENLA Solute carrier family 25 member 40 OS=Xenopus laevis GN=slc25a40 PE=2 SV=1 130 282 7.0E-11
sp|Q4V9P0|SAMC_DANRE S-adenosylmethionine mitochondrial carrier protein OS=Danio rerio GN=slc25a26 PE=2 SV=1 11 278 8.0E-11
sp|Q498U3|S2540_RAT Solute carrier family 25 member 40 OS=Rattus norvegicus GN=Slc25a40 PE=2 SV=2 130 282 1.0E-10
sp|Q55GE2|ODC_DICDI Probable mitochondrial 2-oxodicarboxylate carrier OS=Dictyostelium discoideum GN=mcfT PE=3 SV=1 19 282 1.0E-10
sp|Q70HW3|SAMC_HUMAN S-adenosylmethionine mitochondrial carrier protein OS=Homo sapiens GN=SLC25A26 PE=2 SV=1 11 277 2.0E-10
sp|Q54PY7|M2OM_DICDI Probable mitochondrial 2-oxoglutarate/malate carrier protein OS=Dictyostelium discoideum GN=ucpC PE=3 SV=1 13 294 2.0E-10
sp|Q0VCH6|S2540_BOVIN Solute carrier family 25 member 40 OS=Bos taurus GN=SLC25A40 PE=2 SV=1 130 282 2.0E-10
sp|B0G143|UCPB_DICDI Mitochondrial substrate carrier family protein ucpB OS=Dictyostelium discoideum GN=ucpB PE=3 SV=1 11 294 2.0E-10
sp|Q5U680|SAMC_MOUSE S-adenosylmethionine mitochondrial carrier protein OS=Mus musculus GN=Slc25a26 PE=1 SV=2 17 277 3.0E-10
sp|Q8BW66|S2548_MOUSE Solute carrier family 25 member 48 OS=Mus musculus GN=Slc25a48 PE=1 SV=2 26 273 3.0E-10
sp|Q505J6|GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus GN=Slc25a18 PE=2 SV=2 8 282 5.0E-10
sp|Q5RFB7|ODC_PONAB Mitochondrial 2-oxodicarboxylate carrier OS=Pongo abelii GN=SLC25A21 PE=2 SV=1 18 282 6.0E-10
sp|Q5PQ27|S2542_XENLA Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 118 294 6.0E-10
sp|Q8TBP6|S2540_HUMAN Solute carrier family 25 member 40 OS=Homo sapiens GN=SLC25A40 PE=1 SV=1 129 282 8.0E-10
sp|Q99JD3|ODC_RAT Mitochondrial 2-oxodicarboxylate carrier OS=Rattus norvegicus GN=Slc25a21 PE=2 SV=1 1 282 1.0E-09
sp|Q6ZT89|S2548_HUMAN Solute carrier family 25 member 48 OS=Homo sapiens GN=SLC25A48 PE=1 SV=2 26 273 2.0E-09
sp|P38921|PET8_YEAST Putative mitochondrial carrier protein PET8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET8 PE=1 SV=1 19 278 2.0E-09
sp|A0JN87|ODC_BOVIN Mitochondrial 2-oxodicarboxylate carrier OS=Bos taurus GN=SLC25A21 PE=2 SV=1 18 282 3.0E-09
sp|Q54FE6|MCFS_DICDI Mitochondrial substrate carrier family protein S OS=Dictyostelium discoideum GN=mcfS PE=3 SV=1 13 295 3.0E-09
sp|Q05AQ3|S2542_XENTR Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus tropicalis GN=slc25a42 PE=2 SV=1 118 294 3.0E-09
sp|Q8BGP6|S2540_MOUSE Solute carrier family 25 member 40 OS=Mus musculus GN=Slc25a40 PE=1 SV=1 130 282 6.0E-09
sp|Q6P316|S2540_XENTR Solute carrier family 25 member 40 OS=Xenopus tropicalis GN=slc25a40 PE=2 SV=1 140 282 8.0E-09
sp|Q9H1K4|GHC2_HUMAN Mitochondrial glutamate carrier 2 OS=Homo sapiens GN=SLC25A18 PE=1 SV=1 8 299 1.0E-08
sp|Q9CR62|M2OM_MOUSE Mitochondrial 2-oxoglutarate/malate carrier protein OS=Mus musculus GN=Slc25a11 PE=1 SV=3 123 298 1.0E-08
sp|Q9P3T7|ODC_SCHPO Probable mitochondrial 2-oxodicarboxylate carrier OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.09 PE=3 SV=1 25 282 1.0E-08
sp|Q12482|AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGC1 PE=3 SV=1 111 303 2.0E-08
sp|Q641C8|SAMC_XENLA S-adenosylmethionine mitochondrial carrier protein OS=Xenopus laevis GN=slc25a26 PE=2 SV=1 11 279 2.0E-08
sp|Q9Y619|ORNT1_HUMAN Mitochondrial ornithine transporter 1 OS=Homo sapiens GN=SLC25A15 PE=1 SV=1 139 282 2.0E-08
sp|F4HT41|SAMC2_ARATH Probable S-adenosylmethionine carrier 2, chloroplastic OS=Arabidopsis thaliana GN=SAMC2 PE=2 SV=1 19 281 3.0E-08
sp|Q02978|M2OM_HUMAN Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens GN=SLC25A11 PE=1 SV=3 123 298 3.0E-08
sp|A6QR09|SAMC_BOVIN S-adenosylmethionine mitochondrial carrier protein OS=Bos taurus GN=SLC25A26 PE=2 SV=1 17 277 3.0E-08
sp|A3KPP4|S2535_DANRE Solute carrier family 25 member 35 OS=Danio rerio GN=slc25a35 PE=2 SV=1 128 289 3.0E-08
sp|P70406|UCP2_MOUSE Mitochondrial uncoupling protein 2 OS=Mus musculus GN=Ucp2 PE=1 SV=1 18 288 4.0E-08
sp|Q75AH6|AGC1_ASHGO Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 130 297 4.0E-08
sp|Q3SZI5|UCP2_BOVIN Mitochondrial uncoupling protein 2 OS=Bos taurus GN=UCP2 PE=2 SV=1 18 281 4.0E-08
sp|Q6DE75|S2538_XENLA Solute carrier family 25 member 38 OS=Xenopus laevis GN=slc25a38 PE=2 SV=1 25 278 5.0E-08
sp|Q9DB41|GHC2_MOUSE Mitochondrial glutamate carrier 2 OS=Mus musculus GN=Slc25a18 PE=1 SV=4 17 282 5.0E-08
sp|Q10248|YD1K_SCHPO Uncharacterized mitochondrial carrier C4G9.20c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.20c PE=3 SV=2 1 294 5.0E-08
sp|O60029|PET8_ASHGO Putative mitochondrial carrier protein PET8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PET8 PE=3 SV=1 16 278 6.0E-08
sp|Q6DHC3|S2540_DANRE Solute carrier family 25 member 40 OS=Danio rerio GN=slc25a40 PE=2 SV=1 130 282 6.0E-08
sp|Q9UBX3|DIC_HUMAN Mitochondrial dicarboxylate carrier OS=Homo sapiens GN=SLC25A10 PE=1 SV=2 13 300 7.0E-08
sp|Q5R5A8|UCP2_PONAB Mitochondrial uncoupling protein 2 OS=Pongo abelii GN=UCP2 PE=2 SV=1 18 281 7.0E-08
sp|A3LVX1|TPC1_PICST Mitochondrial thiamine pyrophosphate carrier 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TPC1 PE=3 SV=2 130 289 1.0E-07
sp|Q6GLA2|SAMC_XENTR S-adenosylmethionine mitochondrial carrier protein OS=Xenopus tropicalis GN=slc25a26 PE=2 SV=1 11 277 1.0E-07
sp|B0DK57|S2538_LACBS Solute carrier family 25 member 38 homolog OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_191230 PE=3 SV=1 119 272 1.0E-07
sp|P55851|UCP2_HUMAN Mitochondrial uncoupling protein 2 OS=Homo sapiens GN=UCP2 PE=1 SV=1 18 281 1.0E-07
sp|Q1DRJ3|S2538_COCIM Solute carrier family 25 member 38 homolog OS=Coccidioides immitis (strain RS) GN=CIMG_07070 PE=3 SV=1 140 273 1.0E-07
sp|Q54RB9|CMC_DICDI Calcium-binding mitochondrial carrier protein OS=Dictyostelium discoideum GN=mcfO PE=3 SV=1 9 296 2.0E-07
sp|P56501|UCP3_MOUSE Mitochondrial uncoupling protein 3 OS=Mus musculus GN=Ucp3 PE=1 SV=1 143 288 2.0E-07
sp|Q9M038|SFC1_ARATH Mitochondrial succinate-fumarate transporter 1 OS=Arabidopsis thaliana GN=SFC1 PE=2 SV=1 22 282 2.0E-07
sp|O97562|UCP2_PIG Mitochondrial uncoupling protein 2 OS=Sus scrofa GN=UCP2 PE=2 SV=1 18 281 2.0E-07
sp|P79110|TXTP_BOVIN Tricarboxylate transport protein, mitochondrial OS=Bos taurus GN=SLC25A1 PE=2 SV=1 103 277 2.0E-07
sp|A2ADF7|S2534_MOUSE Solute carrier family 25 member 34 OS=Mus musculus GN=Slc25a34 PE=1 SV=1 172 289 2.0E-07
sp|Q9CA93|BAC2_ARATH Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana GN=BAC2 PE=1 SV=1 136 303 2.0E-07
sp|P56500|UCP2_RAT Mitochondrial uncoupling protein 2 OS=Rattus norvegicus GN=Ucp2 PE=2 SV=1 18 299 2.0E-07
sp|Q9FY68|PUMP6_ARATH Mitochondrial uncoupling protein 6 OS=Arabidopsis thaliana GN=PUMP6 PE=2 SV=1 101 294 3.0E-07
sp|Q9N2J1|UCP2_CANLF Mitochondrial uncoupling protein 2 OS=Canis lupus familiaris GN=UCP2 PE=2 SV=1 18 281 3.0E-07
sp|Q6PIV7|S2534_HUMAN Solute carrier family 25 member 34 OS=Homo sapiens GN=SLC25A34 PE=2 SV=1 172 289 3.0E-07
sp|Q5XIF9|S2534_RAT Solute carrier family 25 member 34 OS=Rattus norvegicus GN=Slc25a34 PE=2 SV=2 172 289 4.0E-07
sp|Q70HW3|SAMC_HUMAN S-adenosylmethionine mitochondrial carrier protein OS=Homo sapiens GN=SLC25A26 PE=2 SV=1 129 294 5.0E-07
sp|Q0P483|S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio GN=slc25a42 PE=2 SV=1 118 294 5.0E-07
sp|Q9WVD5|ORNT1_MOUSE Mitochondrial ornithine transporter 1 OS=Mus musculus GN=Slc25a15 PE=1 SV=1 139 282 6.0E-07
sp|A4QNX2|S247B_DANRE Solute carrier family 25 member 47-B OS=Danio rerio GN=slc25a47b PE=2 SV=1 130 295 6.0E-07
sp|B2VSU4|S2538_PYRTR Solute carrier family 25 member 38 homolog OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_00728 PE=3 SV=1 140 295 6.0E-07
sp|Q3SZK0|S2534_BOVIN Solute carrier family 25 member 34 OS=Bos taurus GN=SLC25A34 PE=2 SV=1 147 289 7.0E-07
sp|Q94AG6|SAMC1_ARATH S-adenosylmethionine carrier 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SAMC1 PE=1 SV=1 20 281 7.0E-07
sp|Q8VEM8|MPCP_MOUSE Phosphate carrier protein, mitochondrial OS=Mus musculus GN=Slc25a3 PE=1 SV=1 105 288 8.0E-07
sp|A4RPU0|S2538_MAGO7 Solute carrier family 25 member 38 homolog OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_05623 PE=3 SV=1 25 273 8.0E-07
sp|Q1ECW7|S247A_DANRE Solute carrier family 25 member 47-A OS=Danio rerio GN=slc25a47a PE=2 SV=1 130 295 9.0E-07
sp|Q5EAC0|S2538_BOVIN Solute carrier family 25 member 38 OS=Bos taurus GN=SLC25A38 PE=2 SV=2 130 282 1.0E-06
sp|Q03028|ODC1_YEAST Mitochondrial 2-oxodicarboxylate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC1 PE=1 SV=1 25 282 1.0E-06
sp|P23641|MPCP_YEAST Mitochondrial phosphate carrier protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIR1 PE=1 SV=1 16 294 2.0E-06
sp|P53007|TXTP_HUMAN Tricarboxylate transport protein, mitochondrial OS=Homo sapiens GN=SLC25A1 PE=1 SV=2 120 277 3.0E-06
sp|P38152|TXTP_YEAST Tricarboxylate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTP1 PE=2 SV=3 126 289 3.0E-06
sp|P56499|UCP3_RAT Mitochondrial uncoupling protein 3 OS=Rattus norvegicus GN=Ucp3 PE=2 SV=1 143 288 3.0E-06
sp|Q5B717|S2538_EMENI Solute carrier family 25 member 38 homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN3663 PE=3 SV=2 140 273 4.0E-06
sp|Q6FTE5|TPC1_CANGA Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TPC1 PE=3 SV=1 130 294 4.0E-06
sp|Q9BZJ4|S2539_HUMAN Solute carrier family 25 member 39 OS=Homo sapiens GN=SLC25A39 PE=2 SV=2 130 284 5.0E-06
sp|A1CWA4|S2538_NEOFI Solute carrier family 25 member 38 homolog OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_103940 PE=3 SV=1 140 273 5.0E-06
sp|Q09461|YQ51_CAEEL Uncharacterized mitochondrial carrier C16C10.1 OS=Caenorhabditis elegans GN=C16C10.1 PE=3 SV=2 136 289 7.0E-06
sp|Q9VA73|CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster GN=aralar1 PE=2 SV=1 6 284 7.0E-06
sp|O75746|CMC1_HUMAN Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens GN=SLC25A12 PE=1 SV=2 10 284 7.0E-06
sp|Q5RBC8|CMC1_PONAB Calcium-binding mitochondrial carrier protein Aralar1 OS=Pongo abelii GN=SLC25A12 PE=2 SV=1 10 284 8.0E-06
sp|Q5R7W2|MPCP_PONAB Phosphate carrier protein, mitochondrial OS=Pongo abelii GN=SLC25A3 PE=2 SV=1 96 288 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7501
MSPPGAALQQEKESNLARLLGSGSAGIAELAIFHPVDTIAKRLMSNQTRITNASQLNQVIFKQYAGAPVGSKFFS
LFPGLGYAAGYKVLQRIYKYSGQPIVRDFLAKHYSNDFEAAFGKKTGKAMLHSTAGSLVGIGEVILLPLDVLKIK
RQTNPDAFRGRGIFKIITDEGLGLYRGWGWTAARNAPGSFALFGGSAFAKEFLFHLQDYNQATWMQNFVASIAGA
SASLVVSAPLDVVKTRIQNRNFENPETGFRIVANMARQEGLTSFFKGLVPKLLMTGPKLVFSFWLAQTLIPAFDV
ALRR*
Coding >OphauB2|7501
ATGTCGCCCCCGGGAGCTGCCTTGCAGCAGGAGAAGGAGTCAAATCTTGCCAGGCTTCTCGGCTCTGGCTCTGCT
GGGATCGCCGAGTTGGCCATCTTTCACCCTGTGGACACGATTGCGAAGCGGTTAATGAGCAACCAGACTAGAATC
ACCAACGCCAGTCAATTGAATCAAGTTATCTTCAAACAATATGCTGGTGCTCCAGTGGGCAGCAAGTTTTTCTCG
CTGTTCCCAGGTTTAGGCTACGCGGCGGGCTACAAAGTGTTGCAAAGAATATACAAGTATAGCGGGCAGCCCATT
GTGCGAGACTTTCTGGCCAAGCACTATAGCAATGATTTTGAGGCGGCCTTTGGCAAGAAAACCGGCAAGGCCATG
TTGCACTCGACGGCGGGCAGCCTGGTTGGCATCGGAGAGGTGATCCTATTACCGTTGGACGTGCTCAAGATTAAA
CGGCAGACAAATCCGGATGCTTTTAGGGGCCGGGGCATCTTTAAGATTATTACCGACGAAGGGCTCGGGCTTTAC
CGAGGCTGGGGCTGGACAGCCGCGAGAAACGCTCCCGGATCATTTGCGCTCTTTGGTGGCTCTGCATTTGCAAAG
GAGTTTTTGTTCCATCTGCAAGATTACAATCAAGCCACATGGATGCAGAATTTCGTGGCTTCAATCGCTGGTGCA
TCGGCATCGCTAGTGGTGTCGGCACCTCTAGACGTGGTTAAGACGCGCATCCAAAACCGCAACTTTGAGAATCCA
GAAACTGGATTCCGCATTGTGGCAAACATGGCTCGTCAAGAAGGGCTGACGAGTTTTTTCAAGGGATTGGTACCC
AAGCTGCTCATGACTGGACCCAAGCTGGTATTTTCATTTTGGCTTGCGCAAACGCTGATTCCTGCCTTTGATGTT
GCTTTGCGACGGTGA
Transcript >OphauB2|7501
ATGTCGCCCCCGGGAGCTGCCTTGCAGCAGGAGAAGGAGTCAAATCTTGCCAGGCTTCTCGGCTCTGGCTCTGCT
GGGATCGCCGAGTTGGCCATCTTTCACCCTGTGGACACGATTGCGAAGCGGTTAATGAGCAACCAGACTAGAATC
ACCAACGCCAGTCAATTGAATCAAGTTATCTTCAAACAATATGCTGGTGCTCCAGTGGGCAGCAAGTTTTTCTCG
CTGTTCCCAGGTTTAGGCTACGCGGCGGGCTACAAAGTGTTGCAAAGAATATACAAGTATAGCGGGCAGCCCATT
GTGCGAGACTTTCTGGCCAAGCACTATAGCAATGATTTTGAGGCGGCCTTTGGCAAGAAAACCGGCAAGGCCATG
TTGCACTCGACGGCGGGCAGCCTGGTTGGCATCGGAGAGGTGATCCTATTACCGTTGGACGTGCTCAAGATTAAA
CGGCAGACAAATCCGGATGCTTTTAGGGGCCGGGGCATCTTTAAGATTATTACCGACGAAGGGCTCGGGCTTTAC
CGAGGCTGGGGCTGGACAGCCGCGAGAAACGCTCCCGGATCATTTGCGCTCTTTGGTGGCTCTGCATTTGCAAAG
GAGTTTTTGTTCCATCTGCAAGATTACAATCAAGCCACATGGATGCAGAATTTCGTGGCTTCAATCGCTGGTGCA
TCGGCATCGCTAGTGGTGTCGGCACCTCTAGACGTGGTTAAGACGCGCATCCAAAACCGCAACTTTGAGAATCCA
GAAACTGGATTCCGCATTGTGGCAAACATGGCTCGTCAAGAAGGGCTGACGAGTTTTTTCAAGGGATTGGTACCC
AAGCTGCTCATGACTGGACCCAAGCTGGTATTTTCATTTTGGCTTGCGCAAACGCTGATTCCTGCCTTTGATGTT
GCTTTGCGACGGTGA
Gene >OphauB2|7501
ATGTCGCCCCCGGGAGCTGCCTTGCAGCAGGAGAAGGAGTCAAATCTTGCCAGGCTTCTCGGCTCTGGTATGAGC
TGCCTTGACCGCTTGCTTTACCGCATGCTCCTCTATGGTTACAGTCTGCTGACGGTGATTGACAGGCTCTGCTGG
GATCGCCGAGTTGGCCATCTTTCACCCTGTTGGTCCACTGAATGCCAAATCTGCTCTAAACTATGCTGACTTTTT
ACTTTCAAGGTGGACACGATTGCGAAGCGGTTAATGAGCAACCAGACTAGAGTAGGCAGGCATGTCGGACAGGCA
CATGGCGAAGGGCTGCTAAAGGTGCTGTGTGCAGATCACCAACGCCAGTCAATTGAATCAAGTTATCTTCAAACA
ATATGCTGGTGCTCCAGTGGGCAGCAAGTTTTTCTCGCTGTTCCCAGGTTTAGGCTACGCGGCGGGCTACAAAGT
GTTGCAAAGAATATACAAGTATAGCGGGCAGCCCATTGTGCGAGACTTTCTGGCCAAGCACTATAGCAATGATTT
TGAGGCGGCCTTTGGCAAGAAAACCGGCAAGGCCATGTTGCACTCGACGGCGGGCAGGTAAGAAGCAGCGTTGAG
GGAGCCACGGGGATGGACGTTTTGGAATTTTGATCTGACTGCATGTTGATGTTAGCCTGGTTGGCATCGGAGAGG
TGATCCTATTACCGTTGGACGTGCTCAAGATTAAACGGCAGACAAATCCGGATGCTTTTAGGGGCCGGGGCATCT
TTAAGATTATTACCGACGAAGGGCTCGGGCTTTACCGAGGCTGGGGCTGGACAGCCGCGAGAAACGCTCCCGGAT
CATTTGCGGTAAGCTGGTGCAGGCTGATGGCGATTGCAGTTGGGCAGGCACAGGGCTCGCTGACATGAAGCAATT
GTAGCTCTTTGGTGGCTCTGCATTTGCAAAGGAGTTTTTGTTCCATCTGCAAGATTACAATCAAGCCACATGGAT
GCAGAATTTCGTGGCTTCAATCGCTGGTGCATCGGCATCGCTAGTGGTGTCGGCACCTCTAGACGTGGTTAAGAC
GCGCATCCAAAACCGCAACTTTGAGAATCCAGAAACTGGATTCCGCATTGTGGCAAACATGGCTCGTCAAGAAGG
GCTGACGAGTTTTTTCAAGGGATTGGTACCCAAGGTTTGTGTGTCAATGTGGAGCCAAGATTTGGTAGCTGCTGA
CCTTTGTCTAGCTGCTCATGACTGGACCCAAGCTGGTATTTTCATTTTGGCTTGCGCAAACGCTGATTCCTGCCT
TTGATGTTGCTTTGCGACGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail