Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7488
Gene name
LocationContig_8:252015..253197
Strand-
Gene length (bp)1182
Transcript length (bp)720
Coding sequence length (bp)720
Protein length (aa) 240

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01092 Ribosomal_S6e Ribosomal protein S6e 7.1E-54 1 126

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C0Z7|RS6B_SCHPO 40S ribosomal protein S6-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps602 PE=1 SV=1 1 239 8.0E-133
sp|P05752|RS6A_SCHPO 40S ribosomal protein S6-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps601 PE=1 SV=2 1 239 6.0E-132
sp|Q6BXH8|RS6_DEBHA 40S ribosomal protein S6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPS6 PE=3 SV=1 1 238 1.0E-125
sp|Q90YR8|RS6_ICTPU 40S ribosomal protein S6 OS=Ictalurus punctatus GN=rps6 PE=2 SV=1 1 238 2.0E-111
sp|P0CX37|RS6A_YEAST 40S ribosomal protein S6-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS6A PE=1 SV=1 1 238 2.0E-110
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C0Z7|RS6B_SCHPO 40S ribosomal protein S6-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps602 PE=1 SV=1 1 239 8.0E-133
sp|P05752|RS6A_SCHPO 40S ribosomal protein S6-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps601 PE=1 SV=2 1 239 6.0E-132
sp|Q6BXH8|RS6_DEBHA 40S ribosomal protein S6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPS6 PE=3 SV=1 1 238 1.0E-125
sp|Q90YR8|RS6_ICTPU 40S ribosomal protein S6 OS=Ictalurus punctatus GN=rps6 PE=2 SV=1 1 238 2.0E-111
sp|P0CX37|RS6A_YEAST 40S ribosomal protein S6-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS6A PE=1 SV=1 1 238 2.0E-110
sp|P39017|RS6_XENLA 40S ribosomal protein S6 OS=Xenopus laevis GN=rps6 PE=2 SV=1 1 238 2.0E-110
sp|P0CX38|RS6B_YEAST 40S ribosomal protein S6-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS6B PE=1 SV=1 1 238 2.0E-110
sp|P62755|RS6_RAT 40S ribosomal protein S6 OS=Rattus norvegicus GN=Rps6 PE=1 SV=1 1 238 3.0E-110
sp|P62754|RS6_MOUSE 40S ribosomal protein S6 OS=Mus musculus GN=Rps6 PE=1 SV=1 1 238 3.0E-110
sp|Q4R4K6|RS6_MACFA 40S ribosomal protein S6 OS=Macaca fascicularis GN=RPS6 PE=2 SV=1 1 238 3.0E-110
sp|P62753|RS6_HUMAN 40S ribosomal protein S6 OS=Homo sapiens GN=RPS6 PE=1 SV=1 1 238 3.0E-110
sp|Q6CM04|RS6_KLULA 40S ribosomal protein S6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RPS6 PE=1 SV=1 1 238 4.0E-110
sp|Q6FJH3|RS6_CANGA 40S ribosomal protein S6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPS6A PE=3 SV=1 1 238 4.0E-110
sp|Q74ZK3|RS6_ASHGO 40S ribosomal protein S6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPS6 PE=3 SV=1 1 238 1.0E-109
sp|Q5E995|RS6_BOVIN 40S ribosomal protein S6 OS=Bos taurus GN=RPS6 PE=2 SV=1 1 238 1.0E-109
sp|P47838|RS6_CHICK 40S ribosomal protein S6 OS=Gallus gallus GN=RPS6 PE=2 SV=1 1 238 3.0E-109
sp|Q9YGF2|RS6_ONCMY 40S ribosomal protein S6 OS=Oncorhynchus mykiss GN=rps6 PE=2 SV=1 1 238 6.0E-109
sp|P41798|RS6_KLUMA 40S ribosomal protein S6 OS=Kluyveromyces marxianus GN=RPS6 PE=3 SV=1 1 238 2.0E-107
sp|Q6C169|RS6_YARLI 40S ribosomal protein S6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPS6 PE=3 SV=1 1 238 4.0E-104
sp|O01727|RS6_BRAFL 40S ribosomal protein S6 OS=Branchiostoma floridae GN=RPS6 PE=3 SV=1 1 238 2.0E-101
sp|Q2PQM1|RS6_GLOMM 40S ribosomal protein S6 OS=Glossina morsitans morsitans GN=RpS6 PE=2 SV=1 1 238 2.0E-101
sp|Q9BMX5|RS6_APLCA 40S ribosomal protein S6 OS=Aplysia californica GN=RPS6 PE=2 SV=1 1 235 4.0E-101
sp|P29327|RS6_DROME 40S ribosomal protein S6 OS=Drosophila melanogaster GN=RpS6 PE=1 SV=1 1 238 3.0E-98
sp|Q95V32|RS6_SPOFR 40S ribosomal protein S6 OS=Spodoptera frugiperda GN=RpS6 PE=2 SV=1 1 238 6.0E-98
sp|Q94624|RS6_MANSE 40S ribosomal protein S6 OS=Manduca sexta GN=RpS6 PE=2 SV=1 1 238 9.0E-96
sp|Q9U762|RS6_AEDAL 40S ribosomal protein S6 OS=Aedes albopictus GN=RpS6 PE=2 SV=1 1 215 9.0E-95
sp|Q9U761|RS6_AEDAE 40S ribosomal protein S6 OS=Aedes aegypti GN=RpS6 PE=2 SV=2 1 215 2.0E-94
sp|Q54UU3|RS6_DICDI 40S ribosomal protein S6 OS=Dictyostelium discoideum GN=rps6 PE=1 SV=1 1 226 2.0E-85
sp|Q9NEN6|RS6_CAEEL 40S ribosomal protein S6 OS=Caenorhabditis elegans GN=rps-6 PE=1 SV=1 1 233 4.0E-83
sp|Q9M3V8|RS6_ASPOF 40S ribosomal protein S6 OS=Asparagus officinalis GN=rps6 PE=2 SV=1 1 239 8.0E-83
sp|P51430|RS62_ARATH 40S ribosomal protein S6-2 OS=Arabidopsis thaliana GN=RPS6B PE=1 SV=3 1 239 2.0E-80
sp|O48549|RS61_ARATH 40S ribosomal protein S6-1 OS=Arabidopsis thaliana GN=RPS6A PE=1 SV=2 1 239 5.0E-77
sp|P29345|RS6_TOBAC 40S ribosomal protein S6 (Fragment) OS=Nicotiana tabacum GN=RPS6 PE=2 SV=2 46 228 2.0E-54
sp|Q9NE83|RS6_LEIMA 40S ribosomal protein S6 OS=Leishmania major GN=RPS6 PE=3 SV=1 1 185 2.0E-49
sp|O44012|RS6_LEIIN 40S ribosomal protein S6 OS=Leishmania infantum GN=RPS6 PE=2 SV=1 1 185 2.0E-48
sp|Q8SRY0|RS6_ENCCU 40S ribosomal protein S6 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPS6 PE=3 SV=2 1 213 5.0E-32
sp|Q8TVE6|RS6E_METKA 30S ribosomal protein S6e OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps6e PE=3 SV=1 19 121 1.0E-16
sp|A3CSP5|RS6E_METMJ 30S ribosomal protein S6e OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps6e PE=3 SV=1 1 117 4.0E-14
sp|O26360|RS6E_METTH 30S ribosomal protein S6e OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps6e PE=3 SV=1 38 118 1.0E-13
sp|Q5JDK8|RS6E_THEKO 30S ribosomal protein S6e OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps6e PE=3 SV=1 1 114 4.0E-13
sp|B6YW70|RS6E_THEON 30S ribosomal protein S6e OS=Thermococcus onnurineus (strain NA1) GN=rps6e PE=3 SV=1 1 114 2.0E-12
sp|C5A7C4|RS6E_THEGJ 30S ribosomal protein S6e OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rps6e PE=3 SV=1 1 106 6.0E-12
sp|Q2NGM7|RS6E_METST 30S ribosomal protein S6e OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rps6e PE=3 SV=1 28 122 9.0E-12
sp|C6A2D7|RS6E_THESM 30S ribosomal protein S6e OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rps6e PE=3 SV=1 20 114 9.0E-12
sp|B9LR51|RS6E_HALLT 30S ribosomal protein S6e OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rps6e PE=3 SV=1 1 118 1.0E-11
sp|Q9UYS3|RS6E_PYRAB 30S ribosomal protein S6e OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps6e PE=3 SV=1 1 114 2.0E-11
sp|O58349|RS6E_PYRHO 30S ribosomal protein S6e OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps6e PE=3 SV=1 1 114 2.0E-11
sp|Q8U3H8|RS6E_PYRFU 30S ribosomal protein S6e OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps6e PE=1 SV=1 1 114 2.0E-11
sp|Q3ISW0|RS6E_NATPD 30S ribosomal protein S6e OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rps6e PE=3 SV=1 27 124 3.0E-11
sp|A6VGE7|RS6E_METM7 30S ribosomal protein S6e OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rps6e PE=3 SV=1 21 123 3.0E-11
sp|P54067|RS6E_METJA 30S ribosomal protein S6e OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps6e PE=3 SV=1 27 124 3.0E-11
sp|Q2FU50|RS6E_METHJ 30S ribosomal protein S6e OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps6e PE=3 SV=1 1 117 1.0E-10
sp|A4FWX0|RS6E_METM5 30S ribosomal protein S6e OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rps6e PE=3 SV=1 21 123 1.0E-10
sp|Q6LXY7|RS6E_METMP 30S ribosomal protein S6e OS=Methanococcus maripaludis (strain S2 / LL) GN=rps6e PE=3 SV=1 27 123 1.0E-10
sp|Q466D6|RS6E_METBF 30S ribosomal protein S6e OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps6e PE=3 SV=1 1 124 2.0E-10
sp|Q18DP5|RS6E_HALWD 30S ribosomal protein S6e OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rps6e PE=3 SV=1 20 99 2.0E-10
sp|Q6L1H6|RS6E_PICTO 30S ribosomal protein S6e OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps6e PE=3 SV=1 20 117 2.0E-10
sp|A5UJM8|RS6E_METS3 30S ribosomal protein S6e OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps6e PE=3 SV=1 16 126 3.0E-10
sp|A9AAA5|RS6E_METM6 30S ribosomal protein S6e OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rps6e PE=3 SV=1 21 123 3.0E-10
sp|O29739|RS6E_ARCFU 30S ribosomal protein S6e OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps6e PE=3 SV=1 1 117 5.0E-10
sp|P21509|RS6E_HALMA 30S ribosomal protein S6e OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps6e PE=1 SV=3 1 124 8.0E-10
sp|B0R815|RS6E_HALS3 30S ribosomal protein S6e OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rps6e PE=3 SV=1 27 118 8.0E-10
sp|Q9HMJ5|RS6E_HALSA 30S ribosomal protein S6e OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps6e PE=3 SV=1 27 118 8.0E-10
sp|A3MUD0|RS6E_PYRCJ 30S ribosomal protein S6e OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps6e PE=3 SV=1 1 124 3.0E-09
sp|Q0W8B4|RS6E_METAR 30S ribosomal protein S6e OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps6e PE=3 SV=1 1 132 3.0E-09
sp|A3DMS1|RS6E_STAMF 30S ribosomal protein S6e OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rps6e PE=3 SV=1 38 106 1.0E-08
sp|A1RUW1|RS6E_PYRIL 30S ribosomal protein S6e OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps6e PE=3 SV=1 1 124 3.0E-08
sp|Q8TQL4|RS6E_METAC 30S ribosomal protein S6e OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps6e PE=3 SV=1 1 124 3.0E-08
sp|A2BJZ7|RS6E_HYPBU 30S ribosomal protein S6e OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps6e PE=3 SV=1 38 114 6.0E-08
sp|Q8PU79|RS6E_METMA 30S ribosomal protein S6e OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps6e PE=3 SV=1 1 124 1.0E-07
sp|Q980A6|RS6E_SULSO 30S ribosomal protein S6e OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps6e PE=3 SV=1 22 115 2.0E-07
sp|Q9HLA6|RS6E_THEAC 30S ribosomal protein S6e OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps6e PE=3 SV=1 30 117 2.0E-07
sp|C3N772|RS6E_SULIY 30S ribosomal protein S6e OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rps6e PE=3 SV=1 22 115 3.0E-07
sp|C3MWZ2|RS6E_SULIM 30S ribosomal protein S6e OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rps6e PE=3 SV=2 22 115 3.0E-07
sp|A4WIK0|RS6E_PYRAR 30S ribosomal protein S6e OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps6e PE=3 SV=1 1 99 3.0E-07
sp|C3MR04|RS6E_SULIL 30S ribosomal protein S6e OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rps6e PE=3 SV=1 22 115 3.0E-07
sp|C4KID0|RS6E_SULIK 30S ribosomal protein S6e OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rps6e PE=3 SV=1 22 115 3.0E-07
sp|C3MZ52|RS6E_SULIA 30S ribosomal protein S6e OS=Sulfolobus islandicus (strain M.16.27) GN=rps6e PE=3 SV=1 22 115 3.0E-07
sp|A7IAP8|RS6E_METB6 30S ribosomal protein S6e OS=Methanoregula boonei (strain 6A8) GN=rps6e PE=3 SV=1 1 98 3.0E-06
sp|Q12Z92|RS6E_METBU 30S ribosomal protein S6e OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rps6e PE=3 SV=1 27 121 6.0E-06
sp|Q978W7|RS6E_THEVO 30S ribosomal protein S6e OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps6e PE=3 SV=1 5 121 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0043228 non-membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043226 organelle No
GO:1901576 organic substance biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0003674 molecular_function No
GO:0009059 macromolecule biosynthetic process No
GO:0005198 structural molecule activity No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0009058 biosynthetic process No
GO:0043043 peptide biosynthetic process No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7488
MKLNISYPANGSQKLIDIEDERKLAIFMEKRMGAEVPGDSVGDEFKGYIFRITGGNDKQGFPMKQGVMHPSRVRL
LLSEGHSCYRPRRTGERKRKSVRGCIVGMDLSVLALSIIKQGDSDIPGLTDVVHPKRLGPKRATKIRKFFGLTKD
DDVRKYVIRREVQPKGEGKKPYTKAPKIQRLVTPQRLQHKRHRAALKRRQSEKVKDEANEYAQILAKRVAEAKAH
KADVRKRRASSMRK*
Coding >OphauB2|7488
ATGAAGTTGAACATTAGCTACCCTGCCAATGGCAGCCAAAAGCTCATCGACATTGAAGATGAGCGCAAGCTCGCC
ATATTTATGGAGAAGCGCATGGGTGCTGAGGTTCCTGGCGATTCAGTCGGCGACGAGTTCAAGGGCTACATCTTC
CGCATCACCGGTGGCAACGACAAGCAAGGCTTTCCCATGAAGCAGGGCGTCATGCACCCTAGTCGTGTCCGTCTC
TTGCTCTCCGAGGGCCACTCGTGCTACCGCCCCCGTCGTACCGGCGAGCGCAAGCGAAAGTCTGTCCGTGGCTGC
ATAGTCGGCATGGATCTTTCTGTCCTCGCCCTTAGCATCATCAAGCAGGGCGACAGCGATATCCCCGGCTTGACC
GACGTCGTCCACCCCAAGCGCCTCGGTCCCAAACGCGCCACCAAGATTCGCAAGTTCTTCGGCCTCACCAAGGAT
GACGATGTCCGCAAATATGTCATTCGCCGCGAAGTCCAGCCCAAGGGCGAGGGCAAGAAGCCTTATACCAAGGCC
CCCAAGATCCAGCGGCTCGTCACTCCCCAACGCCTCCAACATAAGCGCCATCGCGCTGCTCTCAAGAGGCGCCAG
TCCGAAAAGGTCAAGGACGAGGCCAACGAATACGCTCAGATTCTGGCCAAGCGCGTAGCCGAAGCCAAGGCCCAC
AAGGCCGACGTTCGGAAGCGACGGGCAAGCTCCATGCGCAAATAG
Transcript >OphauB2|7488
ATGAAGTTGAACATTAGCTACCCTGCCAATGGCAGCCAAAAGCTCATCGACATTGAAGATGAGCGCAAGCTCGCC
ATATTTATGGAGAAGCGCATGGGTGCTGAGGTTCCTGGCGATTCAGTCGGCGACGAGTTCAAGGGCTACATCTTC
CGCATCACCGGTGGCAACGACAAGCAAGGCTTTCCCATGAAGCAGGGCGTCATGCACCCTAGTCGTGTCCGTCTC
TTGCTCTCCGAGGGCCACTCGTGCTACCGCCCCCGTCGTACCGGCGAGCGCAAGCGAAAGTCTGTCCGTGGCTGC
ATAGTCGGCATGGATCTTTCTGTCCTCGCCCTTAGCATCATCAAGCAGGGCGACAGCGATATCCCCGGCTTGACC
GACGTCGTCCACCCCAAGCGCCTCGGTCCCAAACGCGCCACCAAGATTCGCAAGTTCTTCGGCCTCACCAAGGAT
GACGATGTCCGCAAATATGTCATTCGCCGCGAAGTCCAGCCCAAGGGCGAGGGCAAGAAGCCTTATACCAAGGCC
CCCAAGATCCAGCGGCTCGTCACTCCCCAACGCCTCCAACATAAGCGCCATCGCGCTGCTCTCAAGAGGCGCCAG
TCCGAAAAGGTCAAGGACGAGGCCAACGAATACGCTCAGATTCTGGCCAAGCGCGTAGCCGAAGCCAAGGCCCAC
AAGGCCGACGTTCGGAAGCGACGGGCAAGCTCCATGCGCAAATAG
Gene >OphauB2|7488
ATGAAGGTGAGCTTTGGCGCACAAGAAATCTACTTCAATTCTATACCCCAGCGCCCTTTCCCTTGCACATCCGCC
TCTACCTCGACAAGCAATAATTGGCTGACATTGCTCCCACAGTTGAACATTAGCTACCCTGCCAATGGCAGCCAA
AAGCTCATCGACATTGAAGATGAGCGCAAGCTCGCCATATTTATGGAGAAGCGCGTACGTCAGCTCCCCTTGGAT
GATTCCTCTCGACGGCGCGCCATCGAGGCTCCACGGCTAACTCTTGCTTCATCTTCCAGATGGGTGCTGAGGTTC
CTGGCGATTCAGTCGGCGACGAGTTCAAGGGCTACATCTTCCGCATCACCGGTGGCAACGACAAGCAAGGCTTTC
CCATGAAGCAGGGCGTCATGCACCCTAGTCGTGTCCGTCTCTTGCTCTCCGAGGGCCACTCGTGCTACCGCCCCC
GTCGTACCGGCGAGCGCAAGCGAAAGTCTGTCCGTGGCTGCATAGTCGGCATGGATCTTTCTGTCCTCGCCCTTA
GCATCATCAAGCAGGGCGACAGCGATATCCCCGGCTTGACCGACGTCGTCCACCCCAAGCGCCTCGGTCCCAAAC
GCGCCACCAAGATTCGCAAGTTCTTCGGCCTCACCAAGGATGACGATGTATGTTTGCCCCAGCTCCCATACTCGA
TCATCGCCTATCCGGGGCTGCGGCGGTGGCAAAAGCAGTCCGGGTAGAGTGTGAGAGGCATCGCCTCCCGTCTTG
TTTTGAAGGACAAGCCTCAAGACAAGACTGGGCGGGTTAGATGGAAAAATACCCTTGAGACAACTCTTTGAGACT
AATCGGGACCCAAAATCTCAGGTCCGCAAATATGTCATTCGCCGCGAAGTCCAGCCCAAGGGCGAGGGCAAGAAG
CCTTATACCAAGGCCCCCAAGATCCAGCGGCTCGTCACTCCCCAACGCCTCCAACATAAGCGCCATCGCGCTGCT
CTCAAGAGGCGCCAGTCCGAAAAGGTCAAGGACGAGGCCGTGAGTAACCCATCTTTCAACTACTGTTCATGTGTC
ACCAACGTATAAGTCATGGGACTAACCGTGACGCAGAACGAATACGCTCAGATTCTGGCCAAGCGCGTAGCCGAA
GCCAAGGCCCACAAGGCCGACGTTCGGAAGCGACGGGCAAGCTCCATGCGCAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail