Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7492
Gene name
LocationContig_8:258611..260494
Strand-
Gene length (bp)1883
Transcript length (bp)1536
Coding sequence length (bp)1536
Protein length (aa) 512

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00006 ATP-synt_ab ATP synthase alpha/beta family, nucleotide-binding domain 1.0E-62 144 374
PF02874 ATP-synt_ab_N ATP synthase alpha/beta family, beta-barrel domain 2.7E-14 24 87

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P11593|VATB_NEUCR V-type proton ATPase subunit B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vma-2 PE=3 SV=1 1 511 0.0E+00
sp|Q59PT0|VATB_CANAL V-type proton ATPase subunit B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VMA2 PE=3 SV=1 7 481 0.0E+00
sp|P16140|VATB_YEAST V-type proton ATPase subunit B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA2 PE=1 SV=2 10 479 0.0E+00
sp|P22550|VATB_CANTR V-type proton ATPase subunit B OS=Candida tropicalis GN=VMA2 PE=3 SV=1 7 481 0.0E+00
sp|P31411|VATB_SCHPO V-type proton ATPase subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma2 PE=1 SV=2 10 482 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P11593|VATB_NEUCR V-type proton ATPase subunit B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vma-2 PE=3 SV=1 1 511 0.0E+00
sp|Q59PT0|VATB_CANAL V-type proton ATPase subunit B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VMA2 PE=3 SV=1 7 481 0.0E+00
sp|P16140|VATB_YEAST V-type proton ATPase subunit B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA2 PE=1 SV=2 10 479 0.0E+00
sp|P22550|VATB_CANTR V-type proton ATPase subunit B OS=Candida tropicalis GN=VMA2 PE=3 SV=1 7 481 0.0E+00
sp|P31411|VATB_SCHPO V-type proton ATPase subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma2 PE=1 SV=2 10 482 0.0E+00
sp|P31408|VATB2_BOVIN V-type proton ATPase subunit B, brain isoform OS=Bos taurus GN=ATP6V1B2 PE=1 SV=3 7 481 0.0E+00
sp|P62815|VATB2_RAT V-type proton ATPase subunit B, brain isoform OS=Rattus norvegicus GN=Atp6v1b2 PE=1 SV=1 7 481 0.0E+00
sp|P62814|VATB2_MOUSE V-type proton ATPase subunit B, brain isoform OS=Mus musculus GN=Atp6v1b2 PE=1 SV=1 7 481 0.0E+00
sp|P31401|VATB_MANSE V-type proton ATPase subunit B OS=Manduca sexta GN=VHA55 PE=2 SV=1 14 481 0.0E+00
sp|P31410|VATB_HELVI V-type proton ATPase subunit B OS=Heliothis virescens GN=VHA55 PE=2 SV=1 14 481 0.0E+00
sp|Q5R5V5|VATB2_PONAB V-type proton ATPase subunit B, brain isoform OS=Pongo abelii GN=ATP6V1B2 PE=2 SV=1 7 481 0.0E+00
sp|P21281|VATB2_HUMAN V-type proton ATPase subunit B, brain isoform OS=Homo sapiens GN=ATP6V1B2 PE=1 SV=3 7 481 0.0E+00
sp|P31409|VATB_DROME V-type proton ATPase subunit B OS=Drosophila melanogaster GN=Vha55 PE=2 SV=1 14 481 0.0E+00
sp|P15313|VATB1_HUMAN V-type proton ATPase subunit B, kidney isoform OS=Homo sapiens GN=ATP6V1B1 PE=1 SV=3 7 481 0.0E+00
sp|P31407|VATB1_BOVIN V-type proton ATPase subunit B, kidney isoform OS=Bos taurus GN=ATP6V1B1 PE=1 SV=1 7 488 0.0E+00
sp|Q8SR34|VATB_ENCCU V-type proton ATPase subunit B OS=Encephalitozoon cuniculi (strain GB-M1) GN=VMA2 PE=1 SV=1 9 482 0.0E+00
sp|Q8W4E2|VATB3_ARATH V-type proton ATPase subunit B3 OS=Arabidopsis thaliana GN=VHA-B3 PE=2 SV=1 16 481 0.0E+00
sp|Q40079|VATB2_HORVU V-type proton ATPase subunit B 2 OS=Hordeum vulgare PE=2 SV=1 16 481 0.0E+00
sp|P11574|VATB1_ARATH V-type proton ATPase subunit B1 OS=Arabidopsis thaliana GN=VHA-B1 PE=2 SV=2 16 481 0.0E+00
sp|Q76NU1|VATB_DICDI V-type proton ATPase subunit B OS=Dictyostelium discoideum GN=vatB PE=1 SV=1 7 484 0.0E+00
sp|Q9SZN1|VATB2_ARATH V-type proton ATPase subunit B2 OS=Arabidopsis thaliana GN=VHA-B2 PE=1 SV=1 16 481 0.0E+00
sp|Q43432|VATB1_GOSHI V-type proton ATPase subunit B 1 OS=Gossypium hirsutum PE=2 SV=1 16 481 0.0E+00
sp|Q40078|VATB1_HORVU V-type proton ATPase subunit B 1 OS=Hordeum vulgare PE=2 SV=1 16 481 0.0E+00
sp|Q619C0|VATB_CAEBR Probable V-type proton ATPase subunit B OS=Caenorhabditis briggsae GN=vha-12 PE=3 SV=1 9 481 0.0E+00
sp|Q19626|VATB_CAEEL Probable V-type proton ATPase subunit B OS=Caenorhabditis elegans GN=vha-12 PE=3 SV=1 9 482 0.0E+00
sp|Q38681|VATB1_ACEAT V-type proton ATPase subunit B 1 OS=Acetabularia acetabulum PE=2 SV=1 10 482 0.0E+00
sp|P48413|VATB_CYACA V-type proton ATPase subunit B OS=Cyanidium caldarium PE=3 SV=1 7 487 0.0E+00
sp|Q38680|VATB2_ACEAT V-type proton ATPase subunit B 2 OS=Acetabularia acetabulum PE=2 SV=1 10 483 0.0E+00
sp|Q25691|VATB_PLAFA V-type proton ATPase subunit B OS=Plasmodium falciparum GN=VAPB PE=2 SV=1 9 485 0.0E+00
sp|Q26976|VATB_TRYCO V-type proton ATPase subunit B OS=Trypanosoma congolense PE=2 SV=1 10 479 0.0E+00
sp|P49712|VATB_CHICK V-type proton ATPase subunit B OS=Gallus gallus GN=ATP6V1B PE=3 SV=1 14 489 0.0E+00
sp|Q43433|VATB2_GOSHI V-type proton ATPase subunit B 2 (Fragment) OS=Gossypium hirsutum PE=2 SV=1 100 481 0.0E+00
sp|O57729|VATB_PYRHO V-type ATP synthase beta chain OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=atpB PE=3 SV=1 18 486 0.0E+00
sp|Q9UXU8|VATB_PYRAB V-type ATP synthase beta chain OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=atpB PE=3 SV=2 18 486 0.0E+00
sp|O27035|VATB_METTH V-type ATP synthase beta chain OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=atpB PE=3 SV=2 18 470 0.0E+00
sp|Q8U4A5|VATB_PYRFU V-type ATP synthase beta chain OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=atpB PE=3 SV=1 18 481 0.0E+00
sp|B5XJH4|VATB_STRPZ V-type ATP synthase beta chain OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=atpB PE=3 SV=1 18 482 0.0E+00
sp|Q8P2U5|VATB_STRP8 V-type ATP synthase beta chain OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=atpB PE=3 SV=1 18 482 0.0E+00
sp|P0DA09|VATB_STRPQ V-type ATP synthase beta chain OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=atpB PE=3 SV=1 18 482 0.0E+00
sp|A2RC98|VATB_STRPG V-type ATP synthase beta chain OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=atpB PE=3 SV=1 18 482 0.0E+00
sp|Q1J8S4|VATB_STRPF V-type ATP synthase beta chain OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=atpB PE=3 SV=1 18 482 0.0E+00
sp|Q1JIX4|VATB_STRPD V-type ATP synthase beta chain OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=atpB PE=3 SV=1 18 482 0.0E+00
sp|Q1JNS7|VATB_STRPC V-type ATP synthase beta chain OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=atpB PE=3 SV=1 18 482 0.0E+00
sp|Q1JDW9|VATB_STRPB V-type ATP synthase beta chain OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=atpB PE=3 SV=1 18 482 0.0E+00
sp|Q5XE49|VATB_STRP6 V-type ATP synthase beta chain OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=atpB PE=3 SV=1 18 482 0.0E+00
sp|P0DA08|VATB_STRP3 V-type ATP synthase beta chain OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=atpB PE=3 SV=1 18 482 0.0E+00
sp|Q9A1Q2|VATB_STRP1 V-type ATP synthase beta chain OS=Streptococcus pyogenes serotype M1 GN=atpB PE=3 SV=1 18 482 0.0E+00
sp|Q48VL2|VATB_STRPM V-type ATP synthase beta chain OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=atpB PE=3 SV=1 18 482 0.0E+00
sp|Q5JIR2|VATB_THEKO V-type ATP synthase beta chain OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=atpB PE=3 SV=1 12 484 0.0E+00
sp|A5UKB1|VATB_METS3 V-type ATP synthase beta chain OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=atpB PE=3 SV=1 18 478 0.0E+00
sp|O32467|VATB_THESI V-type ATP synthase beta chain OS=Thermococcus sp. (strain KI) GN=atpB PE=3 SV=1 13 484 0.0E+00
sp|B6YV15|VATB_THEON V-type ATP synthase beta chain OS=Thermococcus onnurineus (strain NA1) GN=atpB PE=3 SV=1 12 484 0.0E+00
sp|C5A337|VATB_THEGJ V-type ATP synthase beta chain OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=atpB PE=3 SV=1 13 484 0.0E+00
sp|O06505|VATB_DESSY V-type ATP synthase beta chain OS=Desulfurococcus sp. (strain SY) GN=atpB PE=3 SV=2 13 484 0.0E+00
sp|Q2NF88|VATB_METST V-type ATP synthase beta chain OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=atpB PE=3 SV=1 18 485 0.0E+00
sp|A8AUJ8|VATB_STRGC V-type ATP synthase beta chain OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=atpB PE=3 SV=1 18 487 0.0E+00
sp|O29100|VATB_ARCFU V-type ATP synthase beta chain OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=atpB PE=3 SV=2 18 484 0.0E+00
sp|A3CK49|VATB_STRSV V-type ATP synthase beta chain OS=Streptococcus sanguinis (strain SK36) GN=atpB PE=3 SV=1 18 487 0.0E+00
sp|B5YFA1|VATB_DICT6 V-type ATP synthase beta chain OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=atpB PE=3 SV=1 18 479 0.0E+00
sp|Q57669|VATB_METJA V-type ATP synthase beta chain OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=atpB PE=3 SV=1 16 484 0.0E+00
sp|B8E137|VATB_DICTD V-type ATP synthase beta chain OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=atpB PE=3 SV=1 18 479 0.0E+00
sp|B0K5I9|VATB_THEPX V-type ATP synthase beta chain OS=Thermoanaerobacter sp. (strain X514) GN=atpB PE=3 SV=1 18 478 0.0E+00
sp|B0K8E7|VATB_THEP3 V-type ATP synthase beta chain OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=atpB PE=3 SV=1 18 478 0.0E+00
sp|Q18FB8|VATB_HALWD V-type ATP synthase beta chain OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=atpB PE=3 SV=1 18 489 0.0E+00
sp|Q2FQF0|VATB3_METHJ V-type ATP synthase beta chain 3 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=atpB3 PE=3 SV=1 16 480 0.0E+00
sp|Q5UXY7|VATB_HALMA V-type ATP synthase beta chain OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=atpB PE=3 SV=1 18 480 0.0E+00
sp|A6UT36|VATB_META3 V-type ATP synthase beta chain OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=atpB PE=3 SV=1 11 484 0.0E+00
sp|Q8RI79|VATB_FUSNN V-type ATP synthase beta chain OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=atpB PE=3 SV=1 18 485 0.0E+00
sp|A0PZC7|VATB_CLONN V-type ATP synthase beta chain OS=Clostridium novyi (strain NT) GN=atpB PE=3 SV=1 18 478 0.0E+00
sp|Q0SSI3|VATB_CLOPS V-type ATP synthase beta chain OS=Clostridium perfringens (strain SM101 / Type A) GN=atpB PE=3 SV=1 18 478 0.0E+00
sp|Q8XJW6|VATB_CLOPE V-type ATP synthase beta chain OS=Clostridium perfringens (strain 13 / Type A) GN=atpB PE=3 SV=1 18 478 0.0E+00
sp|Q0TPW8|VATB_CLOP1 V-type ATP synthase beta chain OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=atpB PE=3 SV=1 18 478 0.0E+00
sp|A5I556|VATB_CLOBH V-type ATP synthase beta chain OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=atpB PE=3 SV=1 18 484 0.0E+00
sp|A7FWQ6|VATB_CLOB1 V-type ATP synthase beta chain OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=atpB PE=3 SV=1 18 484 0.0E+00
sp|B1KXT5|VATB_CLOBM V-type ATP synthase beta chain OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=atpB PE=3 SV=1 18 484 0.0E+00
sp|A7GGL3|VATB_CLOBL V-type ATP synthase beta chain OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=atpB PE=3 SV=1 18 484 0.0E+00
sp|B1IJM7|VATB_CLOBK V-type ATP synthase beta chain OS=Clostridium botulinum (strain Okra / Type B1) GN=atpB PE=3 SV=1 18 484 0.0E+00
sp|Q896K3|VATB1_CLOTE V-type ATP synthase beta chain 1 OS=Clostridium tetani (strain Massachusetts / E88) GN=atpB1 PE=3 SV=1 18 478 0.0E+00
sp|Q834X8|VATB_ENTFA V-type ATP synthase beta chain OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=atpB PE=3 SV=1 18 478 0.0E+00
sp|Q08637|NTPB_ENTHA V-type sodium ATPase subunit B OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=ntpB PE=1 SV=1 18 478 0.0E+00
sp|Q2FL44|VATB2_METHJ V-type ATP synthase beta chain 2 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=atpB2 PE=3 SV=1 16 478 0.0E+00
sp|P22663|VATB_METBA V-type ATP synthase beta chain OS=Methanosarcina barkeri GN=atpB PE=3 SV=1 18 487 0.0E+00
sp|Q48333|VATB_HALVD V-type ATP synthase beta chain OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=atpB PE=1 SV=2 18 490 0.0E+00
sp|C3L1B0|VATB_CLOB6 V-type ATP synthase beta chain OS=Clostridium botulinum (strain 657 / Type Ba4) GN=atpB PE=3 SV=1 18 484 0.0E+00
sp|B1ICC8|VATB_STRPI V-type ATP synthase beta chain OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=atpB PE=3 SV=1 18 478 0.0E+00
sp|A3CS72|VATB_METMJ V-type ATP synthase beta chain OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=atpB PE=3 SV=1 18 490 0.0E+00
sp|C1CES1|VATB_STRZJ V-type ATP synthase beta chain OS=Streptococcus pneumoniae (strain JJA) GN=atpB PE=3 SV=1 18 478 0.0E+00
sp|Q97QA9|VATB_STRPN V-type ATP synthase beta chain OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=atpB PE=3 SV=1 18 478 0.0E+00
sp|B8ZK30|VATB_STRPJ V-type ATP synthase beta chain OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=atpB PE=3 SV=1 18 478 0.0E+00
sp|B5E551|VATB_STRP4 V-type ATP synthase beta chain OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=atpB PE=3 SV=1 18 478 0.0E+00
sp|C1FTN6|VATB_CLOBJ V-type ATP synthase beta chain OS=Clostridium botulinum (strain Kyoto / Type A2) GN=atpB PE=3 SV=1 18 484 0.0E+00
sp|A6UP55|VATB_METVS V-type ATP synthase beta chain OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=atpB PE=3 SV=1 16 478 0.0E+00
sp|B2TP90|VATB_CLOBB V-type ATP synthase beta chain OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=atpB PE=3 SV=1 18 481 0.0E+00
sp|B2UWY3|VATB_CLOBA V-type ATP synthase beta chain OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=atpB PE=3 SV=1 18 481 0.0E+00
sp|Q97CP9|VATB_THEVO V-type ATP synthase beta chain OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=atpB PE=3 SV=1 13 470 0.0E+00
sp|B2IP44|VATB_STRPS V-type ATP synthase beta chain OS=Streptococcus pneumoniae (strain CGSP14) GN=atpB PE=3 SV=1 18 478 0.0E+00
sp|Q46FH4|VATB_METBF V-type ATP synthase beta chain OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=atpB PE=3 SV=1 18 487 0.0E+00
sp|Q3ITC7|VATB_NATPD V-type ATP synthase beta chain OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=atpB PE=3 SV=1 18 479 0.0E+00
sp|Q12WL0|VATB_METBU V-type ATP synthase beta chain OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=atpB PE=3 SV=1 18 487 0.0E+00
sp|B9LS42|VATB_HALLT V-type ATP synthase beta chain OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=atpB PE=3 SV=1 18 487 0.0E+00
sp|A9AAQ3|VATB_METM6 V-type ATP synthase beta chain OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=atpB PE=3 SV=1 16 478 0.0E+00
sp|Q0W362|VATB_METAR V-type ATP synthase beta chain OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=atpB PE=3 SV=1 18 484 0.0E+00
sp|A6VFZ3|VATB_METM7 V-type ATP synthase beta chain OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=atpB PE=3 SV=1 16 478 0.0E+00
sp|A4FXD3|VATB_METM5 V-type ATP synthase beta chain OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=atpB PE=3 SV=1 16 478 0.0E+00
sp|Q6LYE6|VATB_METMP V-type ATP synthase beta chain OS=Methanococcus maripaludis (strain S2 / LL) GN=atpB PE=3 SV=1 16 478 0.0E+00
sp|Q60187|VATB_METMA V-type ATP synthase beta chain OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=atpB PE=1 SV=2 18 487 0.0E+00
sp|Q8TIJ0|VATB_METAC V-type ATP synthase beta chain OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=atpB PE=3 SV=1 18 487 0.0E+00
sp|A2BKX5|VATB_HYPBU V-type ATP synthase beta chain OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=atpB PE=3 SV=1 18 484 0.0E+00
sp|Q9HNE4|VATB_HALSA V-type ATP synthase beta chain OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=atpB PE=1 SV=1 18 479 0.0E+00
sp|B0R754|VATB_HALS3 V-type ATP synthase beta chain OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=atpB PE=3 SV=1 18 479 0.0E+00
sp|B8GFQ7|VATB_METPE V-type ATP synthase beta chain OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=atpB PE=3 SV=1 18 493 0.0E+00
sp|B5Y8B6|VATB_COPPD V-type ATP synthase beta chain OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=atpB PE=3 SV=1 18 478 0.0E+00
sp|A7IAU7|VATB_METB6 V-type ATP synthase beta chain OS=Methanoregula boonei (strain 6A8) GN=atpB PE=3 SV=1 18 487 0.0E+00
sp|Q2FP51|VATB1_METHJ V-type ATP synthase beta chain 1 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=atpB1 PE=3 SV=1 18 487 0.0E+00
sp|A3DNQ5|VATB_STAMF V-type ATP synthase beta chain OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=atpB PE=3 SV=1 25 481 0.0E+00
sp|A8AAA9|VATB_IGNH4 V-type ATP synthase beta chain OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=atpB PE=3 SV=1 18 493 0.0E+00
sp|Q9HM64|VATB_THEAC V-type ATP synthase beta chain OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=atpB PE=3 SV=1 13 470 0.0E+00
sp|Q4J8L8|VATB_SULAC V-type ATP synthase beta chain OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=atpB PE=3 SV=2 18 489 0.0E+00
sp|Q6L1S8|VATB_PICTO V-type ATP synthase beta chain OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=atpB PE=3 SV=1 18 472 0.0E+00
sp|Q971B6|VATB_SULTO V-type ATP synthase beta chain OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=atpB PE=3 SV=1 18 489 3.0E-180
sp|A2SST6|VATB_METLZ V-type ATP synthase beta chain OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=atpB PE=3 SV=1 18 484 1.0E-179
sp|Q184E3|VATB_PEPD6 V-type ATP synthase beta chain OS=Peptoclostridium difficile (strain 630) GN=atpB PE=3 SV=1 18 470 6.0E-179
sp|Q9UWW8|VATB_SULSO V-type ATP synthase beta chain OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=atpB PE=3 SV=1 18 489 2.0E-178
sp|A3DHP1|VATB_CLOTH V-type ATP synthase beta chain OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=atpB PE=3 SV=1 18 485 5.0E-178
sp|Q9YF36|VATB_AERPE V-type ATP synthase beta chain OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=atpB PE=3 SV=2 18 481 5.0E-178
sp|Q891P2|VATB2_CLOTE V-type ATP synthase beta chain 2 OS=Clostridium tetani (strain Massachusetts / E88) GN=atpB2 PE=3 SV=1 15 480 6.0E-178
sp|C3NEU2|VATB_SULIY V-type ATP synthase beta chain OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=atpB PE=3 SV=1 18 479 1.0E-177
sp|C3NGV2|VATB_SULIN V-type ATP synthase beta chain OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=atpB PE=3 SV=1 18 479 1.0E-177
sp|C3MW92|VATB_SULIM V-type ATP synthase beta chain OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=atpB PE=3 SV=1 18 479 1.0E-177
sp|C3MQL4|VATB_SULIL V-type ATP synthase beta chain OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=atpB PE=3 SV=1 18 479 1.0E-177
sp|C4KHU9|VATB_SULIK V-type ATP synthase beta chain OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=atpB PE=3 SV=1 18 479 1.0E-177
sp|C3N6D4|VATB_SULIA V-type ATP synthase beta chain OS=Sulfolobus islandicus (strain M.16.27) GN=atpB PE=3 SV=1 18 479 1.0E-177
sp|A0B9K1|VATB_METTP V-type ATP synthase beta chain OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=atpB PE=3 SV=1 18 481 2.0E-176
sp|A4YI06|VATB_METS5 V-type ATP synthase beta chain OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=atpB PE=3 SV=1 18 479 2.0E-175
sp|B8CZG7|VATB_HALOH V-type ATP synthase beta chain OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=atpB PE=3 SV=1 18 486 3.0E-175
sp|Q56404|VATB_THET8 V-type ATP synthase beta chain OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=atpB PE=1 SV=2 18 479 2.0E-174
sp|Q72J73|VATB_THET2 V-type ATP synthase beta chain OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=atpB PE=3 SV=1 18 479 2.0E-174
sp|A9A2Q9|VATB_NITMS V-type ATP synthase beta chain OS=Nitrosopumilus maritimus (strain SCM1) GN=atpB PE=3 SV=1 16 480 8.0E-174
sp|C1CXU4|VATB_DEIDV V-type ATP synthase beta chain OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=atpB PE=3 SV=1 18 479 3.0E-172
sp|A0RXK0|VATB_CENSY V-type ATP synthase beta chain OS=Cenarchaeum symbiosum (strain A) GN=atpB PE=3 SV=1 16 480 5.0E-171
sp|A4WHI5|VATB_PYRAR V-type ATP synthase beta chain OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=atpB PE=3 SV=1 12 481 6.0E-171
sp|A1RTZ6|VATB_PYRIL V-type ATP synthase beta chain OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=atpB PE=3 SV=1 12 481 8.0E-171
sp|Q1IWP4|VATB_DEIGD V-type ATP synthase beta chain OS=Deinococcus geothermalis (strain DSM 11300) GN=atpB PE=3 SV=1 18 479 9.0E-171
sp|B1YAT5|VATB_PYRNV V-type ATP synthase beta chain OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=atpB PE=3 SV=1 12 481 3.0E-170
sp|A3MU07|VATB_PYRCJ V-type ATP synthase beta chain OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=atpB PE=3 SV=1 12 488 8.0E-170
sp|O83540|VATB2_TREPA V-type ATP synthase beta chain 2 OS=Treponema pallidum (strain Nichols) GN=atpB2 PE=3 SV=1 18 478 4.0E-169
sp|B9K814|VATB_THENN V-type ATP synthase beta chain OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=atpB PE=3 SV=1 18 480 4.0E-169
sp|Q9RWG7|VATB_DEIRA V-type ATP synthase beta chain OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=atpB PE=3 SV=1 18 479 2.0E-168
sp|A1RX20|VATB_THEPD V-type ATP synthase beta chain OS=Thermofilum pendens (strain Hrk 5) GN=atpB PE=3 SV=2 18 481 2.0E-163
sp|Q8ZXR2|VATB_PYRAE V-type ATP synthase beta chain OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=atpB PE=3 SV=1 12 481 2.0E-163
sp|Q3J9F4|VATB_NITOC V-type ATP synthase beta chain OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=atpB PE=3 SV=1 18 480 2.0E-158
sp|A7HDG8|VATB_ANADF V-type ATP synthase beta chain OS=Anaeromyxobacter sp. (strain Fw109-5) GN=atpB PE=3 SV=1 17 476 5.0E-153
sp|B8JE34|VATB_ANAD2 V-type ATP synthase beta chain OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=atpB PE=3 SV=1 23 475 5.0E-151
sp|Q2IQ94|VATB_ANADE V-type ATP synthase beta chain OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=atpB PE=3 SV=1 23 475 5.0E-151
sp|B4UH38|VATB_ANASK V-type ATP synthase beta chain OS=Anaeromyxobacter sp. (strain K) GN=atpB PE=3 SV=1 23 471 1.0E-149
sp|A5GCR3|VATB_GEOUR V-type ATP synthase beta chain OS=Geobacter uraniireducens (strain Rf4) GN=atpB PE=3 SV=1 18 462 6.0E-136
sp|P20022|VATB_METTL V-type ATP synthase beta chain (Fragment) OS=Methanothermococcus thermolithotrophicus GN=atpB PE=3 SV=1 77 341 3.0E-116
sp|Q8TUT0|VATB_METKA V-type ATP synthase beta chain OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=atpB PE=3 SV=1 18 281 5.0E-96
sp|Q8TUT0|VATB_METKA V-type ATP synthase beta chain OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=atpB PE=3 SV=1 267 479 3.0E-85
sp|A1QYP2|VATB_BORT9 V-type ATP synthase beta chain OS=Borrelia turicatae (strain 91E135) GN=atpB PE=3 SV=1 29 459 2.0E-77
sp|B2S1S7|VATB_BORHD V-type ATP synthase beta chain OS=Borrelia hermsii (strain HS1 / DAH) GN=atpB PE=3 SV=1 29 459 2.0E-77
sp|Q662R9|VATB_BORBP V-type ATP synthase beta chain OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=atpB PE=3 SV=1 38 459 3.0E-75
sp|Q6MAJ6|VATB_PARUW V-type ATP synthase beta chain OS=Protochlamydia amoebophila (strain UWE25) GN=atpB PE=3 SV=1 15 459 4.0E-75
sp|Q9Z992|VATB_CHLPN V-type ATP synthase beta chain OS=Chlamydia pneumoniae GN=atpB PE=3 SV=1 18 482 4.0E-75
sp|B7J126|VATB_BORBZ V-type ATP synthase beta chain OS=Borrelia burgdorferi (strain ZS7) GN=atpB PE=3 SV=1 38 459 9.0E-75
sp|O51120|VATB_BORBU V-type ATP synthase beta chain OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=atpB PE=3 SV=1 38 459 9.0E-75
sp|O84309|VATB_CHLTR V-type ATP synthase beta chain OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=atpB PE=3 SV=1 18 459 4.0E-74
sp|Q0SP71|VATB_BORAP V-type ATP synthase beta chain OS=Borrelia afzelii (strain PKo) GN=atpB PE=3 SV=1 38 459 4.0E-74
sp|Q3KM55|VATB_CHLTA V-type ATP synthase beta chain OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=atpB PE=3 SV=1 18 459 4.0E-74
sp|Q9PK86|VATB_CHLMU V-type ATP synthase beta chain OS=Chlamydia muridarum (strain MoPn / Nigg) GN=atpB PE=3 SV=1 18 459 2.0E-73
sp|B0BBT8|VATB_CHLTB V-type ATP synthase beta chain OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=atpB PE=3 SV=1 18 459 5.0E-73
sp|B0B7M3|VATB_CHLT2 V-type ATP synthase beta chain OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=atpB PE=3 SV=1 18 459 5.0E-73
sp|Q822J9|VATB_CHLCV V-type ATP synthase beta chain OS=Chlamydophila caviae (strain GPIC) GN=atpB PE=3 SV=1 18 459 2.0E-72
sp|O83442|VATB1_TREPA V-type ATP synthase beta chain 1 OS=Treponema pallidum (strain Nichols) GN=atpB1 PE=3 SV=1 18 459 2.0E-72
sp|Q255D8|VATB_CHLFF V-type ATP synthase beta chain OS=Chlamydophila felis (strain Fe/C-56) GN=atpB PE=3 SV=1 18 459 5.0E-72
sp|Q73M29|VATB_TREDE V-type ATP synthase beta chain OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=atpB PE=3 SV=1 18 459 8.0E-72
sp|Q5L5J1|VATB_CHLAB V-type ATP synthase beta chain OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=atpB PE=3 SV=1 18 459 9.0E-72
sp|P52607|FLII_BORBU Flagellum-specific ATP synthase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=fliI PE=3 SV=1 49 375 6.0E-36
sp|Q9I4N1|FLII_PSEAE Flagellum-specific ATP synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fliI PE=3 SV=1 90 459 8.0E-35
sp|Q79VG7|ATPA_CORGL ATP synthase subunit alpha OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=atpA PE=3 SV=1 45 428 3.0E-33
sp|A4QDH1|ATPA_CORGB ATP synthase subunit alpha OS=Corynebacterium glutamicum (strain R) GN=atpA PE=3 SV=1 45 428 5.0E-33
sp|Q0AKV8|ATPA_MARMM ATP synthase subunit alpha OS=Maricaulis maris (strain MCS10) GN=atpA PE=3 SV=1 55 479 6.0E-33
sp|Q8FQ22|ATPA_COREF ATP synthase subunit alpha OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=atpA PE=3 SV=2 82 428 7.0E-33
sp|P40291|YSCN_YERPS Probable ATP synthase YscN OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=yscN PE=1 SV=2 81 458 7.0E-33
sp|P40290|YSCN_YEREN Probable ATP synthase YscN OS=Yersinia enterocolitica GN=yscN PE=1 SV=1 81 458 8.0E-33
sp|A1XFU0|ATPA_NUPAD ATP synthase subunit alpha, chloroplastic OS=Nuphar advena GN=atpA PE=3 SV=1 81 402 1.0E-32
sp|P57178|FLII_BUCAI Flagellum-specific ATP synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fliI PE=3 SV=1 91 440 2.0E-32
sp|A4XAW4|ATPA_SALTO ATP synthase subunit alpha OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=atpA PE=3 SV=1 5 457 2.0E-32
sp|Q6EW63|ATPA_NYMAL ATP synthase subunit alpha, chloroplastic OS=Nymphaea alba GN=atpA PE=3 SV=1 81 380 4.0E-32
sp|B7K5I8|ATPA_CYAP8 ATP synthase subunit alpha OS=Cyanothece sp. (strain PCC 8801) GN=atpA PE=3 SV=1 69 506 4.0E-32
sp|A6Q4C0|ATPB_NITSB ATP synthase subunit beta OS=Nitratiruptor sp. (strain SB155-2) GN=atpD PE=3 SV=1 24 440 5.0E-32
sp|Q4JUJ8|ATPA_CORJK ATP synthase subunit alpha OS=Corynebacterium jeikeium (strain K411) GN=atpA PE=3 SV=1 82 412 5.0E-32
sp|P23445|FLII_BACSU Flagellum-specific ATP synthase OS=Bacillus subtilis (strain 168) GN=fliI PE=3 SV=2 83 458 7.0E-32
sp|Q6YXK3|ATPA_PHYPA ATP synthase subunit alpha, chloroplastic OS=Physcomitrella patens subsp. patens GN=atpA PE=3 SV=1 81 380 8.0E-32
sp|A1EA05|ATPA_AGRST ATP synthase subunit alpha, chloroplastic OS=Agrostis stolonifera GN=atpA PE=3 SV=1 83 406 1.0E-31
sp|A8Y9G7|ATPA_LOLPR ATP synthase subunit alpha, chloroplastic OS=Lolium perenne GN=atpA PE=3 SV=1 83 406 1.0E-31
sp|A1XGM3|ATPA_RANMC ATP synthase subunit alpha, chloroplastic OS=Ranunculus macranthus GN=atpA PE=3 SV=1 81 380 2.0E-31
sp|Q1KXW5|ATPA_HELAN ATP synthase subunit alpha, chloroplastic OS=Helianthus annuus GN=atpA PE=3 SV=1 81 380 2.0E-31
sp|A0ZZ20|ATPA_GOSBA ATP synthase subunit alpha, chloroplastic OS=Gossypium barbadense GN=atpA PE=3 SV=1 81 380 2.0E-31
sp|P12405|ATPA_NOSS1 ATP synthase subunit alpha OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=atpA PE=3 SV=2 81 387 2.0E-31
sp|B8I579|ATPB_CLOCE ATP synthase subunit beta OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=atpD PE=3 SV=1 24 440 2.0E-31
sp|Q3M9W0|ATPA_ANAVT ATP synthase subunit alpha OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=atpA PE=3 SV=2 81 387 3.0E-31
sp|Q98EV6|ATPA_RHILO ATP synthase subunit alpha OS=Rhizobium loti (strain MAFF303099) GN=atpA PE=3 SV=1 55 506 3.0E-31
sp|A8W3A9|ATPA_CUSEX ATP synthase subunit alpha, plastid OS=Cuscuta exaltata GN=atpA PE=3 SV=1 75 387 4.0E-31
sp|Q5Z0Y3|ATPA_NOCFA ATP synthase subunit alpha OS=Nocardia farcinica (strain IFM 10152) GN=atpA PE=3 SV=1 82 387 4.0E-31
sp|Q32RS8|ATPA_STAPU ATP synthase subunit alpha, chloroplastic OS=Staurastrum punctulatum GN=atpA PE=3 SV=1 75 380 5.0E-31
sp|A8M2J5|ATPA_SALAI ATP synthase subunit alpha OS=Salinispora arenicola (strain CNS-205) GN=atpA PE=3 SV=1 5 457 6.0E-31
sp|C1AW01|ATPA_RHOOB ATP synthase subunit alpha OS=Rhodococcus opacus (strain B4) GN=atpA PE=3 SV=1 82 428 7.0E-31
sp|Q85FN4|ATPA_ADICA ATP synthase subunit alpha, chloroplastic OS=Adiantum capillus-veneris GN=atpA PE=2 SV=2 83 380 7.0E-31
sp|B1W0A5|ATPA_STRGG ATP synthase subunit alpha OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=atpA PE=3 SV=1 74 495 8.0E-31
sp|Q8S8Y3|ATPA_ATRBE ATP synthase subunit alpha, chloroplastic OS=Atropa belladonna GN=atpA PE=3 SV=1 81 380 8.0E-31
sp|C3PFR3|ATPA_CORA7 ATP synthase subunit alpha OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=atpA PE=3 SV=1 82 412 9.0E-31
sp|A7M951|ATPA_CUSRE ATP synthase subunit alpha, plastid OS=Cuscuta reflexa GN=atpA PE=3 SV=1 75 387 1.0E-30
sp|C1A1Y0|ATPA_RHOE4 ATP synthase subunit alpha OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=atpA PE=3 SV=1 82 428 1.0E-30
sp|Q68S21|ATPA_PANGI ATP synthase subunit alpha, chloroplastic OS=Panax ginseng GN=atpA PE=3 SV=1 81 380 1.0E-30
sp|Q6F202|ATPB_MESFL ATP synthase subunit beta OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=atpD PE=3 SV=1 19 443 1.0E-30
sp|A5CD07|ATPA_ORITB ATP synthase subunit alpha OS=Orientia tsutsugamushi (strain Boryong) GN=atpA PE=3 SV=1 66 401 1.0E-30
sp|Q85AU2|ATPA_ANTFO ATP synthase subunit alpha, chloroplastic OS=Anthoceros formosae GN=atpA PE=2 SV=1 75 387 1.0E-30
sp|Q3V549|ATPA_ACOCL ATP synthase subunit alpha, chloroplastic OS=Acorus calamus GN=atpA PE=3 SV=1 81 402 1.0E-30
sp|A9LYH0|ATPA_ACOAM ATP synthase subunit alpha, chloroplastic OS=Acorus americanus GN=atpA PE=3 SV=1 81 402 1.0E-30
sp|Q27S65|ATPA_SOLTU ATP synthase subunit alpha, chloroplastic OS=Solanum tuberosum GN=atpA PE=3 SV=1 81 380 1.0E-30
sp|Q2MIB5|ATPA_SOLLC ATP synthase subunit alpha, chloroplastic OS=Solanum lycopersicum GN=atpA PE=3 SV=1 81 380 1.0E-30
sp|Q2MIK2|ATPA_SOLBU ATP synthase subunit alpha, chloroplastic OS=Solanum bulbocastanum GN=atpA PE=3 SV=1 81 380 1.0E-30
sp|A7HT50|ATPA_PARL1 ATP synthase subunit alpha OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=atpA PE=3 SV=1 55 480 1.0E-30
sp|Q4FP36|ATPA_PELUB ATP synthase subunit alpha OS=Pelagibacter ubique (strain HTCC1062) GN=atpA PE=3 SV=1 83 489 1.0E-30
sp|B2J058|ATPA_NOSP7 ATP synthase subunit alpha OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=atpA PE=3 SV=1 75 480 2.0E-30
sp|Q3BAQ7|ATPA_PHAAO ATP synthase subunit alpha, chloroplastic OS=Phalaenopsis aphrodite subsp. formosana GN=atpA PE=3 SV=1 75 402 2.0E-30
sp|Q6MS94|ATPB_MYCMS ATP synthase subunit beta OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=atpD PE=3 SV=1 75 443 2.0E-30
sp|B1NWD5|ATPA_MANES ATP synthase subunit alpha, chloroplastic OS=Manihot esculenta GN=atpA PE=3 SV=1 81 380 2.0E-30
sp|Q85X67|ATPA_PINKO ATP synthase subunit alpha, chloroplastic OS=Pinus koraiensis GN=atpA PE=3 SV=1 43 387 2.0E-30
sp|Q5HX59|ATPB_CAMJR ATP synthase subunit beta OS=Campylobacter jejuni (strain RM1221) GN=atpD PE=3 SV=1 24 440 2.0E-30
sp|A1VXJ0|ATPB_CAMJJ ATP synthase subunit beta OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=atpD PE=3 SV=1 24 440 2.0E-30
sp|Q0PC30|ATPB_CAMJE ATP synthase subunit beta OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=atpD PE=3 SV=1 24 440 2.0E-30
sp|A8FJR2|ATPB_CAMJ8 ATP synthase subunit beta OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=atpD PE=3 SV=1 24 440 2.0E-30
sp|Q0SGP7|ATPA_RHOJR ATP synthase subunit alpha OS=Rhodococcus jostii (strain RHA1) GN=atpA PE=3 SV=1 82 428 3.0E-30
sp|P12112|ATPA_WHEAT ATP synthase subunit alpha, chloroplastic OS=Triticum aestivum GN=atpA PE=3 SV=2 83 402 3.0E-30
sp|P41602|ATPA_PINTH ATP synthase subunit alpha, chloroplastic OS=Pinus thunbergii GN=atpA PE=3 SV=1 43 387 3.0E-30
sp|A1E9I8|ATPA_HORVU ATP synthase subunit alpha, chloroplastic OS=Hordeum vulgare GN=atpA PE=3 SV=1 83 402 3.0E-30
sp|Q9TM26|ATPA_CYACA ATP synthase subunit alpha, chloroplastic OS=Cyanidium caldarium GN=atpA PE=3 SV=1 69 508 3.0E-30
sp|B0BZL2|ATPA1_ACAM1 ATP synthase subunit alpha 1 OS=Acaryochloris marina (strain MBIC 11017) GN=atpA1 PE=3 SV=1 81 506 3.0E-30
sp|Q2L8Z1|ATPA_GOSHI ATP synthase subunit alpha, chloroplastic OS=Gossypium hirsutum GN=atpA PE=3 SV=1 81 380 4.0E-30
sp|A1E9S1|ATPA_SORBI ATP synthase subunit alpha, chloroplastic OS=Sorghum bicolor GN=atpA PE=3 SV=1 83 402 4.0E-30
sp|Q6ENW6|ATPA_SACOF ATP synthase subunit alpha, chloroplastic OS=Saccharum officinarum GN=atpA PE=3 SV=1 83 402 4.0E-30
sp|P06450|ATPA_SPIOL ATP synthase subunit alpha, chloroplastic OS=Spinacia oleracea GN=atpA PE=1 SV=1 81 387 4.0E-30
sp|A7H1I1|ATPB_CAMJD ATP synthase subunit beta OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=atpD PE=3 SV=1 24 440 4.0E-30
sp|P0C2Z6|ATPA_ORYSJ ATP synthase subunit alpha, chloroplastic OS=Oryza sativa subsp. japonica GN=atpA PE=3 SV=1 83 402 5.0E-30
sp|P0C2Z5|ATPA_ORYSI ATP synthase subunit alpha, chloroplastic OS=Oryza sativa subsp. indica GN=atpA PE=3 SV=1 83 402 5.0E-30
sp|P0C2Z4|ATPA_ORYSA ATP synthase subunit alpha, chloroplastic OS=Oryza sativa GN=atpA PE=3 SV=1 83 402 5.0E-30
sp|Q6ENH7|ATPA_ORYNI ATP synthase subunit alpha, chloroplastic OS=Oryza nivara GN=atpA PE=3 SV=1 83 402 5.0E-30
sp|A4QJI4|ATPA_AETGR ATP synthase subunit alpha, chloroplastic OS=Aethionema grandiflorum GN=atpA PE=3 SV=1 81 380 5.0E-30
sp|A4QKR6|ATPA_CRUWA ATP synthase subunit alpha, chloroplastic OS=Crucihimalaya wallichii GN=atpA PE=3 SV=1 81 380 6.0E-30
sp|P06283|ATPA_MARPO ATP synthase subunit alpha, chloroplastic OS=Marchantia polymorpha GN=atpA PE=3 SV=1 43 380 6.0E-30
sp|P56757|ATPA_ARATH ATP synthase subunit alpha, chloroplastic OS=Arabidopsis thaliana GN=atpA PE=1 SV=1 81 380 7.0E-30
sp|A4QK03|ATPA_ARAHI ATP synthase subunit alpha, chloroplastic OS=Arabis hirsuta GN=atpA PE=3 SV=1 81 380 7.0E-30
sp|B2G691|ATPB_LACRJ ATP synthase subunit beta OS=Lactobacillus reuteri (strain JCM 1112) GN=atpD PE=3 SV=1 24 424 7.0E-30
sp|A5VIR1|ATPB_LACRD ATP synthase subunit beta OS=Lactobacillus reuteri (strain DSM 20016) GN=atpD PE=3 SV=1 24 424 7.0E-30
sp|A4QJA0|ATPA_AETCO ATP synthase subunit alpha, chloroplastic OS=Aethionema cordifolium GN=atpA PE=3 SV=1 81 380 7.0E-30
sp|A4QL04|ATPA_DRANE ATP synthase subunit alpha, chloroplastic OS=Draba nemorosa GN=atpA PE=3 SV=1 81 380 7.0E-30
sp|A4QL91|ATPA_LEPVR ATP synthase subunit alpha, chloroplastic OS=Lepidium virginicum GN=atpA PE=3 SV=1 81 380 7.0E-30
sp|Q2PMS8|ATPA_SOYBN ATP synthase subunit alpha, chloroplastic OS=Glycine max GN=atpA PE=3 SV=1 81 380 8.0E-30
sp|A4GGB2|ATPA_PHAVU ATP synthase subunit alpha, chloroplastic OS=Phaseolus vulgaris GN=atpA PE=3 SV=1 81 380 8.0E-30
sp|A8SE59|ATPA_CERDE ATP synthase subunit alpha, chloroplastic OS=Ceratophyllum demersum GN=atpA PE=3 SV=1 81 402 8.0E-30
sp|C3M9S3|ATPA_RHISN ATP synthase subunit alpha OS=Rhizobium sp. (strain NGR234) GN=atpA PE=3 SV=1 55 507 8.0E-30
sp|Q6L3A1|ATPA_SACHY ATP synthase subunit alpha, chloroplastic OS=Saccharum hybrid GN=atpA PE=2 SV=2 83 380 8.0E-30
sp|Q2GER5|ATPA_NEOSM ATP synthase subunit alpha OS=Neorickettsia sennetsu (strain Miyayama) GN=atpA PE=3 SV=1 31 380 8.0E-30
sp|Q32RL1|ATPA_ZYGCR ATP synthase subunit alpha, chloroplastic OS=Zygnema circumcarinatum GN=atpA PE=3 SV=1 51 380 9.0E-30
sp|Q6NHT1|ATPA_CORDI ATP synthase subunit alpha OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=atpA PE=3 SV=1 82 410 9.0E-30
sp|A4QKH7|ATPA_CAPBU ATP synthase subunit alpha, chloroplastic OS=Capsella bursa-pastoris GN=atpA PE=3 SV=1 81 380 9.0E-30
sp|A9W2R3|ATPA_METEP ATP synthase subunit alpha OS=Methylobacterium extorquens (strain PA1) GN=atpA PE=3 SV=1 55 410 9.0E-30
sp|B7KUA4|ATPA_METC4 ATP synthase subunit alpha OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=atpA PE=3 SV=1 55 410 9.0E-30
sp|Q47M80|ATPA_THEFY ATP synthase subunit alpha OS=Thermobifida fusca (strain YX) GN=atpA PE=3 SV=1 45 457 1.0E-29
sp|B5YBQ0|ATPA_DICT6 ATP synthase subunit alpha OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=atpA PE=3 SV=1 55 452 1.0E-29
sp|Q5GSX1|ATPA_WOLTR ATP synthase subunit alpha OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=atpA PE=3 SV=1 38 478 1.0E-29
sp|Q07UZ3|ATPA_RHOP5 ATP synthase subunit alpha OS=Rhodopseudomonas palustris (strain BisA53) GN=atpA PE=3 SV=1 94 410 1.0E-29
sp|Q8WI30|ATPA_PSINU ATP synthase subunit alpha, chloroplastic OS=Psilotum nudum GN=atpA PE=3 SV=1 83 380 1.0E-29
sp|A4QLR8|ATPA_NASOF ATP synthase subunit alpha, chloroplastic OS=Nasturtium officinale GN=atpA PE=3 SV=1 81 380 1.0E-29
sp|Q3C1H4|ATPA_NICSY ATP synthase subunit alpha, chloroplastic OS=Nicotiana sylvestris GN=atpA PE=3 SV=1 81 380 1.0E-29
sp|Q33C53|ATPA_NICTO ATP synthase subunit alpha, chloroplastic OS=Nicotiana tomentosiformis GN=atpA PE=3 SV=1 81 380 1.0E-29
sp|Q6NDD0|ATPA_RHOPA ATP synthase subunit alpha OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=atpA PE=3 SV=1 94 472 1.0E-29
sp|A6MMS9|ATPA_ILLOL ATP synthase subunit alpha, chloroplastic OS=Illicium oligandrum GN=atpA PE=3 SV=1 81 402 1.0E-29
sp|B1VFY5|ATPA_CORU7 ATP synthase subunit alpha OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=atpA PE=3 SV=1 82 456 1.0E-29
sp|A4QK90|ATPA_BARVE ATP synthase subunit alpha, chloroplastic OS=Barbarea verna GN=atpA PE=3 SV=1 81 380 2.0E-29
sp|A8W3H5|ATPA_CUSOB ATP synthase subunit alpha, plastid OS=Cuscuta obtusiflora GN=atpA PE=3 SV=1 83 380 2.0E-29
sp|A7HIX9|ATPA_ANADF ATP synthase subunit alpha OS=Anaeromyxobacter sp. (strain Fw109-5) GN=atpA PE=3 SV=1 83 443 2.0E-29
sp|B8EQP9|ATPA_METSB ATP synthase subunit alpha OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=atpA PE=3 SV=1 77 410 2.0E-29
sp|Q83G89|ATPA_TROWT ATP synthase subunit alpha OS=Tropheryma whipplei (strain Twist) GN=atpA PE=3 SV=2 55 376 2.0E-29
sp|Q83HY2|ATPA_TROW8 ATP synthase subunit alpha OS=Tropheryma whipplei (strain TW08/27) GN=atpA PE=3 SV=1 55 376 2.0E-29
sp|Q70XV0|ATPA_AMBTC ATP synthase subunit alpha, chloroplastic OS=Amborella trichopoda GN=atpA PE=3 SV=1 81 402 2.0E-29
sp|B3CN53|ATPA_WOLPP ATP synthase subunit alpha OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=atpA PE=3 SV=1 83 478 2.0E-29
sp|A4QJR8|ATPA_OLIPU ATP synthase subunit alpha, chloroplastic OS=Olimarabidopsis pumila GN=atpA PE=3 SV=1 81 380 2.0E-29
sp|Q06RE6|ATPA_JASNU ATP synthase subunit alpha, chloroplastic OS=Jasminum nudiflorum GN=atpA PE=3 SV=1 81 385 2.0E-29
sp|Q332Y4|ATPA_LACSA ATP synthase subunit alpha, chloroplastic OS=Lactuca sativa GN=atpA PE=3 SV=1 81 380 2.0E-29
sp|Q2J6N1|ATPA_FRASC ATP synthase subunit alpha OS=Frankia sp. (strain CcI3) GN=atpA PE=3 SV=1 82 439 2.0E-29
sp|Q19VA5|ATPA_CHLAT ATP synthase subunit alpha, chloroplastic OS=Chlorokybus atmophyticus GN=atpA PE=3 SV=2 81 387 2.0E-29
sp|Q9BBS3|ATPA_LOTJA ATP synthase subunit alpha, chloroplastic OS=Lotus japonicus GN=atpA PE=3 SV=1 81 380 2.0E-29
sp|Q06SI2|ATPA_STIHE ATP synthase subunit alpha, chloroplastic OS=Stigeoclonium helveticum GN=atpA PE=3 SV=1 45 387 2.0E-29
sp|Q8MA05|ATPA_CHAGL ATP synthase subunit alpha, chloroplastic OS=Chaetosphaeridium globosum GN=atpA PE=3 SV=1 75 380 2.0E-29
sp|A4QLH9|ATPA_LOBMA ATP synthase subunit alpha, chloroplastic OS=Lobularia maritima GN=atpA PE=3 SV=1 81 380 2.0E-29
sp|P00823|ATPA_TOBAC ATP synthase subunit alpha, chloroplastic OS=Nicotiana tabacum GN=atpA PE=2 SV=2 81 380 2.0E-29
sp|B9KPI6|ATPA_RHOSK ATP synthase subunit alpha OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=atpA PE=3 SV=1 98 506 3.0E-29
sp|Q3J433|ATPA_RHOS4 ATP synthase subunit alpha OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=atpA PE=3 SV=1 98 506 3.0E-29
sp|A3PIB7|ATPA1_RHOS1 ATP synthase subunit alpha 1 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=atpA1 PE=3 SV=1 98 506 3.0E-29
sp|Q5LNN9|ATPA_RUEPO ATP synthase subunit alpha OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=atpA PE=3 SV=1 55 386 3.0E-29
sp|Q2RFX7|ATPA_MOOTA ATP synthase subunit alpha OS=Moorella thermoacetica (strain ATCC 39073) GN=atpA PE=1 SV=1 82 467 3.0E-29
sp|B1ZEE9|ATPA_METPB ATP synthase subunit alpha OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=atpA PE=3 SV=1 55 478 3.0E-29
sp|Q06FX6|ATPA_PELHO ATP synthase subunit alpha, chloroplastic OS=Pelargonium hortorum GN=atpA PE=3 SV=1 81 406 3.0E-29
sp|A4WUM9|ATPA_RHOS5 ATP synthase subunit alpha OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=atpA PE=3 SV=1 98 506 3.0E-29
sp|A7M8Y9|ATPA_CUSGR ATP synthase subunit alpha, plastid OS=Cuscuta gronovii GN=atpA PE=3 SV=1 83 380 3.0E-29
sp|A7H017|ATPB_CAMC5 ATP synthase subunit beta OS=Campylobacter curvus (strain 525.92) GN=atpD PE=3 SV=1 24 440 3.0E-29
sp|B7KKR4|ATPA_CYAP7 ATP synthase subunit alpha OS=Cyanothece sp. (strain PCC 7424) GN=atpA PE=3 SV=1 81 506 3.0E-29
sp|A6VWP9|ATPB1_MARMS ATP synthase subunit beta 1 OS=Marinomonas sp. (strain MWYL1) GN=atpD1 PE=3 SV=1 73 495 4.0E-29
sp|Q112Z6|ATPA_TRIEI ATP synthase subunit alpha OS=Trichodesmium erythraeum (strain IMS101) GN=atpA PE=3 SV=1 81 380 4.0E-29
sp|B3CSS9|ATPA_ORITI ATP synthase subunit alpha OS=Orientia tsutsugamushi (strain Ikeda) GN=atpA PE=3 SV=1 81 401 4.0E-29
sp|Q24MN9|ATPA_DESHY ATP synthase subunit alpha OS=Desulfitobacterium hafniense (strain Y51) GN=atpA PE=3 SV=1 82 501 4.0E-29
sp|A6MMA7|ATPA_CHLSC ATP synthase subunit alpha, chloroplastic OS=Chloranthus spicatus GN=atpA PE=3 SV=1 81 402 4.0E-29
sp|Q0G9X7|ATPA_DAUCA ATP synthase subunit alpha, chloroplastic OS=Daucus carota GN=atpA PE=3 SV=1 81 380 4.0E-29
sp|Q7YJY4|ATPA_CALFG ATP synthase subunit alpha, chloroplastic OS=Calycanthus floridus var. glaucus GN=atpA PE=3 SV=1 81 402 4.0E-29
sp|Q3B406|ATPB2_CHLL7 ATP synthase subunit beta 2 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=atpD2 PE=3 SV=1 17 440 4.0E-29
sp|B8IN03|ATPA_METNO ATP synthase subunit alpha OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=atpA PE=3 SV=1 77 410 4.0E-29
sp|P27179|ATPA_SYNY3 ATP synthase subunit alpha OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=atpA PE=3 SV=1 81 506 4.0E-29
sp|Q49L13|ATPA_EUCGG ATP synthase subunit alpha, chloroplastic OS=Eucalyptus globulus subsp. globulus GN=atpA PE=3 SV=1 81 380 5.0E-29
sp|A7ZC37|ATPB_CAMC1 ATP synthase subunit beta OS=Campylobacter concisus (strain 13826) GN=atpD PE=3 SV=1 24 440 5.0E-29
sp|B9KES3|ATPB_CAMLR ATP synthase subunit beta OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=atpD PE=3 SV=1 24 440 5.0E-29
sp|B8DYT0|ATPB_DICTD ATP synthase subunit beta OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=atpD PE=3 SV=1 23 440 5.0E-29
sp|A6MMJ2|ATPA_DIOEL ATP synthase subunit alpha, chloroplastic OS=Dioscorea elephantipes GN=atpA PE=3 SV=1 81 380 5.0E-29
sp|B0Z4W6|ATPA_OENBI ATP synthase subunit alpha, chloroplastic OS=Oenothera biennis GN=atpA PE=3 SV=1 81 380 5.0E-29
sp|Q73HB2|ATPA_WOLPM ATP synthase subunit alpha OS=Wolbachia pipientis wMel GN=atpA PE=3 SV=1 83 478 6.0E-29
sp|C0R2Y2|ATPA_WOLWR ATP synthase subunit alpha OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=atpA PE=3 SV=1 77 478 6.0E-29
sp|Q0RDB2|ATPA_FRAAA ATP synthase subunit alpha OS=Frankia alni (strain ACN14a) GN=atpA PE=3 SV=1 82 439 6.0E-29
sp|Q2ST34|ATPB_MYCCT ATP synthase subunit beta OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=atpD PE=3 SV=1 24 443 6.0E-29
sp|A6BM08|ATPA_GNEPA ATP synthase subunit alpha, chloroplastic OS=Gnetum parvifolium GN=atpA PE=3 SV=1 75 380 6.0E-29
sp|A6MVW4|ATPA_RHDSA ATP synthase subunit alpha, chloroplastic OS=Rhodomonas salina GN=atpA PE=3 SV=1 40 380 7.0E-29
sp|Q589B3|ATPA_SILLA ATP synthase subunit alpha, chloroplastic OS=Silene latifolia GN=atpA PE=3 SV=1 81 380 7.0E-29
sp|Q1WUC6|ATPB_LACS1 ATP synthase subunit beta OS=Lactobacillus salivarius (strain UCC118) GN=atpD PE=3 SV=1 24 425 7.0E-29
sp|Q9MTL7|ATPA_OENEH ATP synthase subunit alpha, chloroplastic OS=Oenothera elata subsp. hookeri GN=atpA PE=3 SV=2 81 380 8.0E-29
sp|B0Z5D4|ATPA_OENPA ATP synthase subunit alpha, chloroplastic OS=Oenothera parviflora GN=atpA PE=3 SV=1 81 380 8.0E-29
sp|B0Z4N2|ATPA_OENAR ATP synthase subunit alpha, chloroplastic OS=Oenothera argillicola GN=atpA PE=3 SV=1 81 380 8.0E-29
sp|Q9MUT2|ATPA_MESVI ATP synthase subunit alpha, chloroplastic OS=Mesostigma viride GN=atpA PE=3 SV=1 81 380 8.0E-29
sp|B0Z550|ATPA_OENGL ATP synthase subunit alpha, chloroplastic OS=Oenothera glazioviana GN=atpA PE=3 SV=1 81 380 9.0E-29
sp|P08215|ATPA_PEA ATP synthase subunit alpha, chloroplastic OS=Pisum sativum GN=atpA PE=3 SV=1 81 380 9.0E-29
sp|Q1IIG6|ATPA_KORVE ATP synthase subunit alpha OS=Koribacter versatilis (strain Ellin345) GN=atpA PE=3 SV=1 75 387 9.0E-29
sp|A1WZT1|ATPB_HALHL ATP synthase subunit beta OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=atpD PE=3 SV=1 33 440 9.0E-29
sp|B3QUP6|ATPB_CHLT3 ATP synthase subunit beta OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=atpD PE=3 SV=1 26 440 9.0E-29
sp|P05022|ATPA_MAIZE ATP synthase subunit alpha, chloroplastic OS=Zea mays GN=atpA PE=1 SV=1 83 402 9.0E-29
sp|A2T317|ATPA_ANGEV ATP synthase subunit alpha, chloroplastic OS=Angiopteris evecta GN=atpA PE=3 SV=1 43 380 9.0E-29
sp|Q8KA42|FLII_BUCAP Flagellum-specific ATP synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fliI PE=3 SV=1 18 412 1.0E-28
sp|Q1GQS7|ATPA_SPHAL ATP synthase subunit alpha OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=atpA PE=3 SV=1 55 387 1.0E-28
sp|Q3AHK5|ATPA_SYNSC ATP synthase subunit alpha OS=Synechococcus sp. (strain CC9605) GN=atpA PE=3 SV=1 32 380 1.0E-28
sp|Q8KDL4|ATPB1_CHLTE ATP synthase subunit beta 1 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=atpD1 PE=3 SV=1 78 437 1.0E-28
sp|A4GYP3|ATPA_POPTR ATP synthase subunit alpha, chloroplastic OS=Populus trichocarpa GN=atpA PE=3 SV=1 81 380 1.0E-28
sp|Q14FH2|ATPA_POPAL ATP synthase subunit alpha, chloroplastic OS=Populus alba GN=atpA PE=3 SV=1 81 380 1.0E-28
sp|Q0G9N4|ATPA_LIRTU ATP synthase subunit alpha, chloroplastic OS=Liriodendron tulipifera GN=atpA PE=3 SV=1 81 402 1.0E-28
sp|O78475|ATPA_GUITH ATP synthase subunit alpha, chloroplastic OS=Guillardia theta GN=atpA PE=3 SV=1 51 380 1.0E-28
sp|Q1QQS5|ATPA_NITHX ATP synthase subunit alpha OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=atpA PE=3 SV=1 94 457 1.0E-28
sp|A6MM21|ATPA_BUXMI ATP synthase subunit alpha, chloroplastic OS=Buxus microphylla GN=atpA PE=3 SV=1 81 402 1.0E-28
sp|B2Y1W2|ATPA_WELMI ATP synthase subunit alpha, chloroplastic OS=Welwitschia mirabilis GN=atpA PE=3 SV=1 75 380 1.0E-28
sp|Q09X32|ATPA_MORIN ATP synthase subunit alpha, chloroplastic OS=Morus indica GN=atpA PE=3 SV=1 81 380 1.0E-28
sp|Q09MJ3|ATPA_CITSI ATP synthase subunit alpha, chloroplastic OS=Citrus sinensis GN=atpA PE=3 SV=1 81 380 1.0E-28
sp|B8FZ36|ATPA_DESHD ATP synthase subunit alpha OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=atpA PE=3 SV=1 82 501 1.0E-28
sp|Q1GEU6|ATPA_RUEST ATP synthase subunit alpha OS=Ruegeria sp. (strain TM1040) GN=atpA PE=3 SV=1 55 386 1.0E-28
sp|P35009|ATPA_GALSU ATP synthase subunit alpha, chloroplastic OS=Galdieria sulphuraria GN=atpA PE=3 SV=1 83 380 2.0E-28
sp|Q2IHQ9|ATPA_ANADE ATP synthase subunit alpha OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=atpA PE=3 SV=1 83 443 2.0E-28
sp|Q06H12|ATPA_DRIGR ATP synthase subunit alpha, chloroplastic OS=Drimys granadensis GN=atpA PE=3 SV=1 81 402 2.0E-28
sp|A0T0F1|ATPA_PHATC ATP synthase subunit alpha, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=atpA PE=3 SV=1 69 387 2.0E-28
sp|Q40611|ATPA_OCHNE ATP synthase subunit alpha, chloroplastic (Fragment) OS=Ochrosphaera neapolitana GN=atpA PE=3 SV=1 75 387 2.0E-28
sp|Q50331|ATPB_MYCPN ATP synthase subunit beta OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=atpD PE=3 SV=1 16 440 2.0E-28
sp|A6WXW9|ATPA_OCHA4 ATP synthase subunit alpha OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=atpA PE=3 SV=1 55 387 2.0E-28
sp|Q2JIV9|ATPB_SYNJB ATP synthase subunit beta OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=atpD PE=3 SV=1 24 440 2.0E-28
sp|B9MS68|ATPB_CALBD ATP synthase subunit beta OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=atpD PE=3 SV=1 26 489 2.0E-28
sp|Q13DP4|ATPA_RHOPS ATP synthase subunit alpha OS=Rhodopseudomonas palustris (strain BisB5) GN=atpA PE=3 SV=1 94 410 2.0E-28
sp|Q67TB9|ATPA_SYMTH ATP synthase subunit alpha OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=atpA PE=3 SV=1 77 410 2.0E-28
sp|Q2JX57|ATPB_SYNJA ATP synthase subunit beta OS=Synechococcus sp. (strain JA-3-3Ab) GN=atpD PE=3 SV=1 24 440 2.0E-28
sp|B0YPM5|ATPA_ANEMR ATP synthase subunit alpha, plastid OS=Aneura mirabilis GN=atpA PE=3 SV=1 81 380 2.0E-28
sp|Q162S7|ATPA_ROSDO ATP synthase subunit alpha OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=atpA PE=3 SV=1 55 386 2.0E-28
sp|B9JTR4|ATPA_AGRVS ATP synthase subunit alpha OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=atpA PE=3 SV=1 55 410 2.0E-28
sp|A6UDM3|ATPA_SINMW ATP synthase subunit alpha OS=Sinorhizobium medicae (strain WSM419) GN=atpA PE=3 SV=1 55 507 2.0E-28
sp|P48080|ATPA_CYAPA ATP synthase subunit alpha, cyanelle OS=Cyanophora paradoxa GN=atpA PE=3 SV=1 69 380 3.0E-28
sp|A6H5F1|ATPA_CYCTA ATP synthase subunit alpha, chloroplastic OS=Cycas taitungensis GN=atpA PE=3 SV=1 81 380 3.0E-28
sp|B1HM54|ATPA_LYSSC ATP synthase subunit alpha OS=Lysinibacillus sphaericus (strain C3-41) GN=atpA PE=3 SV=1 71 387 3.0E-28
sp|A8LJR6|ATPA2_DINSH ATP synthase subunit alpha 2 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=atpA2 PE=3 SV=1 94 380 3.0E-28
sp|Q8UC74|ATPA_AGRFC ATP synthase subunit alpha OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=atpA PE=3 SV=1 55 507 3.0E-28
sp|Q8FYR3|ATPA_BRUSU ATP synthase subunit alpha OS=Brucella suis biovar 1 (strain 1330) GN=atpA PE=3 SV=1 55 410 3.0E-28
sp|A9BFX3|ATPB_PETMO ATP synthase subunit beta OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=atpD PE=3 SV=1 24 440 3.0E-28
sp|A3DIM9|ATPB_CLOTH ATP synthase subunit beta OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=atpD PE=3 SV=1 20 440 3.0E-28
sp|B0UE41|ATPA_METS4 ATP synthase subunit alpha OS=Methylobacterium sp. (strain 4-46) GN=atpA PE=3 SV=1 77 410 3.0E-28
sp|Q7U8W5|ATPA_SYNPX ATP synthase subunit alpha OS=Synechococcus sp. (strain WH8102) GN=atpA PE=3 SV=1 32 380 3.0E-28
sp|A6QB59|ATPB_SULNB ATP synthase subunit beta OS=Sulfurovum sp. (strain NBC37-1) GN=atpD PE=3 SV=1 24 440 3.0E-28
sp|P05439|ATPA_RHOBL ATP synthase subunit alpha OS=Rhodobacter blasticus GN=atpA PE=3 SV=1 98 508 3.0E-28
sp|Q0ZJ35|ATPA_VITVI ATP synthase subunit alpha, chloroplastic OS=Vitis vinifera GN=atpA PE=3 SV=1 81 402 3.0E-28
sp|Q04BA3|ATPB_LACDB ATP synthase subunit beta OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=atpD PE=3 SV=1 24 425 3.0E-28
sp|Q21CY5|ATPA_RHOPB ATP synthase subunit alpha OS=Rhodopseudomonas palustris (strain BisB18) GN=atpA PE=3 SV=1 94 410 3.0E-28
sp|A7Y3A4|ATPA_IPOPU ATP synthase subunit alpha, chloroplastic OS=Ipomoea purpurea GN=atpA PE=3 SV=1 81 380 3.0E-28
sp|B4UKF2|ATPA_ANASK ATP synthase subunit alpha OS=Anaeromyxobacter sp. (strain K) GN=atpA PE=3 SV=1 83 443 3.0E-28
sp|Q06GS5|ATPA_PIPCE ATP synthase subunit alpha, chloroplastic OS=Piper cenocladum GN=atpA PE=3 SV=1 81 380 4.0E-28
sp|A7I177|ATPB_CAMHC ATP synthase subunit beta OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=atpD PE=3 SV=1 24 440 4.0E-28
sp|A9WWS4|ATPA_BRUSI ATP synthase subunit alpha OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=atpA PE=3 SV=1 55 380 4.0E-28
sp|A9M839|ATPA_BRUC2 ATP synthase subunit alpha OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=atpA PE=3 SV=1 55 380 4.0E-28
sp|Q0VKX2|ATPA_ALCBS ATP synthase subunit alpha OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=atpA PE=3 SV=1 82 380 4.0E-28
sp|P45825|ATPA_MYCLE ATP synthase subunit alpha OS=Mycobacterium leprae (strain TN) GN=atpA PE=3 SV=1 82 428 4.0E-28
sp|B8ZR40|ATPA_MYCLB ATP synthase subunit alpha OS=Mycobacterium leprae (strain Br4923) GN=atpA PE=3 SV=1 82 428 4.0E-28
sp|B8JCV2|ATPA_ANAD2 ATP synthase subunit alpha OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=atpA PE=3 SV=1 83 443 4.0E-28
sp|Q57B86|ATPA_BRUAB ATP synthase subunit alpha OS=Brucella abortus biovar 1 (strain 9-941) GN=atpA PE=3 SV=1 55 380 4.0E-28
sp|Q2YLI5|ATPA_BRUA2 ATP synthase subunit alpha OS=Brucella abortus (strain 2308) GN=atpA PE=3 SV=1 55 380 4.0E-28
sp|B2S7M5|ATPA_BRUA1 ATP synthase subunit alpha OS=Brucella abortus (strain S19) GN=atpA PE=3 SV=1 55 380 4.0E-28
sp|Q2J3I2|ATPA_RHOP2 ATP synthase subunit alpha OS=Rhodopseudomonas palustris (strain HaA2) GN=atpA PE=3 SV=1 94 410 4.0E-28
sp|Q92LK6|ATPA_RHIME ATP synthase subunit alpha OS=Rhizobium meliloti (strain 1021) GN=atpA PE=3 SV=1 55 507 4.0E-28
sp|B9L7Y7|ATPB_NAUPA ATP synthase subunit beta OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=atpD PE=3 SV=1 26 492 4.0E-28
sp|Q8YJ37|ATPA_BRUME ATP synthase subunit alpha OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=atpA PE=3 SV=1 55 380 4.0E-28
sp|C0RF52|ATPA_BRUMB ATP synthase subunit alpha OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=atpA PE=3 SV=1 55 380 4.0E-28
sp|A5VSE3|ATPA_BRUO2 ATP synthase subunit alpha OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=atpA PE=3 SV=1 55 380 5.0E-28
sp|Q1GXM8|ATPA_METFK ATP synthase subunit alpha OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=atpA PE=3 SV=1 83 380 5.0E-28
sp|Q09FX6|ATPA_NANDO ATP synthase subunit alpha, chloroplastic OS=Nandina domestica GN=atpA PE=3 SV=1 81 380 5.0E-28
sp|A0A320|ATPA_COFAR ATP synthase subunit alpha, chloroplastic OS=Coffea arabica GN=atpA PE=3 SV=1 81 380 6.0E-28
sp|C4KYS5|ATPA_EXISA ATP synthase subunit alpha OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=atpA PE=3 SV=1 71 387 6.0E-28
sp|A5III5|ATPA2_LEGPC ATP synthase subunit alpha 2 OS=Legionella pneumophila (strain Corby) GN=atpA2 PE=3 SV=1 65 380 6.0E-28
sp|Q02BU3|ATPA_SOLUE ATP synthase subunit alpha OS=Solibacter usitatus (strain Ellin6076) GN=atpA PE=3 SV=1 32 484 6.0E-28
sp|P50001|ATPA_STRLI ATP synthase subunit alpha OS=Streptomyces lividans GN=atpA PE=1 SV=2 74 457 7.0E-28
sp|Q6MAK5|ATPA_PARUW ATP synthase subunit alpha OS=Protochlamydia amoebophila (strain UWE25) GN=atpA PE=3 SV=1 83 479 7.0E-28
sp|A8L3W3|ATPA_FRASN ATP synthase subunit alpha OS=Frankia sp. (strain EAN1pec) GN=atpA PE=3 SV=1 82 439 7.0E-28
sp|Q11DD7|ATPA_CHESB ATP synthase subunit alpha OS=Chelativorans sp. (strain BNC1) GN=atpA PE=3 SV=1 83 410 7.0E-28
sp|Q5SCX6|ATPA_HUPLU ATP synthase subunit alpha, chloroplastic OS=Huperzia lucidula GN=atpA PE=3 SV=1 81 380 8.0E-28
sp|Q1Q897|ATPA_PSYCK ATP synthase subunit alpha OS=Psychrobacter cryohalolentis (strain K5) GN=atpA PE=3 SV=1 82 488 8.0E-28
sp|P29706|ATPA_PROMO ATP synthase subunit alpha, sodium ion specific OS=Propionigenium modestum GN=atpA PE=1 SV=2 82 380 8.0E-28
sp|B5YBP8|ATPB_DICT6 ATP synthase subunit beta OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=atpD PE=3 SV=1 24 440 8.0E-28
sp|Q2JIG0|ATPA_SYNJB ATP synthase subunit alpha OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=atpA PE=3 SV=1 74 480 8.0E-28
sp|A1TD57|ATPA_MYCVP ATP synthase subunit alpha OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=atpA PE=3 SV=1 82 380 8.0E-28
sp|Q2G5N7|ATPA_NOVAD ATP synthase subunit alpha OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atpA PE=3 SV=1 55 387 9.0E-28
sp|A6Q4C2|ATPA_NITSB ATP synthase subunit alpha OS=Nitratiruptor sp. (strain SB155-2) GN=atpA PE=3 SV=1 81 380 9.0E-28
sp|Q8PGG7|ATPB_XANAC ATP synthase subunit beta OS=Xanthomonas axonopodis pv. citri (strain 306) GN=atpD PE=3 SV=1 33 440 9.0E-28
sp|A1VXI8|ATPA_CAMJJ ATP synthase subunit alpha OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=atpA PE=3 SV=1 90 411 9.0E-28
sp|P72245|ATPA_RHOCA ATP synthase subunit alpha OS=Rhodobacter capsulatus GN=atpA PE=1 SV=3 96 380 9.0E-28
sp|A0R202|ATPA_MYCS2 ATP synthase subunit alpha OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=atpA PE=1 SV=1 82 380 9.0E-28
sp|Q5ZR99|ATPA2_LEGPH ATP synthase subunit alpha 2 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=atpA2 PE=3 SV=1 65 380 1.0E-27
sp|Q5X0P1|ATPA2_LEGPA ATP synthase subunit alpha 2 OS=Legionella pneumophila (strain Paris) GN=atpA2 PE=3 SV=1 65 380 1.0E-27
sp|P26526|ATPA_CHLRE ATP synthase subunit alpha, chloroplastic OS=Chlamydomonas reinhardtii GN=atpA PE=1 SV=3 81 387 1.0E-27
sp|Q5HX61|ATPA_CAMJR ATP synthase subunit alpha OS=Campylobacter jejuni (strain RM1221) GN=atpA PE=3 SV=1 90 411 1.0E-27
sp|Q9PJ21|ATPA_CAMJE ATP synthase subunit alpha OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=atpA PE=3 SV=1 90 411 1.0E-27
sp|A8FJR0|ATPA_CAMJ8 ATP synthase subunit alpha OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=atpA PE=3 SV=1 90 411 1.0E-27
sp|O83417|FLII_TREPA Flagellum-specific ATP synthase OS=Treponema pallidum (strain Nichols) GN=fliI PE=3 SV=1 70 459 1.0E-27
sp|Q5WSG6|ATPA_LEGPL ATP synthase subunit alpha OS=Legionella pneumophila (strain Lens) GN=atpA PE=3 SV=1 65 380 1.0E-27
sp|P55717|Y4YI_RHISN Probable ATP synthase y4yI OS=Rhizobium sp. (strain NGR234) GN=NGR_a00640 PE=3 SV=1 72 402 1.0E-27
sp|B8J439|ATPB_DESDA ATP synthase subunit beta OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=atpD PE=3 SV=1 49 448 1.0E-27
sp|Q3SVJ4|ATPA_NITWN ATP synthase subunit alpha OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=atpA PE=3 SV=1 94 457 1.0E-27
sp|Q2YCA5|ATPA1_NITMU ATP synthase subunit alpha 1 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=atpA1 PE=3 SV=1 83 380 1.0E-27
sp|Q9K4D5|ATPA_STRCO ATP synthase subunit alpha OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=atpA PE=3 SV=1 74 457 1.0E-27
sp|A9L981|ATPA_LEMMI ATP synthase subunit alpha, chloroplastic OS=Lemna minor GN=atpA PE=3 SV=1 81 380 1.0E-27
sp|A7H1H9|ATPA_CAMJD ATP synthase subunit alpha OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=atpA PE=3 SV=1 90 380 1.0E-27
sp|Q7MA20|ATPA_WOLSU ATP synthase subunit alpha OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=atpA PE=3 SV=1 62 380 1.0E-27
sp|C1F3N8|ATPA_ACIC5 ATP synthase subunit alpha OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=atpA PE=3 SV=1 82 503 1.0E-27
sp|P42465|ATPB_CHLP8 ATP synthase subunit beta OS=Chlorobaculum parvum (strain NCIB 8327) GN=atpD PE=3 SV=1 16 440 1.0E-27
sp|Q09G61|ATPA_PLAOC ATP synthase subunit alpha, chloroplastic OS=Platanus occidentalis GN=atpA PE=3 SV=1 81 380 1.0E-27
sp|Q1GAW5|ATPB_LACDA ATP synthase subunit beta OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=atpD PE=3 SV=1 36 425 1.0E-27
sp|A0PUK2|ATPA_MYCUA ATP synthase subunit alpha OS=Mycobacterium ulcerans (strain Agy99) GN=atpA PE=3 SV=1 82 380 1.0E-27
sp|Q2JSW1|ATPA_SYNJA ATP synthase subunit alpha OS=Synechococcus sp. (strain JA-3-3Ab) GN=atpA PE=3 SV=1 83 480 1.0E-27
sp|Q3B6W8|ATPB1_CHLL7 ATP synthase subunit beta 1 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=atpD1 PE=3 SV=2 16 440 1.0E-27
sp|Q1MRB8|ATPB_LAWIP ATP synthase subunit beta OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=atpD PE=3 SV=1 86 447 2.0E-27
sp|A5V3X3|ATPA_SPHWW ATP synthase subunit alpha OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=atpA PE=3 SV=1 83 387 2.0E-27
sp|B0JWV1|ATPA_MICAN ATP synthase subunit alpha OS=Microcystis aeruginosa (strain NIES-843) GN=atpA PE=3 SV=1 83 387 2.0E-27
sp|Q9ZK81|ATPB_HELPJ ATP synthase subunit beta OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=atpD PE=3 SV=1 24 440 2.0E-27
sp|Q28TJ8|ATPA_JANSC ATP synthase subunit alpha OS=Jannaschia sp. (strain CCS1) GN=atpA PE=3 SV=1 55 386 2.0E-27
sp|P47639|ATPB_MYCGE ATP synthase subunit beta OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=atpD PE=3 SV=2 16 440 2.0E-27
sp|Q8EM81|ATPA_OCEIH ATP synthase subunit alpha OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=atpA PE=3 SV=1 82 478 2.0E-27
sp|B2HQK4|ATPA_MYCMM ATP synthase subunit alpha OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=atpA PE=3 SV=1 82 380 2.0E-27
sp|C0Z778|ATPA_BREBN ATP synthase subunit alpha OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=atpA PE=3 SV=1 83 466 2.0E-27
sp|B1A920|ATPA_CARPA ATP synthase subunit alpha, chloroplastic OS=Carica papaya GN=atpA PE=3 SV=1 81 380 2.0E-27
sp|Q5WSG8|ATPB_LEGPL ATP synthase subunit beta OS=Legionella pneumophila (strain Lens) GN=atpD PE=3 SV=1 37 440 2.0E-27
sp|Q5ZRA1|ATPB_LEGPH ATP synthase subunit beta OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=atpD PE=3 SV=1 37 440 2.0E-27
sp|A5III3|ATPB_LEGPC ATP synthase subunit beta OS=Legionella pneumophila (strain Corby) GN=atpD PE=3 SV=1 37 440 2.0E-27
sp|Q5X0P3|ATPB_LEGPA ATP synthase subunit beta OS=Legionella pneumophila (strain Paris) GN=atpD PE=3 SV=1 37 440 2.0E-27
sp|A4YKD8|ATPA_BRASO ATP synthase subunit alpha OS=Bradyrhizobium sp. (strain ORS278) GN=atpA PE=3 SV=1 94 457 2.0E-27
sp|Q4FQ35|ATPA_PSYA2 ATP synthase subunit alpha OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=atpA PE=3 SV=1 82 488 2.0E-27
sp|B0T338|ATPA_CAUSK ATP synthase subunit alpha OS=Caulobacter sp. (strain K31) GN=atpA PE=3 SV=1 82 485 2.0E-27
sp|A0LDA2|ATPA_MAGMM ATP synthase subunit alpha OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=atpA PE=3 SV=1 49 380 2.0E-27
sp|B5Z8D0|ATPB_HELPG ATP synthase subunit beta OS=Helicobacter pylori (strain G27) GN=atpD PE=3 SV=1 24 440 2.0E-27
sp|Q89X72|ATPA_BRADU ATP synthase subunit alpha OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=atpA PE=3 SV=1 94 457 3.0E-27
sp|B0THN4|ATPA_HELMI ATP synthase subunit alpha OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=atpA PE=3 SV=1 55 466 3.0E-27
sp|A5E948|ATPA_BRASB ATP synthase subunit alpha OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=atpA PE=3 SV=1 94 457 3.0E-27
sp|P00830|ATPB_YEAST ATP synthase subunit beta, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP2 PE=1 SV=2 70 440 3.0E-27
sp|Q73X57|ATPA_MYCPA ATP synthase subunit alpha OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=atpA PE=3 SV=1 82 380 3.0E-27
sp|A0QCX6|ATPA_MYCA1 ATP synthase subunit alpha OS=Mycobacterium avium (strain 104) GN=atpA PE=3 SV=1 82 380 3.0E-27
sp|Q4A604|ATPB_MYCS5 ATP synthase subunit beta OS=Mycoplasma synoviae (strain 53) GN=atpD PE=3 SV=1 35 440 3.0E-27
sp|P56294|ATPA_CHLVU ATP synthase subunit alpha, chloroplastic OS=Chlorella vulgaris GN=atpA PE=3 SV=1 55 387 3.0E-27
sp|B6JMX2|ATPB_HELP2 ATP synthase subunit beta OS=Helicobacter pylori (strain P12) GN=atpD PE=3 SV=1 24 440 3.0E-27
sp|Q21DK6|ATPA_SACD2 ATP synthase subunit alpha OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=atpA PE=3 SV=1 83 380 3.0E-27
sp|Q7NHG7|ATPB_GLOVI ATP synthase subunit beta OS=Gloeobacter violaceus (strain PCC 7421) GN=atpD PE=3 SV=1 26 440 3.0E-27
sp|Q87E90|ATPB_XYLFT ATP synthase subunit beta OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=atpD PE=3 SV=1 33 440 3.0E-27
sp|B2I877|ATPB_XYLF2 ATP synthase subunit beta OS=Xylella fastidiosa (strain M23) GN=atpD PE=3 SV=1 33 440 3.0E-27
sp|A9H9A4|ATPA_GLUDA ATP synthase subunit alpha OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=atpA PE=3 SV=1 50 410 3.0E-27
sp|P50000|ATPA_ACEWD ATP synthase subunit alpha, sodium ion specific OS=Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655) GN=atpA PE=3 SV=3 83 491 3.0E-27
sp|B8CZ12|ATPA_HALOH ATP synthase subunit alpha OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=atpA PE=3 SV=1 83 387 4.0E-27
sp|Q03EL4|ATPB_PEDPA ATP synthase subunit beta OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=atpD PE=3 SV=1 24 424 4.0E-27
sp|A8HS15|ATPA_AZOC5 ATP synthase subunit alpha OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=atpA PE=3 SV=1 77 410 4.0E-27
sp|A4XKX0|ATPB_CALS8 ATP synthase subunit beta OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=atpD PE=3 SV=1 26 489 4.0E-27
sp|A4FN29|ATPA_SACEN ATP synthase subunit alpha OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=atpA PE=3 SV=1 82 380 4.0E-27
sp|A1AXU4|ATPA_RUTMC ATP synthase subunit alpha OS=Ruthia magnifica subsp. Calyptogena magnifica GN=atpA PE=3 SV=1 83 380 4.0E-27
sp|A0AFQ9|ATPA1_LISW6 ATP synthase subunit alpha 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=atpA1 PE=3 SV=1 55 376 4.0E-27
sp|B1LVH1|ATPA_METRJ ATP synthase subunit alpha OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=atpA PE=3 SV=1 83 507 4.0E-27
sp|P35110|ATPB_CHLLI ATP synthase subunit beta OS=Chlorobium limicola GN=atpD PE=3 SV=1 16 440 4.0E-27
sp|A0JY66|ATPA_ARTS2 ATP synthase subunit alpha OS=Arthrobacter sp. (strain FB24) GN=atpA PE=3 SV=2 45 500 4.0E-27
sp|P49376|ATPB_KLULA ATP synthase subunit beta, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATP2 PE=3 SV=2 70 440 4.0E-27
sp|Q5H4Y4|ATPB_XANOR ATP synthase subunit beta OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=atpD PE=3 SV=2 33 440 5.0E-27
[Show less]

GO

GO Term Description Terminal node
GO:1902600 proton transmembrane transport Yes
GO:0046034 ATP metabolic process Yes
GO:0005524 ATP binding Yes
GO:0006807 nitrogen compound metabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0032553 ribonucleotide binding No
GO:0009259 ribonucleotide metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0051179 localization No
GO:0098655 cation transmembrane transport No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0009144 purine nucleoside triphosphate metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0017076 purine nucleotide binding No
GO:1901135 carbohydrate derivative metabolic process No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0019693 ribose phosphate metabolic process No
GO:0008150 biological_process No
GO:0006812 cation transport No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009199 ribonucleoside triphosphate metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0006811 ion transport No
GO:0055085 transmembrane transport No
GO:0043168 anion binding No
GO:0046483 heterocycle metabolic process No
GO:0009205 purine ribonucleoside triphosphate metabolic process No
GO:0051234 establishment of localization No
GO:1901564 organonitrogen compound metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0006753 nucleoside phosphate metabolic process No
GO:0034220 ion transmembrane transport No
GO:0072521 purine-containing compound metabolic process No
GO:0009141 nucleoside triphosphate metabolic process No
GO:0044238 primary metabolic process No
GO:0098660 inorganic ion transmembrane transport No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008152 metabolic process No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0006163 purine nucleotide metabolic process No
GO:0044237 cellular metabolic process No
GO:0098662 inorganic cation transmembrane transport No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7492
MGDPRDSSSYSIVPRLRYNTVGGVNGPLVILENVKFPKYNEIVTLTLPDGSERSGQVLEARGDRAVVQVFEGTSG
IDVKKTKVEFTGHSLKLGVSEDMLGRIFDGSGRAIDKGPKVLPEDYLDINGSPINPYSREYPEEMIATGISAIDT
MNSIARGQKIPIFSASGLPHNEIAAQICRQAGLVQKQGVTNKGVHDGHEENFSIVFGAMGVNLETARFFTRDFEE
NGSLERVTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLSAYCDALREVSAAREEVPGRRGYPG
YMYTDLSTIYERAGRVEGRNGSITQIPILTMPNDDITHPIPDLTGYITEGQIFVDRPLYNRGIYPPINVLPSLSR
LMKSAIGEGMTRKDHADVSNQLYAKYAIGRDAAAMKAVVGEEALSAEDKLSLEFLDKFERQFISQGAYESRTIYE
SLDLAWSLLRIYPKDLLNRIPAKILNEFYQRAHKDSKAKGKARADVAGKDQKQNDENLIDA*
Coding >OphauB2|7492
ATGGGAGATCCACGCGACTCGTCGTCGTACTCTATTGTACCCAGACTTCGCTACAACACGGTTGGGGGTGTCAAC
GGACCCCTTGTAATTCTCGAGAACGTGAAATTTCCCAAATACAATGAAATCGTCACATTGACGCTCCCCGATGGC
TCGGAGAGATCTGGCCAGGTCCTCGAGGCCCGCGGCGACCGTGCTGTTGTTCAGGTTTTTGAGGGCACTTCGGGC
ATCGATGTGAAAAAGACCAAAGTTGAGTTTACGGGACACAGTCTGAAGCTTGGCGTATCAGAGGACATGCTGGGA
CGCATCTTTGACGGATCTGGGCGCGCCATTGACAAAGGCCCCAAAGTGCTACCTGAAGATTACCTTGATATCAAC
GGCAGCCCCATTAACCCCTACTCCCGAGAATATCCTGAGGAAATGATTGCAACAGGAATTTCGGCGATTGACACA
ATGAACTCGATTGCCCGTGGCCAAAAAATACCCATCTTCTCTGCTTCAGGCCTGCCACACAACGAGATTGCCGCC
CAGATTTGCCGACAGGCTGGCCTTGTACAGAAACAAGGTGTGACAAACAAAGGCGTGCATGATGGACATGAAGAA
AATTTCTCCATCGTCTTTGGTGCCATGGGTGTCAATTTGGAGACTGCTCGGTTTTTCACGCGCGATTTTGAGGAG
AACGGTAGTCTGGAACGCGTCACCTTGTTCCTCAATCTGGCCAACGACCCAACAATCGAGCGTATTATTACACCT
CGTCTTGCGCTGACGACGGCTGAATACTACGCCTACCAACTAGAAAAGCACGTCTTGGTGATCCTGACGGATTTG
TCGGCCTATTGCGATGCTCTGCGTGAAGTGTCGGCGGCCCGAGAAGAAGTGCCTGGCCGGCGCGGTTACCCCGGC
TACATGTATACCGACTTGTCCACGATTTATGAACGAGCCGGCCGTGTCGAGGGGCGCAATGGATCAATTACGCAG
ATTCCTATTCTGACGATGCCCAATGACGACATTACACATCCGATTCCCGATTTGACAGGCTACATCACCGAGGGC
CAGATATTCGTCGACCGTCCGCTCTACAATCGTGGAATTTACCCGCCCATCAATGTGTTGCCGTCGCTGTCGCGT
CTGATGAAGTCTGCCATTGGCGAGGGCATGACGCGCAAAGACCACGCTGACGTGTCGAACCAGCTATATGCCAAG
TATGCCATTGGTCGCGACGCGGCAGCTATGAAGGCTGTGGTTGGTGAGGAAGCATTGTCGGCCGAAGACAAGCTC
TCGCTCGAGTTTTTGGACAAGTTTGAGCGTCAATTCATCAGCCAAGGCGCGTACGAGTCGCGAACCATTTACGAG
TCGTTGGACCTTGCCTGGAGTCTGCTACGCATCTACCCCAAGGACCTGTTGAATCGCATTCCAGCCAAGATTCTC
AATGAGTTTTACCAGAGGGCGCACAAGGACTCCAAGGCTAAGGGTAAGGCACGGGCAGATGTTGCTGGCAAGGAT
CAGAAACAGAATGACGAGAACCTGATTGACGCCTAA
Transcript >OphauB2|7492
ATGGGAGATCCACGCGACTCGTCGTCGTACTCTATTGTACCCAGACTTCGCTACAACACGGTTGGGGGTGTCAAC
GGACCCCTTGTAATTCTCGAGAACGTGAAATTTCCCAAATACAATGAAATCGTCACATTGACGCTCCCCGATGGC
TCGGAGAGATCTGGCCAGGTCCTCGAGGCCCGCGGCGACCGTGCTGTTGTTCAGGTTTTTGAGGGCACTTCGGGC
ATCGATGTGAAAAAGACCAAAGTTGAGTTTACGGGACACAGTCTGAAGCTTGGCGTATCAGAGGACATGCTGGGA
CGCATCTTTGACGGATCTGGGCGCGCCATTGACAAAGGCCCCAAAGTGCTACCTGAAGATTACCTTGATATCAAC
GGCAGCCCCATTAACCCCTACTCCCGAGAATATCCTGAGGAAATGATTGCAACAGGAATTTCGGCGATTGACACA
ATGAACTCGATTGCCCGTGGCCAAAAAATACCCATCTTCTCTGCTTCAGGCCTGCCACACAACGAGATTGCCGCC
CAGATTTGCCGACAGGCTGGCCTTGTACAGAAACAAGGTGTGACAAACAAAGGCGTGCATGATGGACATGAAGAA
AATTTCTCCATCGTCTTTGGTGCCATGGGTGTCAATTTGGAGACTGCTCGGTTTTTCACGCGCGATTTTGAGGAG
AACGGTAGTCTGGAACGCGTCACCTTGTTCCTCAATCTGGCCAACGACCCAACAATCGAGCGTATTATTACACCT
CGTCTTGCGCTGACGACGGCTGAATACTACGCCTACCAACTAGAAAAGCACGTCTTGGTGATCCTGACGGATTTG
TCGGCCTATTGCGATGCTCTGCGTGAAGTGTCGGCGGCCCGAGAAGAAGTGCCTGGCCGGCGCGGTTACCCCGGC
TACATGTATACCGACTTGTCCACGATTTATGAACGAGCCGGCCGTGTCGAGGGGCGCAATGGATCAATTACGCAG
ATTCCTATTCTGACGATGCCCAATGACGACATTACACATCCGATTCCCGATTTGACAGGCTACATCACCGAGGGC
CAGATATTCGTCGACCGTCCGCTCTACAATCGTGGAATTTACCCGCCCATCAATGTGTTGCCGTCGCTGTCGCGT
CTGATGAAGTCTGCCATTGGCGAGGGCATGACGCGCAAAGACCACGCTGACGTGTCGAACCAGCTATATGCCAAG
TATGCCATTGGTCGCGACGCGGCAGCTATGAAGGCTGTGGTTGGTGAGGAAGCATTGTCGGCCGAAGACAAGCTC
TCGCTCGAGTTTTTGGACAAGTTTGAGCGTCAATTCATCAGCCAAGGCGCGTACGAGTCGCGAACCATTTACGAG
TCGTTGGACCTTGCCTGGAGTCTGCTACGCATCTACCCCAAGGACCTGTTGAATCGCATTCCAGCCAAGATTCTC
AATGAGTTTTACCAGAGGGCGCACAAGGACTCCAAGGCTAAGGGTAAGGCACGGGCAGATGTTGCTGGCAAGGAT
CAGAAACAGAATGACGAGAACCTGATTGACGCCTAA
Gene >OphauB2|7492
ATGGGAGATCCACGCGACTCGTCGTCGTACTCTATTGTACCCAGACTTCGCTACAACACGGTTGGGGGTGTCAAC
GGACCCCTTGTAATTCTCGAGAACGTATGAGCTCCATTTACCCTTGGTGCTGCAACAGACTGACAATGTGTTGGA
TATTGATAGGTGAAATTTCCCAAATACAATGAAATCGTCACATTGACGCTCCCCGATGGCTCGGAGAGATCTGGC
CAGGTCCTCGAGGCCCGCGGTAAGCAGCAACTTGTCCACGCTTCGCTTGATTCTGTCGCTGACTAGCGAGGTTAG
GCGACCGTGCTGTTGTTCAGGTACCTCGTTCAAAAAGCTACTGCTGCTTCCTGAGCTAACAATGATATGGCTACA
GGTTTTTGAGGGCACTTCGGGCATCGATGTGAAAAAGGTGGGCCAAAAAAAAAACAAAATAATGAGCTTTCGTTC
GGATTGCGGAGAAGTGGCTGACTAGGATGCAGACCAAAGTTGAGTTTACGGGACACAGTCTGAAGCTTGGCGTAT
CAGAGGACATGCTGGGACGCATCTTTGACGGATCTGGGCGCGCCATTGACAAAGGCCCCAAAGTGCTACCTGAAG
ATTACCTTGATATCAACGGCAGCCCCATTAACCCCTACTCCCGAGTATGTCCAATGGCTCTAGCTTGGGGTGAGG
GACGTGCAGCTGACTGCAGCAGGAATATCCTGAGGAAATGATTGCAACAGGAATTTCGGCGATTGACACAATGAA
CTCGATTGCCCGTGGCCAAAAAATACCCATCTTCTCTGCTTCAGGCCTGCCACACAACGAGATTGCCGCCCAGAT
TTGCCGACAGGCTGGCCTTGTACAGAAACAAGGTGTGACAAACAAAGGCGTGCATGATGGACATGAAGAAAATTT
CTCCATCGTCTTTGGTGCCATGGGTGTCAATTTGGAGACTGCTCGGTTTTTCACGCGCGATTTTGAGGAGAACGG
TAGTCTGGAACGCGTCACCTTGTTCCTCAATCTGGCCAACGACCCAACGTGAGTGTTTACAGGTGCGAATCTGTA
GCCATGGCTGACGAGACACTTGCAGAATCGAGCGTATTATTACACCTCGTCTTGCGCTGACGACGGCTGAATACT
ACGCCTACCAACTAGAAAAGCACGTCTTGGTGATCCTGACGGATTTGTCGGCCTATTGCGATGCTCTGCGTGAAG
TGTCGGCGGCCCGAGAAGAAGTGCCTGGCCGGCGCGGTTACCCCGGCTACATGTATACCGACTTGTCCACGATTT
ATGAACGAGCCGGCCGTGTCGAGGGGCGCAATGGATCAATTACGCAGATTCCTATTCTGACGATGCCCAATGACG
ACATTACACATCCGATTCCCGATTTGACAGGCTACATCACCGAGGGCCAGATATTCGTCGACCGTCCGCTCTACA
ATCGTGGAATTTACCCGCCCATCAATGTGTTGCCGTCGCTGTCGCGTCTGATGAAGTCTGCCATTGGCGAGGGCA
TGACGCGCAAAGACCACGCTGACGTGTCGAACCAGCTATATGCCAAGTATGCCATTGGTCGCGACGCGGCAGCTA
TGAAGGCTGTGGTTGGTGAGGAAGCATTGTCGGCCGAAGACAAGCTCTCGCTCGAGTTTTTGGACAAGTTTGAGC
GTCAATTCATCAGCCAAGGCGCGTACGAGTCGCGAACCATTTACGAGTCGTTGGACCTTGCCTGGAGTCTGCTAC
GCATCTACCCCAAGGACCTGTTGAATCGCATTCCAGCCAAGATTCTCAATGAGTTTTACCAGAGGGCGCACAAGG
ACTCCAAGGCTAAGGGTAAGGCACGGGCAGATGTTGCTGGCAAGGATCAGAAACAGAATGACGAGAACCTGATTG
ACGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail