Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7494
Gene name
LocationContig_8:262836..264625
Strand-
Gene length (bp)1789
Transcript length (bp)1350
Coding sequence length (bp)1350
Protein length (aa) 450

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00091 Tubulin Tubulin/FtsZ family, GTPase domain 6.0E-67 3 213
PF03953 Tubulin_C Tubulin C-terminal domain 7.2E-50 263 392

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5I2J3|TBA_GIBZE Tubulin alpha chain OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TUB1 PE=3 SV=2 1 449 0.0E+00
sp|Q92335|TBA_SORMK Tubulin alpha chain OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=TUBA PE=3 SV=2 1 449 0.0E+00
sp|P38669|TBA2_NEUCR Tubulin alpha-B chain OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tba-2 PE=2 SV=2 1 449 0.0E+00
sp|O94128|TBA_ZYMTR Tubulin alpha chain OS=Zymoseptoria tritici PE=3 SV=1 1 449 0.0E+00
sp|P24633|TBA1_EMENI Tubulin alpha-1 chain OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tubA PE=3 SV=2 1 440 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5I2J3|TBA_GIBZE Tubulin alpha chain OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TUB1 PE=3 SV=2 1 449 0.0E+00
sp|Q92335|TBA_SORMK Tubulin alpha chain OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=TUBA PE=3 SV=2 1 449 0.0E+00
sp|P38669|TBA2_NEUCR Tubulin alpha-B chain OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tba-2 PE=2 SV=2 1 449 0.0E+00
sp|O94128|TBA_ZYMTR Tubulin alpha chain OS=Zymoseptoria tritici PE=3 SV=1 1 449 0.0E+00
sp|P24633|TBA1_EMENI Tubulin alpha-1 chain OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tubA PE=3 SV=2 1 440 0.0E+00
sp|P53372|TBA1_PNECA Tubulin alpha chain OS=Pneumocystis carinii GN=TUB1 PE=3 SV=1 1 449 0.0E+00
sp|P04689|TBA2_SCHPO Tubulin alpha-2 chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tub1 PE=1 SV=2 1 449 0.0E+00
sp|P53371|TBA_AJECA Tubulin alpha chain (Fragment) OS=Ajellomyces capsulatus GN=TUB1 PE=3 SV=1 1 418 0.0E+00
sp|P34690|TBA2_CAEEL Tubulin alpha-2 chain OS=Caenorhabditis elegans GN=tba-2 PE=2 SV=1 1 439 0.0E+00
sp|P04688|TBA1_SCHPO Tubulin alpha-1 chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nda2 PE=3 SV=2 1 448 0.0E+00
sp|Q9BQE3|TBA1C_HUMAN Tubulin alpha-1C chain OS=Homo sapiens GN=TUBA1C PE=1 SV=1 1 449 0.0E+00
sp|P08537|TBA_XENLA Tubulin alpha chain OS=Xenopus laevis GN=tuba PE=2 SV=2 1 449 0.0E+00
sp|P91910|TBA3_CAEEL Tubulin alpha-3 chain OS=Caenorhabditis elegans GN=mec-12 PE=1 SV=1 1 443 0.0E+00
sp|P68373|TBA1C_MOUSE Tubulin alpha-1C chain OS=Mus musculus GN=Tuba1c PE=1 SV=1 1 449 0.0E+00
sp|P68365|TBA1C_CRIGR Tubulin alpha-1C chain OS=Cricetulus griseus GN=TUBA1C PE=2 SV=1 1 449 0.0E+00
sp|P18288|TBAT_ONCMY Tubulin alpha chain, testis-specific OS=Oncorhynchus mykiss PE=2 SV=1 1 440 0.0E+00
sp|P06603|TBA1_DROME Tubulin alpha-1 chain OS=Drosophila melanogaster GN=alphaTub84B PE=2 SV=1 1 439 0.0E+00
sp|Q6AYZ1|TBA1C_RAT Tubulin alpha-1C chain OS=Rattus norvegicus GN=Tuba1c PE=1 SV=1 1 449 0.0E+00
sp|Q68FR8|TBA3_RAT Tubulin alpha-3 chain OS=Rattus norvegicus GN=Tuba3a PE=2 SV=1 1 440 0.0E+00
sp|P05214|TBA3_MOUSE Tubulin alpha-3 chain OS=Mus musculus GN=Tuba3a PE=1 SV=1 1 440 0.0E+00
sp|Q13748|TBA3C_HUMAN Tubulin alpha-3C/D chain OS=Homo sapiens GN=TUBA3C PE=1 SV=3 1 440 0.0E+00
sp|P18258|TBA1_PARLI Tubulin alpha-1 chain OS=Paracentrotus lividus PE=2 SV=1 1 439 0.0E+00
sp|P68370|TBA1A_RAT Tubulin alpha-1A chain OS=Rattus norvegicus GN=Tuba1a PE=1 SV=1 1 440 0.0E+00
sp|A5A6J1|TBA1A_PANTR Tubulin alpha-1A chain OS=Pan troglodytes GN=TUBA1A PE=2 SV=1 1 440 0.0E+00
sp|P68369|TBA1A_MOUSE Tubulin alpha-1A chain OS=Mus musculus GN=Tuba1a PE=1 SV=1 1 440 0.0E+00
sp|Q71U36|TBA1A_HUMAN Tubulin alpha-1A chain OS=Homo sapiens GN=TUBA1A PE=1 SV=1 1 440 0.0E+00
sp|P68362|TBA1A_CRIGR Tubulin alpha-1A chain OS=Cricetulus griseus GN=TUBA1A PE=2 SV=1 1 440 0.0E+00
sp|Q8T6A5|TBA1_APLCA Tubulin alpha-1 chain OS=Aplysia californica PE=2 SV=1 1 440 0.0E+00
sp|P36220|TBA_TORMA Tubulin alpha chain OS=Torpedo marmorata PE=2 SV=1 1 440 0.0E+00
sp|Q8WQ47|TBA_LEPDS Tubulin alpha chain OS=Lepidoglyphus destructor PE=1 SV=2 1 448 0.0E+00
sp|Q3ZCJ7|TBA1C_BOVIN Tubulin alpha-1C chain OS=Bos taurus GN=TUBA1C PE=1 SV=1 1 449 0.0E+00
sp|Q6P9V9|TBA1B_RAT Tubulin alpha-1B chain OS=Rattus norvegicus GN=Tuba1b PE=1 SV=1 1 440 0.0E+00
sp|Q2XVP4|TBA1B_PIG Tubulin alpha-1B chain OS=Sus scrofa GN=TUBA1B PE=1 SV=1 1 440 0.0E+00
sp|P05213|TBA1B_MOUSE Tubulin alpha-1B chain OS=Mus musculus GN=Tuba1b PE=1 SV=2 1 440 0.0E+00
sp|P68360|TBA1B_MERUN Tubulin alpha-1B chain OS=Meriones unguiculatus GN=TUBA1B PE=2 SV=1 1 440 0.0E+00
sp|Q4R538|TBA1B_MACFA Tubulin alpha-1B chain OS=Macaca fascicularis GN=TUBA1B PE=2 SV=1 1 440 0.0E+00
sp|P68363|TBA1B_HUMAN Tubulin alpha-1B chain OS=Homo sapiens GN=TUBA1B PE=1 SV=1 1 440 0.0E+00
sp|P68361|TBA1B_CRIGR Tubulin alpha-1B chain OS=Cricetulus griseus GN=TUBA1B PE=2 SV=1 1 440 0.0E+00
sp|P81947|TBA1B_BOVIN Tubulin alpha-1B chain OS=Bos taurus PE=1 SV=2 1 440 0.0E+00
sp|Q2HJ86|TBA1D_BOVIN Tubulin alpha-1D chain OS=Bos taurus GN=TUBA1D PE=1 SV=1 1 440 0.0E+00
sp|P50719|TBA_HAECO Tubulin alpha chain OS=Haemonchus contortus PE=2 SV=1 1 443 0.0E+00
sp|Q94572|TBA3_HOMAM Tubulin alpha-3 chain OS=Homarus americanus PE=2 SV=1 1 439 0.0E+00
sp|Q32KN8|TBA3_BOVIN Tubulin alpha-3 chain OS=Bos taurus GN=TUBA3 PE=2 SV=1 1 440 0.0E+00
sp|P06605|TBA3_DROME Tubulin alpha-3 chain OS=Drosophila melanogaster GN=alphaTub84D PE=2 SV=1 1 439 0.0E+00
sp|Q28IX8|TBA_XENTR Tubulin alpha chain OS=Xenopus tropicalis GN=tuba PE=2 SV=1 1 439 0.0E+00
sp|P41383|TBA2_PATVU Tubulin alpha-2/alpha-4 chain OS=Patella vulgata GN=TUB2 PE=2 SV=1 1 440 0.0E+00
sp|Q5R1W4|TBA1B_PANTR Tubulin alpha-1B chain OS=Pan troglodytes GN=TUBA1B PE=2 SV=1 1 440 0.0E+00
sp|P52273|TBA_BOMMO Tubulin alpha chain OS=Bombyx mori PE=2 SV=1 1 439 0.0E+00
sp|P06604|TBA2_DROME Tubulin alpha-2 chain OS=Drosophila melanogaster GN=alphaTub85E PE=1 SV=1 1 449 0.0E+00
sp|Q91060|TBA_NOTVI Tubulin alpha chain OS=Notophthalmus viridescens PE=2 SV=1 1 439 0.0E+00
sp|Q25008|TBA1_HOMAM Tubulin alpha-1 chain OS=Homarus americanus PE=2 SV=1 1 447 0.0E+00
sp|Q5XIF6|TBA4A_RAT Tubulin alpha-4A chain OS=Rattus norvegicus GN=Tuba4a PE=1 SV=1 1 444 0.0E+00
sp|P68368|TBA4A_MOUSE Tubulin alpha-4A chain OS=Mus musculus GN=Tuba4a PE=1 SV=1 1 444 0.0E+00
sp|P68367|TBA4A_MACFA Tubulin alpha-4A chain OS=Macaca fascicularis GN=TUBA4A PE=2 SV=1 1 444 0.0E+00
sp|P68366|TBA4A_HUMAN Tubulin alpha-4A chain OS=Homo sapiens GN=TUBA4A PE=1 SV=1 1 444 0.0E+00
sp|P81948|TBA4A_BOVIN Tubulin alpha-4A chain OS=Bos taurus GN=TUBA4A PE=1 SV=2 1 444 0.0E+00
sp|P02550|TBA1A_PIG Tubulin alpha-1A chain OS=Sus scrofa GN=TUBA1A PE=1 SV=1 1 440 0.0E+00
sp|P30436|TBA_ONCKE Tubulin alpha chain OS=Oncorhynchus keta PE=2 SV=2 1 440 0.0E+00
sp|Q06331|TBA_ENTDO Tubulin alpha chain OS=Enteroctopus dofleini PE=2 SV=1 1 440 0.0E+00
sp|Q9JJZ2|TBA8_MOUSE Tubulin alpha-8 chain OS=Mus musculus GN=Tuba8 PE=1 SV=1 1 440 0.0E+00
sp|Q9NY65|TBA8_HUMAN Tubulin alpha-8 chain OS=Homo sapiens GN=TUBA8 PE=1 SV=1 1 440 0.0E+00
sp|Q6AY56|TBA8_RAT Tubulin alpha-8 chain OS=Rattus norvegicus GN=Tuba8 PE=2 SV=1 1 440 0.0E+00
sp|Q2HJB8|TBA8_BOVIN Tubulin alpha-8 chain OS=Bos taurus GN=TUBA8 PE=2 SV=1 1 440 0.0E+00
sp|Q6PEY2|TBA3E_HUMAN Tubulin alpha-3E chain OS=Homo sapiens GN=TUBA3E PE=1 SV=2 1 440 0.0E+00
sp|P09644|TBA5_CHICK Tubulin alpha-5 chain OS=Gallus gallus PE=3 SV=1 1 439 0.0E+00
sp|P49741|TBAA_SCHCO Tubulin alpha-1A chain OS=Schizophyllum commune GN=TUB-1A PE=3 SV=1 1 439 0.0E+00
sp|P49742|TBAB_SCHCO Tubulin alpha-1B chain OS=Schizophyllum commune GN=TUB-1B PE=3 SV=1 1 449 0.0E+00
sp|P87066|TBA_CANAX Tubulin alpha chain OS=Candida albicans GN=TUB1 PE=3 SV=1 1 446 0.0E+00
sp|Q752Y2|TBA_ASHGO Tubulin alpha chain OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TUB1 PE=3 SV=1 1 444 0.0E+00
sp|Q94570|TBA2_HOMAM Tubulin alpha-2 chain OS=Homarus americanus PE=2 SV=1 1 447 0.0E+00
sp|P08070|TBA2_CHICK Tubulin alpha-2 chain OS=Gallus gallus PE=2 SV=1 1 447 0.0E+00
sp|P04105|TBAN_PHYPO Tubulin alpha-1B chain OS=Physarum polycephalum GN=ALTBN PE=2 SV=2 1 448 0.0E+00
sp|P09733|TBA1_YEAST Tubulin alpha-1 chain OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUB1 PE=1 SV=2 1 444 0.0E+00
sp|P50258|TBAD_PHYPO Tubulin alpha-1A chain OS=Physarum polycephalum GN=ALTA PE=1 SV=1 1 446 0.0E+00
sp|P14642|TBA_PLAFK Tubulin alpha chain OS=Plasmodium falciparum (isolate K1 / Thailand) PE=3 SV=1 1 449 0.0E+00
sp|P09734|TBA3_YEAST Tubulin alpha-3 chain OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUB3 PE=1 SV=1 1 443 0.0E+00
sp|P22275|TBA3_MAIZE Tubulin alpha-3 chain OS=Zea mays GN=TUBA3 PE=2 SV=1 1 448 0.0E+00
sp|Q25563|TBA13_NAEGR Tubulin alpha-13 chain OS=Naegleria gruberi GN=TUBA13 PE=2 SV=1 1 439 0.0E+00
sp|P12543|TBA_PLAYO Tubulin alpha chain OS=Plasmodium yoelii yoelii GN=PY01155 PE=2 SV=2 1 449 0.0E+00
sp|P11480|TBAE_PHYPO Tubulin alpha-2B chain OS=Physarum polycephalum GN=ALTBE PE=2 SV=1 1 448 0.0E+00
sp|P11237|TBA1_NAEGR Tubulin alpha-1/2/3 chain OS=Naegleria gruberi GN=TBA1 PE=2 SV=1 1 439 0.0E+00
sp|Q9ZRJ4|TBA_CHLVU Tubulin alpha chain OS=Chlorella vulgaris GN=TUBA PE=3 SV=1 1 439 0.0E+00
sp|P41351|TBA_TETTH Tubulin alpha chain OS=Tetrahymena thermophila PE=1 SV=1 1 439 0.0E+00
sp|P33629|TBA_PRUDU Tubulin alpha chain OS=Prunus dulcis GN=TUBA PE=2 SV=1 1 448 0.0E+00
sp|Q6VAG0|TBA2_GOSHI Tubulin alpha-2 chain OS=Gossypium hirsutum PE=2 SV=1 1 449 0.0E+00
sp|P11481|TBA1_VOLCA Tubulin alpha-1/alpha-2 chain OS=Volvox carteri GN=TUBA1 PE=3 SV=1 1 435 0.0E+00
sp|Q40831|TBA1_PELFA Tubulin alpha-1 chain OS=Pelvetia fastigiata GN=TUBA1 PE=2 SV=1 1 439 0.0E+00
sp|Q6VAG1|TBA1_GOSHI Tubulin alpha-1 chain OS=Gossypium hirsutum PE=2 SV=1 1 439 0.0E+00
sp|Q9FT36|TBA_DAUCA Tubulin alpha chain OS=Daucus carota GN=TBA PE=2 SV=1 1 439 0.0E+00
sp|Q40832|TBA2_PELFA Tubulin alpha-2 chain OS=Pelvetia fastigiata GN=TUBA2 PE=2 SV=1 1 435 0.0E+00
sp|P09204|TBA1_CHLRE Tubulin alpha-1 chain OS=Chlamydomonas reinhardtii GN=TUBA1 PE=1 SV=1 1 435 0.0E+00
sp|P10872|TBA_TETPY Tubulin alpha chain OS=Tetrahymena pyriformis PE=3 SV=1 1 439 0.0E+00
sp|P10873|TBA_TOXGO Tubulin alpha chain OS=Toxoplasma gondii PE=3 SV=1 1 435 0.0E+00
sp|Q71G51|TBA_NEOCA Tubulin alpha chain OS=Neospora caninum GN=TUBA PE=2 SV=1 1 435 0.0E+00
sp|Q96460|TBA2_HORVU Tubulin alpha-2 chain OS=Hordeum vulgare GN=TUBA2 PE=2 SV=1 1 438 0.0E+00
sp|Q9ZRR5|TBA3_HORVU Tubulin alpha-3 chain OS=Hordeum vulgare GN=TUBA3 PE=2 SV=1 1 438 0.0E+00
sp|P46259|TBA1_PEA Tubulin alpha-1 chain OS=Pisum sativum GN=TUBA1 PE=3 SV=1 1 437 0.0E+00
sp|P04106|TBA_TRYBR Tubulin alpha chain OS=Trypanosoma brucei rhodesiense PE=3 SV=1 1 446 0.0E+00
sp|Q6VAF9|TBA4_GOSHI Tubulin alpha-4 chain OS=Gossypium hirsutum PE=2 SV=1 1 437 0.0E+00
sp|Q9ZRB7|TBA_WHEAT Tubulin alpha chain OS=Triticum aestivum GN=TUBA PE=2 SV=1 1 438 0.0E+00
sp|Q0WV25|TBA4_ARATH Tubulin alpha-4 chain OS=Arabidopsis thaliana GN=TUBA4 PE=2 SV=2 1 435 0.0E+00
sp|B9DGT7|TBA2_ARATH Tubulin alpha-2 chain OS=Arabidopsis thaliana GN=TUBA2 PE=2 SV=2 1 435 0.0E+00
sp|P33625|TBA_EUGGR Tubulin alpha chain OS=Euglena gracilis GN=TUBA PE=2 SV=1 1 439 0.0E+00
sp|P28287|TBA_OXYGR Tubulin alpha chain OS=Oxytricha granulifera PE=3 SV=1 1 435 0.0E+00
sp|P29511|TBA6_ARATH Tubulin alpha-6 chain OS=Arabidopsis thaliana GN=TUBA6 PE=1 SV=1 1 435 0.0E+00
sp|P14641|TBA2_MAIZE Tubulin alpha-2 chain OS=Zea mays GN=TUBA2 PE=3 SV=1 1 438 0.0E+00
sp|P14640|TBA1_MAIZE Tubulin alpha-1 chain OS=Zea mays GN=TUBA1 PE=3 SV=1 1 438 0.0E+00
sp|O22347|TBA1_ELEIN Tubulin alpha-1 chain OS=Eleusine indica GN=TUBA1 PE=2 SV=1 1 438 0.0E+00
sp|Q53M52|TBA2_ORYSJ Tubulin alpha-2 chain OS=Oryza sativa subsp. japonica GN=TUBA PE=2 SV=1 1 438 0.0E+00
sp|P09205|TBA2_CHLRE Tubulin alpha-2 chain OS=Chlamydomonas reinhardtii GN=TUBA2 PE=1 SV=1 1 435 0.0E+00
sp|O22349|TBA3_ELEIN Tubulin alpha-3 chain OS=Eleusine indica GN=TUBA3 PE=2 SV=1 1 448 0.0E+00
sp|Q27352|TBA_TRYCR Tubulin alpha chain OS=Trypanosoma cruzi PE=3 SV=1 1 446 0.0E+00
sp|Q08114|TBA_EUPOC Tubulin alpha chain OS=Euplotes octocarinatus PE=3 SV=1 1 435 0.0E+00
sp|P28752|TBA1_ORYSJ Tubulin alpha-1 chain OS=Oryza sativa subsp. japonica GN=TUBA1 PE=1 SV=1 1 448 0.0E+00
sp|P33623|TBA1_ANEPH Tubulin alpha-1 chain OS=Anemia phyllitidis GN=TUBA1 PE=2 SV=1 1 432 0.0E+00
sp|P02552|TBA1_CHICK Tubulin alpha-1 chain (Fragment) OS=Gallus gallus PE=1 SV=1 46 440 0.0E+00
sp|B9DHQ0|TBA5_ARATH Tubulin alpha-5 chain OS=Arabidopsis thaliana GN=TUBA5 PE=1 SV=2 1 435 0.0E+00
sp|Q56WH1|TBA3_ARATH Tubulin alpha-3 chain OS=Arabidopsis thaliana GN=TUBA3 PE=1 SV=2 1 435 0.0E+00
sp|Q9C413|TBA_COLOR Tubulin alpha chain OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=TUB1 PE=3 SV=2 3 449 0.0E+00
sp|P33627|TBA6_MAIZE Tubulin alpha-6 chain OS=Zea mays GN=TUBA6 PE=2 SV=1 1 435 0.0E+00
sp|P09243|TBA2_STYLE Tubulin alpha-2 chain OS=Stylonychia lemnae PE=3 SV=1 1 435 0.0E+00
sp|P24634|TBA2_EMENI Tubulin alpha-2 chain OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tubB PE=3 SV=2 3 449 0.0E+00
sp|P28268|TBA_EUPVA Tubulin alpha chain OS=Euplotes vannus PE=3 SV=1 1 439 0.0E+00
sp|Q02245|TBA5_MAIZE Tubulin alpha-5 chain OS=Zea mays GN=TUBA5 PE=2 SV=1 1 435 0.0E+00
sp|Q43473|TBA1_HORVU Tubulin alpha-1 chain OS=Hordeum vulgare GN=TUBA1 PE=2 SV=1 1 435 0.0E+00
sp|O22348|TBA2_ELEIN Tubulin alpha-2 chain OS=Eleusine indica GN=TUBA2 PE=2 SV=1 1 437 0.0E+00
sp|P11139|TBA1_ARATH Tubulin alpha-1 chain OS=Arabidopsis thaliana GN=TUBA1 PE=2 SV=1 1 435 0.0E+00
sp|P52274|TBA8_CAEEL Tubulin alpha-8 chain OS=Caenorhabditis elegans GN=tba-8 PE=3 SV=2 2 449 0.0E+00
sp|Q38771|TBA_AVESA Tubulin alpha chain OS=Avena sativa GN=TUBA PE=2 SV=1 1 443 0.0E+00
sp|P38668|TBA1_NEUCR Tubulin alpha-A chain OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tba-1 PE=2 SV=3 3 449 0.0E+00
sp|P07304|TBA1_STYLE Tubulin alpha-1 chain OS=Stylonychia lemnae PE=3 SV=2 1 432 0.0E+00
sp|Q9SCC8|TBAN_GUITH Tubulin alpha chain, nucleomorph OS=Guillardia theta GN=tubA PE=3 SV=1 1 439 0.0E+00
sp|P06606|TBA4_DROME Tubulin alpha-4 chain OS=Drosophila melanogaster GN=alphaTub67C PE=3 SV=1 1 442 0.0E+00
sp|Q8SRI6|TBA_ENCCU Tubulin alpha chain OS=Encephalitozoon cuniculi (strain GB-M1) GN=TUB1 PE=3 SV=1 1 439 0.0E+00
sp|A6NHL2|TBAL3_HUMAN Tubulin alpha chain-like 3 OS=Homo sapiens GN=TUBAL3 PE=1 SV=2 1 436 0.0E+00
sp|Q3UX10|TBAL3_MOUSE Tubulin alpha chain-like 3 OS=Mus musculus GN=Tubal3 PE=2 SV=2 1 435 0.0E+00
sp|P32255|TBA_DICDI Tubulin alpha chain OS=Dictyostelium discoideum GN=tubA PE=1 SV=1 2 439 0.0E+00
sp|Q962P8|TBA6_NAEGR Tubulin alpha-6 chain OS=Naegleria gruberi GN=TUBA6 PE=2 SV=1 1 444 0.0E+00
sp|P33624|TBA2_ANEPH Tubulin alpha-2 chain (Fragment) OS=Anemia phyllitidis GN=TUBA2 PE=2 SV=1 86 444 0.0E+00
sp|P92120|TBA_ENCHE Tubulin alpha chain (Fragment) OS=Encephalitozoon hellem GN=TUB1 PE=3 SV=1 23 406 0.0E+00
sp|P09645|TBA8_CHICK Tubulin alpha-8 chain (Fragment) OS=Gallus gallus PE=3 SV=1 127 449 0.0E+00
sp|P09643|TBA4_CHICK Tubulin alpha-4 chain (Fragment) OS=Gallus gallus PE=3 SV=1 126 446 0.0E+00
sp|P09642|TBA3_CHICK Tubulin alpha-3 chain (Fragment) OS=Gallus gallus PE=3 SV=1 126 446 2.0E-176
sp|P31017|TBA1_ENTHI Tubulin alpha-1 chain OS=Entamoeba histolytica GN=TUB1 PE=3 SV=1 1 444 7.0E-173
sp|A0AAL4|TBA_DICPU Tubulin alpha chain (Fragment) OS=Dictyostelium purpureum GN=tuba PE=3 SV=1 93 409 3.0E-140
sp|P24635|TBA_OCTVU Tubulin alpha chain (Fragment) OS=Octopus vulgaris PE=2 SV=1 212 440 3.0E-133
sp|Q07972|TBAA_PNECA Tubulin alpha chain (Fragment) OS=Pneumocystis carinii GN=TUB-A PE=3 SV=1 204 415 8.0E-133
sp|Q94571|TBB2_HOMAM Tubulin beta-2 chain OS=Homarus americanus PE=2 SV=1 1 434 2.0E-121
sp|P18025|TBB1_MAIZE Tubulin beta-1 chain OS=Zea mays GN=TUBB1 PE=2 SV=1 1 434 1.0E-119
sp|Q27380|TBB_EIMTE Tubulin beta chain OS=Eimeria tenella PE=2 SV=1 1 434 3.0E-115
sp|P30157|TBB6_ECTVR Tubulin beta-6 chain OS=Ectocarpus variabilis GN=TUBB6 PE=2 SV=1 1 434 4.0E-115
sp|P52275|TBB2_CAEEL Tubulin beta-2 chain OS=Caenorhabditis elegans GN=tbb-2 PE=3 SV=1 1 434 4.0E-115
sp|Q9LKI8|TBB_THAWE Tubulin beta chain OS=Thalassiosira weissflogii PE=2 SV=1 1 434 6.0E-115
sp|P10875|TBB_CANAX Tubulin beta chain OS=Candida albicans GN=TUB2 PE=3 SV=1 1 446 1.0E-114
sp|P30156|TBB5_ECTVR Tubulin beta-5 chain OS=Ectocarpus variabilis GN=TUBB5 PE=2 SV=1 1 434 2.0E-114
sp|Q9ZPN9|TBB2_ELEIN Tubulin beta-2 chain OS=Eleusine indica GN=TUBB2 PE=2 SV=1 1 448 2.0E-114
sp|P12456|TBB1_CAEEL Tubulin beta-1 chain OS=Caenorhabditis elegans GN=mec-7 PE=2 SV=1 1 434 3.0E-114
sp|P30668|TBB_SCHCO Tubulin beta chain OS=Schizophyllum commune GN=TUB-2 PE=3 SV=1 1 434 4.0E-114
sp|P41937|TBB4_CAEEL Tubulin beta-4 chain OS=Caenorhabditis elegans GN=tbb-4 PE=3 SV=1 1 442 4.0E-114
sp|P29514|TBB6_ARATH Tubulin beta-6 chain OS=Arabidopsis thaliana GN=TUBB6 PE=2 SV=1 1 434 4.0E-114
sp|P79008|TBB_COPC7 Tubulin beta chain OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_04743 PE=3 SV=1 1 434 8.0E-114
sp|P53375|TBB_PENDI Tubulin beta chain OS=Penicillium digitatum GN=TUB2 PE=3 SV=1 1 448 8.0E-114
sp|P02557|TBB_YEAST Tubulin beta chain OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUB2 PE=1 SV=2 1 444 9.0E-114
sp|P41387|TBB_ONCGI Tubulin beta chain OS=Onchocerca gibsoni GN=TBB PE=3 SV=1 1 446 9.0E-114
sp|Q17299|TBB1_CAEBR Tubulin beta-1 chain OS=Caenorhabditis briggsae GN=mec-7 PE=2 SV=1 1 434 1.0E-113
sp|P18241|TBB1_BRUPA Tubulin beta-1 chain OS=Brugia pahangi PE=3 SV=1 1 449 1.0E-113
sp|P24637|TBB_PNECA Tubulin beta chain OS=Pneumocystis carinii GN=TUB-B PE=2 SV=1 1 448 2.0E-113
sp|P14140|TBB_PLAFA Tubulin beta chain OS=Plasmodium falciparum PE=3 SV=1 1 434 2.0E-113
sp|P14643|TBB_PLAFK Tubulin beta chain OS=Plasmodium falciparum (isolate K1 / Thailand) PE=3 SV=2 1 434 3.0E-113
sp|Q7KQL5|TBB_PLAF7 Tubulin beta chain OS=Plasmodium falciparum (isolate 3D7) GN=PF10_0084 PE=3 SV=1 1 434 3.0E-113
sp|Q24829|TBB_ENCHE Tubulin beta chain OS=Encephalitozoon hellem GN=TUB2 PE=3 SV=1 1 434 3.0E-113
sp|Q9HFQ3|TBB_MELLI Tubulin beta chain OS=Melampsora lini GN=TUB1 PE=3 SV=1 1 434 3.0E-113
sp|P35394|TBB_ENTDO Tubulin beta chain OS=Enteroctopus dofleini PE=2 SV=1 1 434 3.0E-113
sp|P45960|TBB4_ORYSJ Tubulin beta-4 chain OS=Oryza sativa subsp. japonica GN=TUBB4 PE=2 SV=1 1 434 4.0E-113
sp|Q8SS99|TBB_ENCCU Tubulin beta chain OS=Encephalitozoon cuniculi (strain GB-M1) GN=TUB2 PE=1 SV=1 1 434 5.0E-113
sp|Q41783|TBB6_MAIZE Tubulin beta-6 chain OS=Zea mays GN=TUBB6 PE=2 SV=1 1 434 5.0E-113
sp|P32924|TBB1_GEOCN Tubulin beta-1 chain OS=Geotrichum candidum PE=3 SV=2 1 434 5.0E-113
sp|Q6VAF8|TBB3_GOSHI Tubulin beta-3 chain OS=Gossypium hirsutum PE=2 SV=1 1 435 6.0E-113
sp|P93176|TBB_HORVU Tubulin beta chain OS=Hordeum vulgare GN=TUBB PE=2 SV=1 1 434 6.0E-113
sp|Q6VAF5|TBB7_GOSHI Tubulin beta-7 chain OS=Gossypium hirsutum PE=2 SV=1 1 434 6.0E-113
sp|Q9ZRB1|TBB2_WHEAT Tubulin beta-2 chain OS=Triticum aestivum GN=TUBB2 PE=2 SV=1 1 434 9.0E-113
sp|Q43697|TBB5_MAIZE Tubulin beta-5 chain OS=Zea mays GN=TUBB5 PE=2 SV=1 1 434 1.0E-112
sp|Q9ZPN7|TBB4_ELEIN Tubulin beta-4 chain OS=Eleusine indica GN=TUBB4 PE=2 SV=1 1 434 1.0E-112
sp|Q43594|TBB1_ORYSJ Tubulin beta-1 chain OS=Oryza sativa subsp. japonica GN=TUBB1 PE=2 SV=2 1 434 1.0E-112
sp|Q60HC2|TBB3_MACFA Tubulin beta-3 chain OS=Macaca fascicularis GN=TUBB3 PE=2 SV=1 1 446 2.0E-112
sp|Q13509|TBB3_HUMAN Tubulin beta-3 chain OS=Homo sapiens GN=TUBB3 PE=1 SV=2 1 446 2.0E-112
sp|Q2T9S0|TBB3_BOVIN Tubulin beta-3 chain OS=Bos taurus GN=TUBB3 PE=2 SV=1 1 446 2.0E-112
sp|Q9ZRA8|TBB5_WHEAT Tubulin beta-5 chain OS=Triticum aestivum GN=TUBB5 PE=2 SV=1 1 434 2.0E-112
sp|P09244|TBB7_CHICK Tubulin beta-7 chain OS=Gallus gallus PE=2 SV=1 1 434 2.0E-112
sp|Q76FS3|TBB6_ORYSJ Tubulin beta-6 chain OS=Oryza sativa subsp. japonica GN=TUBB6 PE=2 SV=1 1 434 2.0E-112
sp|Q6GLE7|TBB5_XENTR Tubulin beta chain OS=Xenopus tropicalis GN=tubb PE=2 SV=1 1 434 2.0E-112
sp|Q91575|TBB5_XENLA Tubulin beta chain OS=Xenopus laevis GN=tubb PE=2 SV=1 1 434 2.0E-112
sp|P69897|TBB5_RAT Tubulin beta-5 chain OS=Rattus norvegicus GN=Tubb5 PE=1 SV=1 1 434 2.0E-112
sp|Q5R943|TBB5_PONAB Tubulin beta chain OS=Pongo abelii GN=TUBB PE=2 SV=1 1 434 2.0E-112
sp|Q767L7|TBB5_PIG Tubulin beta chain OS=Sus scrofa GN=TUBB PE=2 SV=1 1 434 2.0E-112
sp|Q7JJU6|TBB5_PANTR Tubulin beta chain OS=Pan troglodytes GN=TUBB PE=3 SV=1 1 434 2.0E-112
sp|P99024|TBB5_MOUSE Tubulin beta-5 chain OS=Mus musculus GN=Tubb5 PE=1 SV=1 1 434 2.0E-112
sp|P69895|TBB5_MACMU Tubulin beta chain OS=Macaca mulatta GN=TUBB PE=2 SV=1 1 434 2.0E-112
sp|P07437|TBB5_HUMAN Tubulin beta chain OS=Homo sapiens GN=TUBB PE=1 SV=2 1 434 2.0E-112
sp|P69893|TBB5_CRIGR Tubulin beta-5 chain OS=Cricetulus griseus GN=TUBB5 PE=1 SV=1 1 434 2.0E-112
sp|Q2KJD0|TBB5_BOVIN Tubulin beta-5 chain OS=Bos taurus GN=TUBB5 PE=2 SV=1 1 434 2.0E-112
sp|Q4QRB4|TBB3_RAT Tubulin beta-3 chain OS=Rattus norvegicus GN=Tubb3 PE=1 SV=1 1 446 2.0E-112
sp|Q9ERD7|TBB3_MOUSE Tubulin beta-3 chain OS=Mus musculus GN=Tubb3 PE=1 SV=1 1 446 2.0E-112
sp|P12411|TBB1_ARATH Tubulin beta-1 chain OS=Arabidopsis thaliana GN=TUBB1 PE=2 SV=1 1 434 3.0E-112
sp|Q6VAF7|TBB5_GOSHI Tubulin beta-5 chain OS=Gossypium hirsutum PE=2 SV=1 1 434 3.0E-112
sp|Q4WA70|TBB_ASPFU Tubulin beta chain OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_7G00250 PE=3 SV=1 1 444 3.0E-112
sp|P50259|TBB_PORPU Tubulin beta chain OS=Porphyra purpurea GN=TUBB1 PE=3 SV=1 1 447 3.0E-112
sp|Q6EVK8|TBB1_SUIBO Tubulin beta-1 chain OS=Suillus bovinus GN=TUBB1 PE=3 SV=1 1 434 3.0E-112
sp|P09652|TBB4_CHICK Tubulin beta-4 chain OS=Gallus gallus PE=1 SV=1 1 446 4.0E-112
sp|P05304|TBB_GIAIN Tubulin beta chain OS=Giardia intestinalis PE=2 SV=3 1 434 4.0E-112
sp|O44388|TBB_TRITR Tubulin beta chain OS=Trichuris trichiura PE=3 SV=1 1 434 5.0E-112
sp|P29517|TBB9_ARATH Tubulin beta-9 chain OS=Arabidopsis thaliana GN=TUBB9 PE=1 SV=1 1 441 5.0E-112
sp|Q39697|TBB2_DAUCA Tubulin beta-2 chain OS=Daucus carota GN=TUBB2 PE=2 SV=1 1 444 6.0E-112
sp|P41741|TBB_ACRCH Tubulin beta chain OS=Acremonium chrysogenum GN=TUB2 PE=3 SV=1 1 434 7.0E-112
sp|Q9ZRB2|TBB1_WHEAT Tubulin beta-1 chain OS=Triticum aestivum GN=TUBB1 PE=2 SV=1 1 438 7.0E-112
sp|P50261|TBB3_OOMCK Tubulin beta-3 chain OS=Oomycete-like sp. (strain MacKay2000) GN=TUBB3 PE=3 SV=1 1 434 7.0E-112
sp|P29500|TBB1_PEA Tubulin beta-1 chain OS=Pisum sativum GN=TUBB1 PE=3 SV=1 1 434 1.0E-111
sp|Q9NFZ6|TBB2_ECHMU Tubulin beta-2 chain OS=Echinococcus multilocularis GN=TUB-2 PE=3 SV=1 1 434 1.0E-111
sp|P05219|TBB_SCHPO Tubulin beta chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nda3 PE=1 SV=2 1 434 1.0E-111
sp|Q04709|TBB_BABBO Tubulin beta chain OS=Babesia bovis PE=3 SV=1 1 434 1.0E-111
sp|O17449|TBB1_MANSE Tubulin beta-1 chain OS=Manduca sexta PE=2 SV=1 1 438 2.0E-111
sp|P34108|TBB_NAEGR Tubulin beta chain OS=Naegleria gruberi PE=2 SV=1 1 434 2.0E-111
sp|Q41785|TBB8_MAIZE Tubulin beta-8 chain OS=Zea mays GN=TUBB8 PE=2 SV=1 1 434 2.0E-111
sp|Q40665|TBB3_ORYSJ Tubulin beta-3 chain OS=Oryza sativa subsp. japonica GN=TUBB3 PE=2 SV=2 1 434 2.0E-111
sp|P18026|TBB2_MAIZE Tubulin beta-2 chain OS=Zea mays GN=TUBB2 PE=2 SV=1 1 434 3.0E-111
sp|P37832|TBB7_ORYSJ Tubulin beta-7 chain OS=Oryza sativa subsp. japonica GN=TUBB7 PE=2 SV=2 1 434 3.0E-111
sp|Q9ASR0|TBB3_ARATH Tubulin beta-3 chain OS=Arabidopsis thaliana GN=TUBB3 PE=2 SV=2 1 434 3.0E-111
sp|Q56YW9|TBB2_ARATH Tubulin beta-2 chain OS=Arabidopsis thaliana GN=TUBB2 PE=2 SV=2 1 434 3.0E-111
sp|P29513|TBB5_ARATH Tubulin beta-5 chain OS=Arabidopsis thaliana GN=TUBB5 PE=2 SV=1 1 434 3.0E-111
sp|Q6VAF4|TBB9_GOSHI Tubulin beta-9 chain OS=Gossypium hirsutum PE=2 SV=1 1 434 3.0E-111
sp|Q39445|TBB_CICAR Tubulin beta chain OS=Cicer arietinum GN=TUBB PE=2 SV=1 1 434 4.0E-111
sp|P29501|TBB2_PEA Tubulin beta-2 chain (Fragment) OS=Pisum sativum GN=TUBB2 PE=2 SV=1 3 434 4.0E-111
sp|P09653|TBB5_CHICK Tubulin beta-5 chain OS=Gallus gallus PE=3 SV=1 1 434 4.0E-111
sp|Q84TG9|TBB_PYRYE Tubulin beta chain OS=Pyropia yezoensis GN=TUBB1 PE=3 SV=1 1 428 5.0E-111
sp|P04690|TBB_CHLRE Tubulin beta-1/beta-2 chain OS=Chlamydomonas reinhardtii GN=TUBB1 PE=3 SV=1 1 434 5.0E-111
sp|P11482|TBB1_VOLCA Tubulin beta chain OS=Volvox carteri GN=TUBB1 PE=3 SV=1 1 434 5.0E-111
sp|Q6QDC9|TBB_ZYMTR Tubulin beta chain OS=Zymoseptoria tritici GN=TUB1 PE=3 SV=1 1 434 5.0E-111
sp|Q41782|TBB4_MAIZE Tubulin beta-4 chain OS=Zea mays GN=TUBB4 PE=2 SV=2 1 434 6.0E-111
sp|Q25009|TBB1_HOMAM Tubulin beta-1 chain OS=Homarus americanus PE=2 SV=1 1 434 7.0E-111
sp|Q8H7U1|TBB2_ORYSJ Tubulin beta-2 chain OS=Oryza sativa subsp. japonica GN=TUBB2 PE=2 SV=1 1 434 7.0E-111
sp|Q6P9T8|TBB4B_RAT Tubulin beta-4B chain OS=Rattus norvegicus GN=Tubb4b PE=1 SV=1 1 434 7.0E-111
sp|P32925|TBB2_GEOCN Tubulin beta-2 chain OS=Geotrichum candidum PE=3 SV=2 1 444 7.0E-111
sp|P29516|TBB8_ARATH Tubulin beta-8 chain OS=Arabidopsis thaliana GN=TUBB8 PE=2 SV=2 1 434 7.0E-111
sp|Q9ZPP0|TBB1_ELEIN Tubulin beta-1 chain OS=Eleusine indica GN=TUBB1 PE=2 SV=1 1 434 7.0E-111
sp|Q9GSR5|TBB_ENCIN Tubulin beta chain OS=Encephalitozoon intestinalis GN=TUB2 PE=3 SV=1 1 434 8.0E-111
sp|O04386|TBB_CHLIN Tubulin beta chain OS=Chlamydomonas incerta GN=TUBB PE=3 SV=1 1 434 9.0E-111
sp|P10876|TBB_TETPY Tubulin beta chain OS=Tetrahymena pyriformis GN=BETA-TT1 PE=3 SV=1 1 434 1.0E-110
sp|P40904|TBB2_COLGL Tubulin beta-2 chain OS=Colletotrichum gloeosporioides GN=TUB2 PE=3 SV=2 1 434 1.0E-110
sp|P22014|TBB2_COLGR Tubulin beta-2 chain OS=Colletotrichum graminicola GN=TUB2 PE=3 SV=1 1 434 1.0E-110
sp|P50262|TBB4_OOMCK Tubulin beta-4 chain OS=Oomycete-like sp. (strain MacKay2000) GN=TUBB4 PE=3 SV=1 1 434 1.0E-110
sp|P33127|TBB_EPICN Tubulin beta chain OS=Epichloe coenophiala GN=TUB2 PE=3 SV=1 1 434 1.0E-110
sp|Q96TU8|TBB_UROFA Tubulin beta chain OS=Uromyces fabae GN=TBB1 PE=3 SV=1 1 434 1.0E-110
sp|P37392|TBB1_LUPAL Tubulin beta-1 chain OS=Lupinus albus GN=TUBB1 PE=3 SV=1 1 434 1.0E-110
sp|P46263|TBB1_SOLTU Tubulin beta-1 chain OS=Solanum tuberosum GN=TUBB1 PE=2 SV=1 1 425 1.0E-110
sp|P12460|TBB2_SOYBN Tubulin beta-2 chain OS=Glycine max GN=TUBB2 PE=3 SV=1 1 434 1.0E-110
sp|P10878|TBB_TOXGO Tubulin beta chain OS=Toxoplasma gondii PE=3 SV=1 1 434 1.0E-110
sp|P46265|TBB5_ORYSJ Tubulin beta-5 chain OS=Oryza sativa subsp. japonica GN=TUBB5 PE=1 SV=1 1 434 2.0E-110
sp|Q52NY7|TBB_METAN Tubulin beta chain OS=Metarhizium anisopliae PE=3 SV=1 1 434 2.0E-110
sp|P46264|TBB2_SOLTU Tubulin beta-2 chain OS=Solanum tuberosum GN=TUBB2 PE=2 SV=1 1 425 2.0E-110
sp|P07436|TBB1_PHYPO Tubulin beta-1 chain OS=Physarum polycephalum GN=BETA PE=1 SV=4 1 434 2.0E-110
sp|P30883|TBB4_XENLA Tubulin beta-4 chain OS=Xenopus laevis GN=tubb4 PE=2 SV=1 1 434 2.0E-110
sp|Q4P235|TBB_USTMA Tubulin beta chain OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_05828 PE=3 SV=1 1 434 2.0E-110
sp|Q9BUF5|TBB6_HUMAN Tubulin beta-6 chain OS=Homo sapiens GN=TUBB6 PE=1 SV=1 1 434 2.0E-110
sp|P11833|TBB_PARLI Tubulin beta chain OS=Paracentrotus lividus PE=2 SV=1 1 434 2.0E-110
sp|P36221|TBB1_NOTNE Tubulin beta-1 chain OS=Notothenia neglecta GN=tubb1 PE=1 SV=1 1 434 2.0E-110
sp|Q9ZPN8|TBB3_ELEIN Tubulin beta-3 chain OS=Eleusine indica GN=TUBB3 PE=2 SV=1 1 434 2.0E-110
sp|P04107|TBB_TRYBR Tubulin beta chain OS=Trypanosoma brucei rhodesiense PE=3 SV=1 1 434 2.0E-110
sp|O42786|TBB_MYCPJ Tubulin beta chain OS=Mycosphaerella pini GN=TUB1 PE=3 SV=1 1 434 2.0E-110
sp|P05220|TBB_NEUCR Tubulin beta chain OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tub-2 PE=1 SV=2 1 434 3.0E-110
sp|P85108|TBB2A_RAT Tubulin beta-2A chain OS=Rattus norvegicus GN=Tubb2a PE=1 SV=1 1 434 3.0E-110
sp|Q7TMM9|TBB2A_MOUSE Tubulin beta-2A chain OS=Mus musculus GN=Tubb2a PE=1 SV=1 1 434 3.0E-110
sp|Q4R5B3|TBB2A_MACFA Tubulin beta-2A chain OS=Macaca fascicularis GN=TUBB2A PE=2 SV=1 1 434 3.0E-110
sp|Q13885|TBB2A_HUMAN Tubulin beta-2A chain OS=Homo sapiens GN=TUBB2A PE=1 SV=1 1 434 3.0E-110
sp|Q76FS2|TBB8_ORYSJ Tubulin beta-8 chain OS=Oryza sativa subsp. japonica GN=TUBB8 PE=2 SV=1 1 434 3.0E-110
sp|Q3KVN1|TBB_CERBT Tubulin beta chain OS=Cercospora beticola GN=TUB1 PE=3 SV=1 1 434 3.0E-110
sp|Q4HZS8|TBB_GIBZE Tubulin beta chain OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TUB2 PE=3 SV=1 1 434 3.0E-110
sp|P32256|TBB_DICDI Tubulin beta chain OS=Dictyostelium discoideum GN=tubB PE=1 SV=2 1 443 3.0E-110
sp|Q875L2|TBB2_HYPVI Tubulin beta-2 chain OS=Hypocrea virens PE=2 SV=1 1 434 3.0E-110
sp|Q9ZRB0|TBB3_WHEAT Tubulin beta-3 chain OS=Triticum aestivum GN=TUBB3 PE=2 SV=1 1 434 3.0E-110
sp|P17938|TBB_EPITY Tubulin beta chain OS=Epichloe typhina GN=TUBB PE=3 SV=1 1 434 3.0E-110
sp|P22852|TBB_POLAG Tubulin beta chain OS=Polytomella agilis GN=TUBB1 PE=3 SV=1 1 434 3.0E-110
sp|P24636|TBB4_ARATH Tubulin beta-4 chain OS=Arabidopsis thaliana GN=TUBB4 PE=2 SV=2 1 441 3.0E-110
sp|P68372|TBB4B_MOUSE Tubulin beta-4B chain OS=Mus musculus GN=Tubb4b PE=1 SV=1 1 434 4.0E-110
sp|P68371|TBB4B_HUMAN Tubulin beta-4B chain OS=Homo sapiens GN=TUBB4B PE=1 SV=1 1 434 4.0E-110
sp|Q3MHM5|TBB4B_BOVIN Tubulin beta-4B chain OS=Bos taurus GN=TUBB4B PE=2 SV=1 1 434 4.0E-110
sp|P29502|TBB3_PEA Tubulin beta-3 chain (Fragment) OS=Pisum sativum GN=TUBB3 PE=2 SV=1 10 434 4.0E-110
sp|P33188|TBB1_PARTE Tubulin beta chain OS=Paramecium tetraurelia GN=bPT2 PE=3 SV=1 1 434 4.0E-110
sp|Q41784|TBB7_MAIZE Tubulin beta-7 chain OS=Zea mays GN=TUBB7 PE=2 SV=1 1 434 4.0E-110
sp|P31863|TBB2_HYPRU Tubulin beta-2 chain OS=Hypocrea rufa GN=tub2 PE=3 SV=1 1 434 4.0E-110
sp|Q922F4|TBB6_MOUSE Tubulin beta-6 chain OS=Mus musculus GN=Tubb6 PE=1 SV=1 1 434 4.0E-110
sp|P41352|TBB_TETTH Tubulin beta chain OS=Tetrahymena thermophila GN=BTU1 PE=1 SV=1 1 434 4.0E-110
sp|Q9ZSW1|TBB1_CYAPA Tubulin beta-1 chain OS=Cyanophora paradoxa GN=TUBB1 PE=2 SV=1 1 434 4.0E-110
sp|Q2HJ81|TBB6_BOVIN Tubulin beta-6 chain OS=Bos taurus GN=TUBB6 PE=2 SV=1 1 434 5.0E-110
sp|P02554|TBB_PIG Tubulin beta chain OS=Sus scrofa PE=1 SV=1 1 434 5.0E-110
sp|Q9UV72|TBB_PESMI Tubulin beta chain OS=Pestalotiopsis microspora GN=TUBB PE=2 SV=1 1 434 6.0E-110
sp|Q9D6F9|TBB4A_MOUSE Tubulin beta-4A chain OS=Mus musculus GN=Tubb4a PE=1 SV=3 1 434 6.0E-110
sp|Q4R4X8|TBB4A_MACFA Tubulin beta-4A chain OS=Macaca fascicularis GN=TUBB4A PE=2 SV=1 1 434 6.0E-110
sp|P04350|TBB4A_HUMAN Tubulin beta-4A chain OS=Homo sapiens GN=TUBB4A PE=1 SV=2 1 434 6.0E-110
sp|Q3ZBU7|TBB4A_BOVIN Tubulin beta-4A chain OS=Bos taurus GN=TUBB4A PE=2 SV=1 1 434 6.0E-110
sp|Q9NFZ7|TBB1_ECHMU Tubulin beta-1 chain OS=Echinococcus multilocularis GN=TUB-1 PE=3 SV=1 1 434 6.0E-110
sp|Q8WZE0|TBB_USTVI Tubulin beta chain OS=Microbotryum violaceum PE=2 SV=1 1 438 6.0E-110
sp|Q6VAF6|TBB6_GOSHI Tubulin beta-6 chain OS=Gossypium hirsutum PE=2 SV=1 1 434 6.0E-110
sp|Q9ZRA9|TBB4_WHEAT Tubulin beta-4 chain OS=Triticum aestivum GN=TUBB4 PE=2 SV=1 1 434 7.0E-110
sp|P32882|TBB2_CHICK Tubulin beta-2 chain OS=Gallus gallus PE=1 SV=1 1 434 7.0E-110
sp|Q3KRE8|TBB2B_RAT Tubulin beta-2B chain OS=Rattus norvegicus GN=Tubb2b PE=1 SV=1 1 434 7.0E-110
sp|Q9CWF2|TBB2B_MOUSE Tubulin beta-2B chain OS=Mus musculus GN=Tubb2b PE=1 SV=1 1 434 7.0E-110
sp|Q9BVA1|TBB2B_HUMAN Tubulin beta-2B chain OS=Homo sapiens GN=TUBB2B PE=1 SV=1 1 434 7.0E-110
sp|Q6B856|TBB2B_BOVIN Tubulin beta-2B chain OS=Bos taurus GN=TUBB2B PE=1 SV=2 1 434 7.0E-110
sp|Q875L3|TBB1_HYPVI Tubulin beta-1 chain OS=Hypocrea virens PE=2 SV=1 1 447 8.0E-110
sp|P53374|TBB_GIBFU Tubulin beta chain OS=Gibberella fujikuroi GN=TUB2 PE=3 SV=1 1 434 8.0E-110
sp|P29515|TBB7_ARATH Tubulin beta-7 chain OS=Arabidopsis thaliana GN=TUBB7 PE=2 SV=1 1 434 1.0E-109
sp|P08562|TBB_TRYCR Tubulin beta chain OS=Trypanosoma cruzi PE=3 SV=2 1 434 1.0E-109
sp|P09203|TBB1_CHICK Tubulin beta-1 chain OS=Gallus gallus PE=2 SV=1 1 434 1.0E-109
sp|Q08115|TBB_EUPOC Tubulin beta chain OS=Euplotes octocarinatus PE=3 SV=1 1 434 1.0E-109
sp|P32928|TBB1_COLGL Tubulin beta-1 chain OS=Colletotrichum gloeosporioides GN=TUB1 PE=3 SV=1 1 443 2.0E-109
sp|P20365|TBB_EUPCR Tubulin beta chain OS=Euplotes crassus PE=3 SV=1 1 434 2.0E-109
sp|P53376|TBB_RHYSE Tubulin beta chain OS=Rhynchosporium secalis PE=3 SV=1 1 434 2.0E-109
sp|Q92268|TBB_PLESA Tubulin beta chain OS=Pleurotus sajor-caju PE=2 SV=1 1 438 2.0E-109
sp|Q5UBX3|TBB_TRIRU Tubulin beta chain OS=Trichophyton rubrum PE=2 SV=1 1 448 3.0E-109
sp|P08841|TBB3_DROME Tubulin beta-3 chain OS=Drosophila melanogaster GN=betaTub60D PE=2 SV=2 1 448 3.0E-109
sp|Q91240|TBB_PSEAM Tubulin beta chain OS=Pseudopleuronectes americanus PE=2 SV=1 1 434 3.0E-109
sp|P11857|TBB_STYLE Tubulin beta chain OS=Stylonychia lemnae GN=TUBB1 PE=3 SV=1 1 434 4.0E-109
sp|Q27U48|TBB1_GLOMM Tubulin beta-1 chain OS=Glossina morsitans morsitans PE=2 SV=1 1 434 4.0E-109
sp|Q24560|TBB1_DROME Tubulin beta-1 chain OS=Drosophila melanogaster GN=betaTub56D PE=1 SV=2 1 434 4.0E-109
sp|P09206|TBB3_CHICK Tubulin beta-3 chain OS=Gallus gallus PE=2 SV=1 1 434 4.0E-109
sp|Q9NFZ5|TBB3_ECHMU Tubulin beta-3 chain OS=Echinococcus multilocularis GN=TUB-3 PE=3 SV=1 1 448 5.0E-109
sp|P13602|TBB2_XENLA Tubulin beta-2 chain OS=Xenopus laevis GN=tubb2 PE=2 SV=1 1 438 6.0E-109
sp|Q9YHC3|TBB1_GADMO Tubulin beta-1 chain OS=Gadus morhua PE=2 SV=1 1 434 7.0E-109
sp|P41388|TBB_VENIN Tubulin beta chain OS=Venturia inaequalis PE=3 SV=1 1 434 8.0E-109
sp|Q43695|TBB3_MAIZE Tubulin beta-3 chain OS=Zea mays GN=TUBB3 PE=2 SV=1 1 434 8.0E-109
sp|P28551|TBB3_SOYBN Tubulin beta chain (Fragment) OS=Glycine max GN=TUBB PE=2 SV=2 1 418 1.0E-108
sp|P16040|TBB_BLUGH Tubulin beta chain OS=Blumeria graminis f. sp. hordei GN=TUB2 PE=3 SV=1 1 440 2.0E-108
sp|Q40106|TBB2_LUPAL Tubulin beta-2 chain OS=Lupinus albus GN=TUBB2 PE=3 SV=1 1 434 2.0E-108
sp|P12459|TBB1_SOYBN Tubulin beta-1 chain OS=Glycine max GN=TUBB1 PE=3 SV=1 1 434 2.0E-108
sp|P53373|TBB_BOTFU Tubulin beta chain OS=Botryotinia fuckeliana GN=tubA PE=3 SV=1 1 434 3.0E-108
sp|P41799|TBB_PHANO Tubulin beta chain OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=tubB PE=1 SV=2 1 434 4.0E-108
sp|A2AQ07|TBB1_MOUSE Tubulin beta-1 chain OS=Mus musculus GN=Tubb1 PE=1 SV=1 1 434 7.0E-108
sp|Q42480|TBB1_CHOCR Tubulin beta-1 chain OS=Chondrus crispus GN=TUBB PE=2 SV=1 2 434 7.0E-108
sp|P22013|TBB1_COLGR Tubulin beta-1 chain OS=Colletotrichum graminicola GN=TUB1 PE=3 SV=1 1 434 1.0E-107
sp|P09207|TBB6_CHICK Tubulin beta-6 chain OS=Gallus gallus PE=1 SV=1 1 447 2.0E-107
sp|P40905|TBB2_ERYPI Tubulin beta-2 chain OS=Erysiphe pisi GN=TUB2 PE=2 SV=2 1 434 2.0E-107
sp|P21148|TBB_LEIME Tubulin beta chain OS=Leishmania mexicana PE=3 SV=1 1 434 2.0E-107
sp|Q4R9N3|TBB_COCHE Tubulin beta chain OS=Cochliobolus heterostrophus GN=TUB1 PE=3 SV=1 1 434 3.0E-107
sp|Q86ZP5|TBB_UNCNE Tubulin beta chain OS=Uncinula necator PE=3 SV=1 1 434 3.0E-107
sp|P31864|TBB1_HYPRU Tubulin beta-1 chain OS=Hypocrea rufa GN=tub1 PE=3 SV=1 1 447 4.0E-107
sp|P10874|TBB2_EMENI Tubulin beta-2 chain OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tubC PE=3 SV=2 1 444 7.0E-107
sp|O59837|TBB_PHYCI Tubulin beta chain OS=Phytophthora cinnamomi PE=3 SV=1 1 434 8.0E-107
sp|P33630|TBB1_ANEPH Tubulin beta-1 chain OS=Anemia phyllitidis GN=TUBB1 PE=2 SV=1 1 434 2.0E-106
sp|P41742|TBB_AJECA Tubulin beta chain OS=Ajellomyces capsulatus GN=TUB2 PE=3 SV=1 1 446 3.0E-106
sp|Q9N2N6|TBB_EUPFO Tubulin beta chain OS=Euplotes focardii PE=3 SV=1 1 434 3.0E-106
sp|Q3ZCM7|TBB8_HUMAN Tubulin beta-8 chain OS=Homo sapiens GN=TUBB8 PE=1 SV=2 1 434 1.0E-105
sp|Q8WP13|TBB8_PAPHA Tubulin beta-8 chain OS=Papio hamadryas GN=TUBB8 PE=3 SV=1 1 434 1.0E-105
sp|Q8WP14|TBB8_PANTR Tubulin beta-8 chain OS=Pan troglodytes GN=TUBB8 PE=3 SV=1 1 434 2.0E-105
sp|P61857|TBB2_DROME Tubulin beta-2 chain OS=Drosophila melanogaster GN=betaTub85D PE=1 SV=1 1 434 4.0E-105
sp|P61858|TBB2_DROHY Tubulin beta-2 chain OS=Drosophila hydei GN=betaTub85D PE=2 SV=1 1 434 4.0E-105
sp|Q9SEV2|TBBN_GUITH Tubulin beta chain, nucleomorph OS=Guillardia theta GN=tubB PE=3 SV=2 1 448 4.0E-105
sp|P83130|TBB2_DROER Tubulin beta-2 chain OS=Drosophila erecta GN=betaTub85D PE=3 SV=1 1 434 6.0E-105
sp|Q9H4B7|TBB1_HUMAN Tubulin beta-1 chain OS=Homo sapiens GN=TUBB1 PE=1 SV=1 1 434 4.0E-104
sp|Q2U2U3|TBB_ASPOR Tubulin beta chain OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=benA56 PE=3 SV=1 1 434 5.0E-104
sp|Q00264|TBB_ASPPA Tubulin beta chain OS=Aspergillus parasiticus GN=benR PE=3 SV=1 1 434 6.0E-104
sp|P12458|TBB2_PHYPO Tubulin beta-2 chain OS=Physarum polycephalum GN=BETC PE=2 SV=1 1 446 9.0E-104
sp|P10653|TBB1_EMENI Tubulin beta-1 chain OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=benA PE=3 SV=1 1 434 1.0E-103
sp|P22012|TBB_ASPFL Tubulin beta chain OS=Aspergillus flavus PE=3 SV=1 1 434 2.0E-103
sp|P20802|TBB_ACHKL Tubulin beta chain OS=Achlya klebsiana PE=2 SV=1 1 434 4.0E-103
sp|P41385|TBB_BOMMO Tubulin beta chain OS=Bombyx mori PE=2 SV=1 1 434 9.0E-103
sp|P50260|TBB2_OOMCK Tubulin beta-2 chain (Fragment) OS=Oomycete-like sp. (strain MacKay2000) GN=TUBB2 PE=2 SV=1 27 434 4.0E-102
sp|Q8J1R4|TBB2_SUIBO Tubulin beta-2 chain OS=Suillus bovinus GN=TUBB2 PE=2 SV=1 2 434 2.0E-100
sp|A6NNZ2|TBB8L_HUMAN Tubulin beta-8 chain-like protein LOC260334 OS=Homo sapiens PE=1 SV=1 1 434 2.0E-100
sp|P12457|TBB_EUGGR Tubulin beta chain OS=Euglena gracilis GN=TUBB PE=2 SV=1 1 434 2.0E-99
sp|P33631|TBB2_ANEPH Tubulin beta-2 chain (Fragment) OS=Anemia phyllitidis GN=TUBB2 PE=2 SV=1 50 444 9.0E-99
sp|Q9H853|TBA4B_HUMAN Putative tubulin-like protein alpha-4B OS=Homo sapiens GN=TUBA4B PE=5 SV=2 81 266 8.0E-97
sp|P25862|TBB1_AVESA Tubulin beta-1 chain (Fragment) OS=Avena sativa GN=TUBB1 PE=2 SV=1 65 434 2.0E-96
sp|P41386|TBB_HALDI Tubulin beta chain (Fragment) OS=Haliotis discus PE=2 SV=1 78 425 1.0E-88
sp|P02553|TBA_LYTPI Tubulin alpha chain (Fragment) OS=Lytechinus pictus PE=3 SV=1 291 440 1.0E-85
sp|Q9VRX3|TBBP_DROME Probable tubulin beta chain CG32396 OS=Drosophila melanogaster GN=CG32396 PE=2 SV=1 1 436 6.0E-84
sp|P86234|TBA3_MESAU Tubulin alpha-3 chain (Fragments) OS=Mesocricetus auratus PE=1 SV=1 65 401 1.0E-83
sp|P18695|TBG_EMENI Tubulin gamma chain OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mipA PE=2 SV=3 2 433 3.0E-79
sp|P32348|TBG_USTVI Tubulin gamma chain OS=Microbotryum violaceum GN=TUB4 PE=3 SV=1 2 432 7.0E-79
sp|Q7Z9Z2|TBG_COPC7 Tubulin gamma chain OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=TUB4 PE=3 SV=1 2 432 1.0E-77
sp|P25295|TBG_SCHPO Tubulin gamma chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tug1 PE=3 SV=1 2 433 1.0E-76
sp|P40633|TBG_COCH5 Tubulin gamma chain OS=Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O) GN=TUB4 PE=3 SV=3 2 443 2.0E-76
sp|P54405|TBG_RETFI Tubulin gamma chain OS=Reticulomyxa filosa PE=2 SV=1 2 435 2.0E-75
sp|Q9Y882|TBG_SCHJP Tubulin gamma chain OS=Schizosaccharomyces japonicus GN=tug1 PE=3 SV=1 2 433 5.0E-75
sp|P53377|TBG_NEUCR Tubulin gamma chain OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tbg PE=2 SV=1 2 439 9.0E-75
sp|O49068|TBG2_ORYSJ Tubulin gamma-2 chain OS=Oryza sativa subsp. japonica GN=TUBG2 PE=2 SV=1 2 432 4.0E-73
sp|Q9NRH3|TBG2_HUMAN Tubulin gamma-2 chain OS=Homo sapiens GN=TUBG2 PE=2 SV=1 2 437 1.0E-72
sp|P34787|TBG_PLAFO Tubulin gamma chain OS=Plasmodium falciparum (isolate NF54) GN=G-TUB PE=2 SV=1 2 434 2.0E-72
sp|P38558|TBG2_ARATH Tubulin gamma-2 chain OS=Arabidopsis thaliana GN=TUBG2 PE=1 SV=1 2 432 6.0E-72
sp|Q41808|TBG2_MAIZE Tubulin gamma-2 chain OS=Zea mays GN=TUBG2 PE=2 SV=1 2 432 6.0E-72
sp|Q55AR3|TBG_DICDI Tubulin gamma chain OS=Dictyostelium discoideum GN=tubC PE=1 SV=1 2 432 8.0E-72
sp|Q32KM1|TBG2_BOVIN Tubulin gamma-2 chain OS=Bos taurus GN=TUBG2 PE=2 SV=1 2 437 1.0E-71
sp|P23258|TBG1_HUMAN Tubulin gamma-1 chain OS=Homo sapiens GN=TUBG1 PE=1 SV=2 2 437 1.0E-71
sp|P23330|TBG1_XENLA Tubulin gamma-1 chain OS=Xenopus laevis GN=tubg1 PE=2 SV=1 2 437 2.0E-71
sp|P38557|TBG1_ARATH Tubulin gamma-1 chain OS=Arabidopsis thaliana GN=TUBG1 PE=1 SV=1 2 432 3.0E-71
sp|Q41807|TBG1_MAIZE Tubulin gamma-1 chain OS=Zea mays GN=TUBG1 PE=2 SV=1 2 432 4.0E-71
sp|Q0VCD2|TBG1_BOVIN Tubulin gamma-1 chain OS=Bos taurus GN=TUBG1 PE=2 SV=1 2 437 1.0E-70
sp|Q39582|TBG_CHLRE Tubulin gamma chain OS=Chlamydomonas reinhardtii GN=TUBG PE=3 SV=1 2 432 2.0E-70
sp|Q8VCK3|TBG2_MOUSE Tubulin gamma-2 chain OS=Mus musculus GN=Tubg2 PE=1 SV=1 2 437 2.0E-70
sp|P83888|TBG1_RAT Tubulin gamma-1 chain OS=Rattus norvegicus GN=Tubg1 PE=2 SV=1 2 437 5.0E-70
sp|P83887|TBG1_MOUSE Tubulin gamma-1 chain OS=Mus musculus GN=Tubg1 PE=1 SV=1 2 437 5.0E-70
sp|P23257|TBG1_DROME Tubulin gamma-1 chain OS=Drosophila melanogaster GN=gammaTub23C PE=2 SV=2 3 433 8.0E-70
sp|Q9GKK5|TBG1_CANLF Tubulin gamma-1 chain OS=Canis lupus familiaris GN=TUBG1 PE=2 SV=1 2 437 8.0E-70
sp|P54404|TBG2_EUPCR Tubulin gamma-2 chain OS=Euplotes crassus PE=2 SV=1 2 437 1.0E-69
sp|P54403|TBG1_EUPCR Tubulin gamma-1 chain OS=Euplotes crassus PE=2 SV=1 2 440 1.0E-69
sp|Q9XFG3|TBG_PHYPA Tubulin gamma chain OS=Physcomitrella patens subsp. patens GN=TUBG1 PE=3 SV=1 2 432 2.0E-69
sp|P34785|TBG_ANEPH Tubulin gamma chain OS=Anemia phyllitidis GN=TUBG PE=2 SV=1 2 432 4.0E-69
sp|P90548|TBG2_EUPOC Tubulin gamma-2 chain OS=Euplotes octocarinatus PE=3 SV=1 2 437 2.0E-68
sp|P34786|TBG1_EUPOC Tubulin gamma-1 chain OS=Euplotes octocarinatus PE=2 SV=2 2 437 4.0E-68
sp|P54402|TBG_EUPAE Tubulin gamma chain OS=Euplotes aediculatus PE=2 SV=1 2 437 2.0E-67
sp|P42271|TBG2_DROME Tubulin gamma-2 chain OS=Drosophila melanogaster GN=gammaTub37C PE=2 SV=3 3 433 3.0E-67
sp|Q9D6T1|TBE_MOUSE Tubulin epsilon chain OS=Mus musculus GN=Tube1 PE=2 SV=1 1 437 4.0E-66
sp|P18700|TBB_STRPU Tubulin beta chain (Fragment) OS=Strongylocentrotus purpuratus PE=2 SV=1 160 434 9.0E-66
sp|Q9UJT0|TBE_HUMAN Tubulin epsilon chain OS=Homo sapiens GN=TUBE1 PE=2 SV=1 1 437 3.0E-65
sp|P20364|TBB1_DAUCA Tubulin beta-1 chain (Fragment) OS=Daucus carota GN=TUBB1 PE=1 SV=2 135 434 8.0E-65
sp|P54401|TBG_ENTHI Tubulin gamma chain OS=Entamoeba histolytica PE=2 SV=1 2 432 6.0E-62
sp|Q41874|TBG3_MAIZE Tubulin gamma-3 chain (Fragment) OS=Zea mays GN=TUBG3 PE=2 SV=1 52 432 1.0E-59
sp|Q75A43|TBG_ASHGO Tubulin gamma chain OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TUB4 PE=3 SV=1 3 432 2.0E-59
sp|Q8SRD2|TBG_ENCCU Tubulin gamma chain OS=Encephalitozoon cuniculi (strain GB-M1) GN=TUB4 PE=3 SV=1 1 432 3.0E-58
sp|P53378|TBG_YEAST Tubulin gamma chain OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUB4 PE=1 SV=1 3 445 8.0E-55
sp|P33628|TBA_PICAB Tubulin alpha chain (Fragment) OS=Picea abies GN=TUBA PE=2 SV=1 20 132 1.0E-49
sp|P86221|TBB4B_MESAU Tubulin beta-4B chain (Fragments) OS=Mesocricetus auratus GN=TUBB4B PE=1 SV=1 1 401 3.0E-48
sp|Q6FNU9|TBG_CANGA Tubulin gamma chain OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TUB4 PE=3 SV=1 3 448 2.0E-46
sp|P33632|TBB3_ANEPH Tubulin beta-3 chain (Fragment) OS=Anemia phyllitidis GN=TUBB3 PE=2 SV=1 207 434 3.0E-45
sp|P34475|TBG_CAEEL Tubulin gamma chain OS=Caenorhabditis elegans GN=tbg-1 PE=2 SV=1 4 405 6.0E-41
sp|O93807|TBG_CANAX Tubulin gamma chain OS=Candida albicans GN=TUB4 PE=3 SV=1 3 432 7.0E-41
sp|Q8HZV4|TBD_CANLF Tubulin delta chain OS=Canis lupus familiaris GN=TUBD1 PE=2 SV=1 4 418 1.0E-29
sp|Q9UJT1|TBD_HUMAN Tubulin delta chain OS=Homo sapiens GN=TUBD1 PE=2 SV=2 4 432 1.0E-29
sp|Q4R7T7|TBD_MACFA Tubulin delta chain OS=Macaca fascicularis GN=TUBD1 PE=2 SV=1 4 432 4.0E-29
sp|P02556|TBB_LYTPI Tubulin beta chain (Fragment) OS=Lytechinus pictus PE=2 SV=1 272 434 4.0E-28
sp|Q9R1K7|TBD_MOUSE Tubulin delta chain OS=Mus musculus GN=Tubd1 PE=2 SV=1 4 418 3.0E-27
sp|Q6DIM3|TBD_XENTR Tubulin delta chain OS=Xenopus tropicalis GN=tubd1 PE=2 SV=1 4 432 3.0E-26
sp|Q9SEA4|TBGN_GUITH Tubulin gamma chain, nucleomorph OS=Guillardia theta GN=tubG PE=3 SV=2 3 437 4.0E-24
sp|Q08628|TBA_BLEJA Tubulin alpha chain (Fragment) OS=Blepharisma japonicum PE=2 SV=1 404 436 2.0E-13
sp|P18699|TBB_LYMST Tubulin beta chain (Fragment) OS=Lymnaea stagnalis PE=2 SV=1 343 434 3.0E-12
sp|P33626|TBA4_MAIZE Tubulin alpha-4 chain (Fragments) OS=Zea mays GN=TUBA4 PE=3 SV=1 1 49 4.0E-12
sp|P84549|TBA_POPEU Tubulin alpha chain (Fragments) OS=Populus euphratica PE=1 SV=1 215 264 4.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0019001 guanyl nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7494
MREVISINVGQAGCQIANSCWELYCLEHGIQPDGYLTEQRKAQDPDQGFSTFFSETGQGKYVPRAIYCDLEPNVV
DEVRTGPYRNLFHPEMMITGKEDASNNYARGHYTVGKELIDGVLDKIRRVADNCVGLQGFLVFHSFGGGTGSGFG
ALLMERLSVDYGKKSKLEFCVYPAPQTATSVVEPYNSILTTHTTLEHSDCSFMVDNEAIYDICRRNLGLERPNYE
NLNRLIAQVVSSITASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVAYAPVISAAKAAHEANSVQEMTMSCFEPNN
QMVKCDPRHGKYMATCLLYRGDVVPNDAHAAVATLKTKRTIQFVDWCPTGFKLGICYQAPMNVPNGDLAKVNRAV
CMLSNTTAISEAWSSLSNKFDLMHAKRAFVHWYVGEGMEEGEFSEAREDLAALERDYDEVAADSMGEEELEAEY*
Coding >OphauB2|7494
ATGCGTGAAGTCATCAGCATCAACGTCGGCCAAGCTGGCTGCCAAATTGCCAACTCGTGCTGGGAGCTATACTGT
CTGGAGCACGGAATACAGCCTGATGGCTATCTCACTGAGCAGCGCAAGGCGCAGGATCCTGACCAGGGCTTCAGC
ACCTTCTTCTCGGAGACGGGACAAGGGAAATATGTCCCCAGGGCCATTTATTGTGATCTCGAGCCCAACGTCGTC
GACGAAGTTCGCACCGGTCCCTACCGTAACCTCTTTCACCCCGAGATGATGATCACGGGCAAGGAAGACGCCTCC
AACAACTATGCCCGAGGCCACTACACCGTGGGCAAGGAGCTTATTGATGGCGTTTTGGACAAGATTCGCCGCGTT
GCCGACAACTGCGTGGGTCTGCAGGGATTTCTTGTTTTCCACTCTTTTGGCGGTGGCACTGGCTCCGGGTTTGGT
GCCCTTCTCATGGAGCGCCTTTCTGTCGACTATGGCAAGAAGAGCAAACTCGAGTTTTGCGTCTACCCTGCTCCT
CAGACGGCCACTTCTGTTGTTGAGCCCTATAATTCCATCTTGACTACTCACACCACGCTCGAGCACTCTGACTGC
TCTTTCATGGTGGACAACGAGGCAATTTATGACATCTGCCGCAGGAACCTGGGCCTGGAGCGCCCCAACTATGAG
AATCTCAATCGTCTCATTGCGCAGGTTGTGTCGTCCATTACGGCGTCGCTCCGCTTTGATGGTTCCCTCAACGTC
GATCTCAACGAGTTCCAGACGAATCTCGTGCCATATCCCCGCATCCATTTCCCCTTGGTGGCCTATGCGCCCGTC
ATTTCGGCCGCCAAGGCTGCACACGAGGCAAATTCGGTACAGGAGATGACCATGTCTTGCTTTGAACCCAACAAC
CAAATGGTCAAATGCGACCCGCGACATGGGAAATACATGGCCACTTGCTTGTTGTACCGCGGTGACGTTGTGCCC
AATGATGCACATGCTGCTGTTGCAACCCTCAAGACGAAGCGAACTATTCAGTTTGTCGACTGGTGCCCTACAGGT
TTCAAGCTTGGCATTTGCTACCAGGCTCCCATGAACGTTCCCAACGGTGACTTGGCCAAGGTCAACCGTGCAGTC
TGCATGTTGTCCAATACGACTGCAATCTCCGAGGCCTGGAGCAGTCTATCAAACAAGTTTGACCTTATGCACGCG
AAGCGCGCTTTCGTTCACTGGTATGTTGGCGAGGGCATGGAGGAGGGTGAGTTTTCTGAAGCTCGTGAGGACTTG
GCTGCACTTGAGCGCGACTACGACGAGGTTGCTGCCGATTCCATGGGTGAAGAGGAACTTGAAGCCGAGTATTAG
Transcript >OphauB2|7494
ATGCGTGAAGTCATCAGCATCAACGTCGGCCAAGCTGGCTGCCAAATTGCCAACTCGTGCTGGGAGCTATACTGT
CTGGAGCACGGAATACAGCCTGATGGCTATCTCACTGAGCAGCGCAAGGCGCAGGATCCTGACCAGGGCTTCAGC
ACCTTCTTCTCGGAGACGGGACAAGGGAAATATGTCCCCAGGGCCATTTATTGTGATCTCGAGCCCAACGTCGTC
GACGAAGTTCGCACCGGTCCCTACCGTAACCTCTTTCACCCCGAGATGATGATCACGGGCAAGGAAGACGCCTCC
AACAACTATGCCCGAGGCCACTACACCGTGGGCAAGGAGCTTATTGATGGCGTTTTGGACAAGATTCGCCGCGTT
GCCGACAACTGCGTGGGTCTGCAGGGATTTCTTGTTTTCCACTCTTTTGGCGGTGGCACTGGCTCCGGGTTTGGT
GCCCTTCTCATGGAGCGCCTTTCTGTCGACTATGGCAAGAAGAGCAAACTCGAGTTTTGCGTCTACCCTGCTCCT
CAGACGGCCACTTCTGTTGTTGAGCCCTATAATTCCATCTTGACTACTCACACCACGCTCGAGCACTCTGACTGC
TCTTTCATGGTGGACAACGAGGCAATTTATGACATCTGCCGCAGGAACCTGGGCCTGGAGCGCCCCAACTATGAG
AATCTCAATCGTCTCATTGCGCAGGTTGTGTCGTCCATTACGGCGTCGCTCCGCTTTGATGGTTCCCTCAACGTC
GATCTCAACGAGTTCCAGACGAATCTCGTGCCATATCCCCGCATCCATTTCCCCTTGGTGGCCTATGCGCCCGTC
ATTTCGGCCGCCAAGGCTGCACACGAGGCAAATTCGGTACAGGAGATGACCATGTCTTGCTTTGAACCCAACAAC
CAAATGGTCAAATGCGACCCGCGACATGGGAAATACATGGCCACTTGCTTGTTGTACCGCGGTGACGTTGTGCCC
AATGATGCACATGCTGCTGTTGCAACCCTCAAGACGAAGCGAACTATTCAGTTTGTCGACTGGTGCCCTACAGGT
TTCAAGCTTGGCATTTGCTACCAGGCTCCCATGAACGTTCCCAACGGTGACTTGGCCAAGGTCAACCGTGCAGTC
TGCATGTTGTCCAATACGACTGCAATCTCCGAGGCCTGGAGCAGTCTATCAAACAAGTTTGACCTTATGCACGCG
AAGCGCGCTTTCGTTCACTGGTATGTTGGCGAGGGCATGGAGGAGGGTGAGTTTTCTGAAGCTCGTGAGGACTTG
GCTGCACTTGAGCGCGACTACGACGAGGTTGCTGCCGATTCCATGGGTGAAGAGGAACTTGAAGCCGAGTATTAG
Gene >OphauB2|7494
ATGCGTGAAGTCATCAGCATCAACGGTAAGCTCTAGCTCGTGTCCTTTACGCGTCGTTGCCCTAGCCACCAAGCT
CGTCGCCTTGTGTCTGCATCACATTGCGCTGACGCACCCTTCTAGTCGGCCAAGCTGGCTGCCAAATTGCCAACT
CGTGCTGGGAGGTAAGTTTTGCCTTGCTGCAAAGAATTCTGCTCAATGGCGCCTTGTACTGACTCAATTTGTTCA
GCTATACTGTCTGGAGCACGGAATACAGGTATATTTACTGCCACTGCCTCGCTCGCCTTGATACAGTCGGATTCG
GCTAACGCGCATTTGCCCGCTTTAGCCTGATGGCTATCTCACTGAGCAGCGCAAGGCGCAGGATCCTGACCAGGG
CTTCAGCACCTTCTTCTCGGAGACGGGTACGGACCCATGACCATCAGTCTTCTCCCCCCCCCCAATCTTGCAAAT
CATGTTTCTGAACAAAATCCCTTTTTGGGGGAATCTAGGACAAGGGAAATATGTCCCCAGGGCCATTTATTGTGA
TCTCGAGCCCAACGTCGTCGACGAAGTTCGCACCGGTCCCTACCGTAACCTCTTTCACCCCGAGATGATGATCAC
GGGCAAGGAAGACGCCTCCAACAACTATGCCCGAGGCCACTACACCGTGGGCAAGGAGCTTATTGATGGCGTTTT
GGACAAGATTCGCCGCGTTGCCGACAACTGCGTGGGTCTGCAGGGATTTCTTGTTTTCCACTCTTTTGGCGGTGG
CACTGGCTCCGGGTTTGGTGCCCTTCTCATGGAGCGCCTTTCTGTCGACTATGGCAAGAAGAGCAAACTCGAGTT
TTGCGTCTACCCTGCTCCTCAGACGGCCACTTCTGTTGTTGAGCCCTATAATTCCATCTTGACTACTCACACCAC
GCTCGAGCACTCTGACTGCTCTTTCATGGTGGACAACGAGGCAATTTATGACATCTGCCGCAGGAACCTGGGCCT
GGAGCGCCCCAACTATGAGAATCTCAATCGTCTCATTGCGCAGGGTACGTTGATGTATAGAGAGGAGGTCCAACT
ATAGTCCCAGCTGACGAAATACGTGGATAGTTGTGTCGTCCATTACGGCGTCGCTCCGCTTTGATGGTTCCCTCA
ACGTCGATCTCAACGAGTTCCAGACGAATCTCGTGCCATATCCCCGCATCCATTTCCCCTTGGTGGCCTATGCGC
CCGTCATTTCGGCCGCCAAGGCTGCACACGAGGCAAATTCGGTACAGGAGATGACCATGTCTTGCTTTGAACCCA
ACAACCAAATGGTCAAATGCGACCCGCGACATGGGAAATACATGGCCACTTGCTTGTTGTACCGCGGTGACGTTG
TGCCCAATGATGCACATGCTGCTGTTGCAACCCTCAAGACGAAGCGAACTATTCAGTTTGTCGACTGGTGCCCTA
CAGGTTTCAAGCTTGGCATTTGCTACCAGGCTCCCATGAACGTTCCCAACGGTGACTTGGCCAAGGTCAACCGTG
CAGTGTAAGAAGCCTCACACAGCTGTCGTGTCAATTTTTTTTTTTTGCTGACTTGTTTGATAGCTGCATGTTGTC
CAATACGACTGCAATCTCCGAGGCCTGGAGCAGTCTATCAAACAAGTTTGACCTTATGCACGCGAAGCGCGCTTT
CGTTCACTGGTATGTTGGCGAGGGCATGGAGGAGGGTGAGTTTTCTGAAGCTCGTGAGGACTTGGCTGCACTTGA
GCGCGACTACGACGAGGTTGCTGCCGATTCCATGGGTGAAGAGGAACTTGAAGCCGAGTATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail