Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7487
Gene name
LocationContig_8:238427..250929
Strand+
Gene length (bp)12502
Transcript length (bp)11655
Coding sequence length (bp)11655
Protein length (aa) 3885

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06025 DUF913 Domain of Unknown Function (DUF913) 4.0E-128 575 1007
PF06012 DUF908 Domain of Unknown Function (DUF908) 3.9E-115 119 507
PF00632 HECT HECT-domain (ubiquitin-transferase) 1.1E-90 3579 3883
PF14377 UBM Ubiquitin binding region 2.2E-08 2926 2958
PF14377 UBM Ubiquitin binding region 3.2E-07 2968 3001
PF14377 UBM Ubiquitin binding region 6.9E-06 3020 3049

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4Z1|TOM1_NEUCR E3 ubiquitin-protein ligase TOM1-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B11B22.010 PE=3 SV=4 1 3884 0.0E+00
sp|O13834|PTR1_SCHPO E3 ubiquitin-protein ligase ptr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr1 PE=1 SV=1 2715 3884 0.0E+00
sp|Q756G2|TOM1_ASHGO Probable E3 ubiquitin-protein ligase TOM1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TOM1 PE=3 SV=2 2963 3884 0.0E+00
sp|Q03280|TOM1_YEAST E3 ubiquitin-protein ligase TOM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM1 PE=1 SV=1 2969 3884 2.0E-178
sp|P51593|HUWE1_RAT E3 ubiquitin-protein ligase HUWE1 (Fragment) OS=Rattus norvegicus GN=Huwe1 PE=1 SV=2 3564 3884 4.0E-122
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4Z1|TOM1_NEUCR E3 ubiquitin-protein ligase TOM1-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B11B22.010 PE=3 SV=4 1 3884 0.0E+00
sp|O13834|PTR1_SCHPO E3 ubiquitin-protein ligase ptr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr1 PE=1 SV=1 2715 3884 0.0E+00
sp|Q756G2|TOM1_ASHGO Probable E3 ubiquitin-protein ligase TOM1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TOM1 PE=3 SV=2 2963 3884 0.0E+00
sp|Q03280|TOM1_YEAST E3 ubiquitin-protein ligase TOM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM1 PE=1 SV=1 2969 3884 2.0E-178
sp|P51593|HUWE1_RAT E3 ubiquitin-protein ligase HUWE1 (Fragment) OS=Rattus norvegicus GN=Huwe1 PE=1 SV=2 3564 3884 4.0E-122
sp|Q7Z6Z7|HUWE1_HUMAN E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens GN=HUWE1 PE=1 SV=3 3502 3884 2.0E-119
sp|Q7TMY8|HUWE1_MOUSE E3 ubiquitin-protein ligase HUWE1 OS=Mus musculus GN=Huwe1 PE=1 SV=5 3502 3884 2.0E-119
sp|Q8GY23|UPL1_ARATH E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis thaliana GN=UPL1 PE=1 SV=3 3514 3884 4.0E-114
sp|Q8H0T4|UPL2_ARATH E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis thaliana GN=UPL2 PE=1 SV=3 3403 3884 1.0E-113
sp|A1D3C5|RSP5_NEOFI Probable E3 ubiquitin-protein ligase hulA OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hulA PE=3 SV=1 3556 3884 3.0E-100
sp|Q4WTF3|RSP5_ASPFU Probable E3 ubiquitin-protein ligase hulA OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hulA PE=3 SV=2 3556 3884 4.0E-100
sp|B0XQ72|RSP5_ASPFC Probable E3 ubiquitin-protein ligase hulA OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=hulA PE=3 SV=2 3556 3884 4.0E-100
sp|Q0CCL1|RSP5_ASPTN Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hulA PE=3 SV=1 3556 3884 5.0E-100
sp|A2QQ28|RSP5_ASPNC Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hulA PE=3 SV=1 3556 3884 6.0E-100
sp|B8N7E5|RSP5_ASPFN Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=hulA PE=3 SV=1 3556 3884 8.0E-100
sp|A1CQG2|RSP5_ASPCL Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hulA PE=3 SV=2 3556 3884 1.0E-98
sp|Q5BDP1|RSP5_EMENI E3 ubiquitin-protein ligase RSP5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hulA PE=1 SV=1 3556 3884 2.0E-98
sp|Q2UBP1|RSP5_ASPOR Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hulA PE=3 SV=2 3556 3884 3.0E-98
sp|P39940|RSP5_YEAST E3 ubiquitin-protein ligase RSP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSP5 PE=1 SV=1 3556 3884 3.0E-96
sp|Q92462|PUB1_SCHPO E3 ubiquitin-protein ligase pub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pub1 PE=1 SV=2 3556 3884 6.0E-96
sp|O14326|PUB3_SCHPO E3 ubiquitin-protein ligase pub3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pub3 PE=2 SV=1 3556 3874 2.0E-95
sp|Q9VVI3|NEDD4_DROME E3 ubiquitin-protein ligase Nedd-4 OS=Drosophila melanogaster GN=Nedd4 PE=1 SV=2 3545 3884 3.0E-95
sp|Q96PU5|NED4L_HUMAN E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens GN=NEDD4L PE=1 SV=2 3517 3882 1.0E-94
sp|Q5RBF2|NED4L_PONAB E3 ubiquitin-protein ligase NEDD4-like OS=Pongo abelii GN=NEDD4L PE=2 SV=1 3517 3882 2.0E-94
sp|Q8CFI0|NED4L_MOUSE E3 ubiquitin-protein ligase NEDD4-like OS=Mus musculus GN=Nedd4l PE=1 SV=2 3517 3882 2.0E-94
sp|A9JRZ0|SMUF2_DANRE E3 ubiquitin-protein ligase SMURF2 OS=Danio rerio GN=smurf2 PE=2 SV=1 3554 3884 8.0E-94
sp|A2A5Z6|SMUF2_MOUSE E3 ubiquitin-protein ligase SMURF2 OS=Mus musculus GN=Smurf2 PE=1 SV=1 3554 3884 2.0E-92
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 3545 3884 4.0E-92
sp|Q9HAU4|SMUF2_HUMAN E3 ubiquitin-protein ligase SMURF2 OS=Homo sapiens GN=SMURF2 PE=1 SV=1 3554 3884 5.0E-92
sp|Q2TAS2|SMUF2_XENLA E3 ubiquitin-protein ligase SMURF2 OS=Xenopus laevis GN=smurf2 PE=2 SV=1 3554 3884 1.0E-91
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 3547 3884 6.0E-91
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 3547 3884 2.0E-90
sp|P46935|NEDD4_MOUSE E3 ubiquitin-protein ligase NEDD4 OS=Mus musculus GN=Nedd4 PE=1 SV=3 3555 3877 8.0E-90
sp|P46934|NEDD4_HUMAN E3 ubiquitin-protein ligase NEDD4 OS=Homo sapiens GN=NEDD4 PE=1 SV=4 3555 3877 8.0E-89
sp|Q9CUN6|SMUF1_MOUSE E3 ubiquitin-protein ligase SMURF1 OS=Mus musculus GN=Smurf1 PE=2 SV=2 3556 3884 9.0E-89
sp|Q9PUN2|SMUF1_XENLA E3 ubiquitin-protein ligase SMURF1 OS=Xenopus laevis GN=smurf1 PE=2 SV=1 3556 3884 1.0E-88
sp|Q62940|NEDD4_RAT E3 ubiquitin-protein ligase NEDD4 OS=Rattus norvegicus GN=Nedd4 PE=1 SV=1 3555 3877 2.0E-88
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 3559 3884 3.0E-88
sp|Q9HCE7|SMUF1_HUMAN E3 ubiquitin-protein ligase SMURF1 OS=Homo sapiens GN=SMURF1 PE=1 SV=2 3556 3884 7.0E-88
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 3559 3884 1.0E-86
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 3559 3884 1.0E-86
sp|Q9V853|SMUF1_DROME E3 ubiquitin-protein ligase Smurf1 OS=Drosophila melanogaster GN=lack PE=1 SV=3 3556 3884 1.0E-86
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 3559 3884 2.0E-86
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 3559 3884 3.0E-86
sp|Q9DBH0|WWP2_MOUSE NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Mus musculus GN=Wwp2 PE=1 SV=1 3556 3882 7.0E-86
sp|Q8C863|ITCH_MOUSE E3 ubiquitin-protein ligase Itchy OS=Mus musculus GN=Itch PE=1 SV=2 3556 3882 3.0E-85
sp|Q9Y0H4|SUDX_DROME E3 ubiquitin-protein ligase Su(dx) OS=Drosophila melanogaster GN=Su(dx) PE=1 SV=1 3556 3874 4.0E-85
sp|Q96J02|ITCH_HUMAN E3 ubiquitin-protein ligase Itchy homolog OS=Homo sapiens GN=ITCH PE=1 SV=2 3556 3882 5.0E-85
sp|O00308|WWP2_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Homo sapiens GN=WWP2 PE=1 SV=2 3556 3882 9.0E-85
sp|Q9H0M0|WWP1_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Homo sapiens GN=WWP1 PE=1 SV=1 3556 3882 2.0E-82
sp|Q8BZZ3|WWP1_MOUSE NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Mus musculus GN=Wwp1 PE=1 SV=2 3556 3882 4.0E-82
sp|Q9UTG2|PUB2_SCHPO E3 ubiquitin-protein ligase pub2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pub2 PE=1 SV=1 3546 3880 1.0E-80
sp|Q6I6G8|HECW2_MOUSE E3 ubiquitin-protein ligase HECW2 OS=Mus musculus GN=Hecw2 PE=1 SV=1 3542 3880 2.0E-78
sp|Q76N89|HECW1_HUMAN E3 ubiquitin-protein ligase HECW1 OS=Homo sapiens GN=HECW1 PE=1 SV=3 3542 3880 2.0E-78
sp|Q9P2P5|HECW2_HUMAN E3 ubiquitin-protein ligase HECW2 OS=Homo sapiens GN=HECW2 PE=1 SV=2 3542 3880 2.0E-78
sp|Q8K4P8|HECW1_MOUSE E3 ubiquitin-protein ligase HECW1 OS=Mus musculus GN=Hecw1 PE=1 SV=3 3542 3880 2.0E-78
sp|O15033|AREL1_HUMAN Apoptosis-resistant E3 ubiquitin protein ligase 1 OS=Homo sapiens GN=AREL1 PE=1 SV=3 3544 3882 5.0E-55
sp|Q8CHG5|AREL1_MOUSE Apoptosis-resistant E3 ubiquitin protein ligase 1 OS=Mus musculus GN=Arel1 PE=2 SV=2 3544 3882 5.0E-55
sp|Q8RWB8|UPL6_ARATH E3 ubiquitin-protein ligase UPL6 OS=Arabidopsis thaliana GN=UPL6 PE=2 SV=1 3564 3875 4.0E-54
sp|Q1K9C4|YFK7_SCHPO Probable E3 ubiquitin protein ligase C167.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC167.07c PE=2 SV=1 3542 3884 6.0E-52
sp|Q5RD78|HECD2_PONAB Probable E3 ubiquitin-protein ligase HECTD2 OS=Pongo abelii GN=HECTD2 PE=2 SV=1 3556 3882 3.0E-49
sp|Q5U5R9|HECD2_HUMAN Probable E3 ubiquitin-protein ligase HECTD2 OS=Homo sapiens GN=HECTD2 PE=2 SV=2 3556 3882 9.0E-49
sp|Q05086|UBE3A_HUMAN Ubiquitin-protein ligase E3A OS=Homo sapiens GN=UBE3A PE=1 SV=4 3556 3880 1.0E-48
sp|O08759|UBE3A_MOUSE Ubiquitin-protein ligase E3A OS=Mus musculus GN=Ube3a PE=1 SV=2 3556 3880 2.0E-48
sp|Q8CDU6|HECD2_MOUSE Probable E3 ubiquitin-protein ligase HECTD2 OS=Mus musculus GN=Hectd2 PE=1 SV=2 3556 3882 3.0E-48
sp|Q9SCQ2|UPL7_ARATH E3 ubiquitin-protein ligase UPL7 OS=Arabidopsis thaliana GN=UPL7 PE=2 SV=1 3564 3880 1.0E-47
sp|Q757T0|HUL4_ASHGO Probable E3 ubiquitin-protein ligase HUL4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HUL4 PE=3 SV=1 3557 3883 7.0E-47
sp|Q9SU29|UPL5_ARATH E3 ubiquitin-protein ligase UPL5 OS=Arabidopsis thaliana GN=UPL5 PE=1 SV=1 3542 3876 6.0E-46
sp|Q15386|UBE3C_HUMAN Ubiquitin-protein ligase E3C OS=Homo sapiens GN=UBE3C PE=1 SV=3 3562 3874 7.0E-45
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 3557 3874 8.0E-45
sp|P53119|HUL5_YEAST Probable E3 ubiquitin-protein ligase HUL5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HUL5 PE=1 SV=1 3542 3880 2.0E-44
sp|Q9ES34|UBE3B_MOUSE Ubiquitin-protein ligase E3B OS=Mus musculus GN=Ube3b PE=1 SV=3 3564 3880 2.0E-44
sp|Q7Z3V4|UBE3B_HUMAN Ubiquitin-protein ligase E3B OS=Homo sapiens GN=UBE3B PE=1 SV=3 3564 3880 5.0E-44
sp|Q80U95|UBE3C_MOUSE Ubiquitin-protein ligase E3C OS=Mus musculus GN=Ube3c PE=1 SV=2 3562 3874 6.0E-44
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 3557 3874 1.0E-43
sp|Q08CZ0|UBE3B_XENTR Ubiquitin-protein ligase E3B OS=Xenopus tropicalis GN=ube3b PE=2 SV=1 3564 3880 1.0E-43
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 3557 3874 8.0E-41
sp|P40985|HUL4_YEAST Probable E3 ubiquitin-protein ligase HUL4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HUL4 PE=1 SV=2 3549 3883 3.0E-38
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 3559 3874 3.0E-36
sp|O94275|MUG30_SCHPO Probable E3 ubiquitin-protein ligase mug30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug30 PE=1 SV=1 3557 3880 4.0E-33
sp|Q15034|HERC3_HUMAN Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 3544 3884 5.0E-33
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 3558 3874 8.0E-32
sp|O13834|PTR1_SCHPO E3 ubiquitin-protein ligase ptr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr1 PE=1 SV=1 2076 2616 9.0E-32
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 3558 3874 2.0E-31
sp|Q9UII4|HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens GN=HERC5 PE=1 SV=2 3556 3874 6.0E-31
sp|P51592|HYD_DROME E3 ubiquitin-protein ligase hyd OS=Drosophila melanogaster GN=hyd PE=1 SV=3 3613 3884 1.0E-29
sp|Q756G2|TOM1_ASHGO Probable E3 ubiquitin-protein ligase TOM1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TOM1 PE=3 SV=2 1627 2500 7.0E-29
sp|Q8IVU3|HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 3544 3874 1.0E-28
sp|Q9LYZ7|UPL4_ARATH E3 ubiquitin-protein ligase UPL4 OS=Arabidopsis thaliana GN=UPL4 PE=3 SV=1 3556 3881 8.0E-28
sp|B4F6W9|TRIPC_XENTR E3 ubiquitin-protein ligase TRIP12 OS=Xenopus tropicalis GN=trip12 PE=2 SV=1 3616 3881 1.0E-27
sp|F2Z461|HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus GN=Herc6 PE=2 SV=1 3556 3880 2.0E-27
sp|F1RCR6|TRIPC_DANRE E3 ubiquitin-protein ligase TRIP12 OS=Danio rerio GN=trip12 PE=3 SV=1 3582 3881 5.0E-27
sp|G5E870|TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus GN=Trip12 PE=1 SV=1 3616 3881 6.0E-27
sp|E1B7Q7|TRIPC_BOVIN E3 ubiquitin-protein ligase TRIP12 OS=Bos taurus GN=TRIP12 PE=2 SV=2 3616 3881 8.0E-27
sp|Q14669|TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens GN=TRIP12 PE=1 SV=1 3616 3881 1.0E-26
sp|F1LP64|TRIPC_RAT E3 ubiquitin-protein ligase TRIP12 OS=Rattus norvegicus GN=Trip12 PE=1 SV=1 3616 3881 2.0E-26
sp|Q03280|TOM1_YEAST E3 ubiquitin-protein ligase TOM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM1 PE=1 SV=1 1705 2368 3.0E-26
sp|Q62671|UBR5_RAT E3 ubiquitin-protein ligase UBR5 OS=Rattus norvegicus GN=Ubr5 PE=1 SV=3 3609 3883 3.0E-26
sp|Q80TP3|UBR5_MOUSE E3 ubiquitin-protein ligase UBR5 OS=Mus musculus GN=Ubr5 PE=1 SV=2 3609 3883 3.0E-26
sp|O95071|UBR5_HUMAN E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens GN=UBR5 PE=1 SV=2 3609 3883 4.0E-26
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 3558 3874 1.0E-25
sp|O13834|PTR1_SCHPO E3 ubiquitin-protein ligase ptr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr1 PE=1 SV=1 350 873 3.0E-24
sp|Q3U487|HECD3_MOUSE E3 ubiquitin-protein ligase HECTD3 OS=Mus musculus GN=Hectd3 PE=1 SV=2 3618 3873 8.0E-24
sp|Q5T447|HECD3_HUMAN E3 ubiquitin-protein ligase HECTD3 OS=Homo sapiens GN=HECTD3 PE=1 SV=1 3618 3873 4.0E-23
sp|P33202|UFD4_YEAST Ubiquitin fusion degradation protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UFD4 PE=1 SV=1 3611 3881 2.0E-22
sp|Q8SSY6|SPKUL_DICDI Bifunctional serine/threonine-protein kinase/NEDD4-like E3 ubiquitin-protein ligase OS=Dictyostelium discoideum GN=DDB_G0276527 PE=3 SV=2 3618 3884 3.0E-22
sp|Q6WWW4|UPL3_ARATH E3 ubiquitin-protein ligase UPL3 OS=Arabidopsis thaliana GN=UPL3 PE=1 SV=1 3617 3881 2.0E-21
sp|Q10435|YDE1_SCHPO Probable ubiquitin fusion degradation protein C12B10.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12B10.01c PE=3 SV=2 3611 3881 1.0E-20
sp|Q8H0T4|UPL2_ARATH E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis thaliana GN=UPL2 PE=1 SV=3 366 1012 1.0E-17
sp|Q9ULT8|HECD1_HUMAN E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens GN=HECTD1 PE=1 SV=3 3695 3876 1.0E-17
sp|Q756G2|TOM1_ASHGO Probable E3 ubiquitin-protein ligase TOM1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TOM1 PE=3 SV=2 452 879 5.0E-17
sp|Q69ZR2|HECD1_MOUSE E3 ubiquitin-protein ligase HECTD1 OS=Mus musculus GN=Hectd1 PE=1 SV=2 3695 3876 2.0E-16
sp|O13834|PTR1_SCHPO E3 ubiquitin-protein ligase ptr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr1 PE=1 SV=1 46 175 3.0E-15
sp|Q03280|TOM1_YEAST E3 ubiquitin-protein ligase TOM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM1 PE=1 SV=1 377 879 3.0E-15
sp|Q8GY23|UPL1_ARATH E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis thaliana GN=UPL1 PE=1 SV=3 350 1012 1.0E-14
sp|Q7Z6Z7|HUWE1_HUMAN E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens GN=HUWE1 PE=1 SV=3 2932 3181 8.0E-14
sp|Q7TMY8|HUWE1_MOUSE E3 ubiquitin-protein ligase HUWE1 OS=Mus musculus GN=Huwe1 PE=1 SV=5 2932 3181 4.0E-13
sp|C6KTB7|ALTH1_PLAF7 Putative E3 ubiquitin-protein ligase protein PFF1365c OS=Plasmodium falciparum (isolate 3D7) GN=PFF1365c PE=3 SV=1 3615 3878 3.0E-10
sp|Q8GY23|UPL1_ARATH E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis thaliana GN=UPL1 PE=1 SV=3 2932 3075 1.0E-09
sp|Q9Y4D8|HECD4_HUMAN Probable E3 ubiquitin-protein ligase HECTD4 OS=Homo sapiens GN=HECTD4 PE=1 SV=5 3546 3874 3.0E-09
sp|Q03280|TOM1_YEAST E3 ubiquitin-protein ligase TOM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM1 PE=1 SV=1 2902 3000 5.0E-08
sp|Q7TMY8|HUWE1_MOUSE E3 ubiquitin-protein ligase HUWE1 OS=Mus musculus GN=Huwe1 PE=1 SV=5 377 1116 6.0E-08
sp|Q7Z6Z7|HUWE1_HUMAN E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens GN=HUWE1 PE=1 SV=3 377 1116 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004842 ubiquitin-protein transferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0019787 ubiquitin-like protein transferase activity No
GO:0140096 catalytic activity, acting on a protein No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup790
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2080
Ophiocordyceps australis 1348a (Ghana) OphauG2|2081
Ophiocordyceps australis map64 (Brazil) OphauB2|7487 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06565
Ophiocordyceps camponoti-rufipedis Ophun1|3633
Ophiocordyceps kimflemingae Ophio5|819
Ophiocordyceps subramaniannii Hirsu2|3177
Ophiocordyceps subramaniannii Hirsu2|3178

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7487
MGKITKVMQARHKETMSPWLENFVLTASEASLPSLPKQLASFPSRWPFSRGDLYHWIPLLNRFDSILEQLCKTYN
LSQGPQSRDFGCDLLLNQCKDSIFHNETAWNESQLMQMGYPPDGDRVLAEATLEFTRMLLEHCGNRSIYASSAHL
NDLLNSTSLSILISTLKVGVELAQRYQASVKRLAQNTSRLISTALLTNHYNIDLDRVQQLAMPFVKTPIASLSES
VTLTTPVANKGKDKAHGGGSRVATSMYANDLVAVATSDDKQWKEWEDVKVYYFPLDIPTAPMAYSDPSRSTIPTI
PTTPTPLRKASTSMSAQQHSTPKSRNISADDSSPITPRTPGLIEDSVNPGQKLFEVPRSVVAALPLHQLVLRCPD
DMPPASKYEAFNRLRVAKALGSSIESRRQILAVRLLAISNLAYIHSDSNFVEKVLRHDNDETRRYQLVYQLSELI
HPSADNNIEVPLWLQSIGLSLLEAMSGIHSKAQDLSSALNTNVNHGILLYVIRKAVAGMASDVDDQDNGDHTTEL
DEWRNSLFSLTLHLSMQPRVGSEMVSAGLMDALVEVLSLRTRISQRHHAMVMAFLDGLIWSFQTAFVIFLQANGL
DAVSKLLVDTVTDTQSWLTTSKPIGPEHRSSAVDYQIPYYKQQTLKWLTRFIHHIMTSAYSFSGNTDRLLRNLAE
KSDLLGSLRDIIQDKERYGSVVWTNSVTILSDFINNDPANYAAIMESGMIKTFLEAVTNRSIPAHLADSKRDDSG
DDEGSSDSSAISTLISQDERSHPPSEDMLQHEERGPLAAGILASSDAINIVPHVLSSISLNNSGMKMVVLSRAID
AFFQVFESPAHVKCLDMECDLVQNIGNNFDEFARHHPPLRPCISNAVIDLVARLRFLGLEKSRTAGWGAKLFIAS
RDGSLLSVNEFGVLEDASHLSPQVREQAILGDTDVDMSDVVAPDELRPSKRGNGEPGAHMESITPYIHALANFLA
AYLNNATLKMMFIRKGGIELLLDICESPSLPASFGESAASRVLNQVVSQLVEQSPVRALPSLLRRAQASVDVLGP
LAAKTRNLPPYFAPFLAPDLGRSRNEPETSTSVATGTTLVKGLLNAQTFIKIIADCFVTTRSSGLSFYPVNVYDY
YLTLVKSIGPLLRGVLAEEAAELSVVPQHWSLRRHSSLGDNNTSSSADGGMDDAPLSGVLNAASSWGATTADASD
GAPAARPTEQEQSSPRFQNYETLRVLLHPMIPTSFPFLQSLGRSLLPRRSEPIHPEPYSRSRHLDLAKALANSIL
SHLRASVASPGPTSKEFHYWIIMLHTINEMLIDHPSGRQSDRSNVHIILPVLLAFKEQGGLRVLNSMLGVYSRSV
RQSTENPSDEASSKAKVAAFGLKKVLDLYFLLVNGKYLSDTTTYFNIQARNADRANSLALIQQIVVDIRAAILPS
IMELWDSDFVHKVPDTTVKRLLDILKLISAGENEPQTISKQLVPFSCFNYDDARFSWKPLQNVINETVGAGYDED
LAQEAAYRALGHTLATQEYCRAHKEGLAGPRNPVPVEDANVPRLSPTRQEPTSQDRDPSSGPSMPDAERMSLDSL
PDLTTEGLREMIGRSDQLAEGGQESTSGQKATTLATSSEEATKIQHAASQLATAKENLDNMRAKLRDSLIDQCLD
VIRAHPETAIEVSDLIISVVLRRQNSEAHADVASTLTQALSSLGTDDEERKRNGSCIAAYAHLLALLLQDEKFFE
RNMKILEDRVEDYISFLRVPMSSSTDDLPPWIPFILLILEFFLCHDERPVAAEWTAPKSLEEPIAQPVIQTSTVL
VNDQQRSQILNSLLDLLPRIGKEETLATSVLRVLMILTRRRQAAKAVGEKKNLQRLFLMAKQLSGSGSERLKQTR
LTTHIITILRHVIEDEEIIKQIMRAEIQTEFPNIQRNQRGPTDVTSYLRAMASIALRAPELFVDVSNELLEFTRW
HSGPVEGIRSQPLGLKASHKDKDQTKSANEEAQQETHQDLDVKQSTEPADKEMVDAPRIQHDSKRPVVENPDGVI
HFLLCELVNYREVDDKEPPVAEKESKSESRESSTQSIQAAAASNVTPTSKDKKPSKPVFKAEEHPIFVYRCFLLN
CLAELLQSYTRTKVEFINFKRSAPPLTTQTPIKPRSSILNYLIYDLLCQGNLNGTTDTIASKKKAATSSLTQKVL
VALVTKTSERPMENIRDKFAHDDEPDLLFVRKFVLDTILKAYEKAPLADEPLETRYTRMQCLAELMNCIVGEKDK
DVPSTASRSVNMQLRSQAQLRRLMYEKGFVEKLTSSIAEISLNYPGVKRAIKYILRVLRVLTATAKELSLLNLVG
EPISDPAAADQSDEDFASTSSLSDLLDDREETPDLYRNSALGMLEPRGPDDESEDEDDDEDEDMYGDEYEDEDME
EMSDEEDDISEDEELGEMGEIEGLHGDSGVVEVIMDGDEDDDETSDDDDDDDDDDDDELDSADMEDIEDRVEIVD
EEGNPMEEDGDSGWESESDGEDEEGAEAEDLDFEAEAQDEDEVHMHDMVPSEVIDNMARAMMRDDGYDGEEFGLL
DDGEDEAEDEEEQEEDEEFMYGQFDNDEPPSVPAPAITWETMNVNANEDHRQMVFIDGGRRPVVTRMDRGPFHSR
FMTASNRDHMDFRSYFSRGNRTTHAQPNAEDGVNPLLRRHRHGSDAPPRSGHGHSVGLRLPEGVFGGGRHGIDGP
MGLLGELMEFLPMMSRNGGGQAFHFHIAGPTGSREARDVGTSRLSRSDQRREGAGQEPHQAVSFSPESTLDRYQG
EARMIFGTNMAADASKLGNIITGKLAPLAIEQEKKMKMGEEENKKKREEERKQREEEERKAREDNAAVQAAMDQI
EAEARQALERNAAGAEQQDGDTSHEEGEERQDESGGAMEGVEMCVSATGHGDDGEEGRGESGSQRRVLTTLRGEQ
VDVTELGIDPDYLAALPEEFREEVIAQTVSERRSQAREGAAIAGGEPTEVFQEFLDALPEELRLEIAQQERQDER
RRLREESRRQAQAGGGSAMAADMDPASILLTFPPELREQALIDQGEDLMDQLPPEMAAQARALAQARAPHDQSVS
QQQQGIRSVVTTGRVASGTSRATEAVVRRETETIVRAPRRTVVQMLDKSGIATLLRLMFIAQQGSIRNYLFSVFA
DVCENRQNRLEVISSLLQILQEGSTDMNAVERSFSQLSLRARRSKEKDGEQKTAHSFKRTLSSLGLVGSVQTNSE
TSPLLVVQQCLDLLVELCTRSYQVPWLFLTEHEIVGSTLKRALSRKGKVKDTKAHKYAINSLLTLLDRDLVTDST
PVMTHLADLLNQVTLPLQNLERRRREALQAAKESSGPGQGEAGDTAGPEAAAAGSAAQRSDAEADKESAQKRHRQ
LHPPVIPAQNLTLVNLSTIPGAKETFGQELAVTGTEIQGNKLLRVLTALDHLFDTSKKKTRDKADEAAMERDKQF
LVTSLYHNSTFAAMWDKLGACLSAIRKREAMLNVATILLPLIESLMVDMLLSSPPPESRTASLFFSFTEEHRRIL
NELNPKVLEFDNKRNYFNRSLSSGDEMKFGKLNIRFHGEEGVDAGGVTREWFQVLARQMFDPNYALFIPVSSDRT
TFHPNKLSGINDEHLMFFKFIGRIIGKALYEGRLLDCFFSRAVYKRILGKSVSVKDMESFDPDYYKSLCWMLDND
ITDIITETFSLEDDEFGVTTVVDLIPTGREIAVTEENKHEYVRLVVEHKLLSSVKDQMENFLKGFHEIVPAGLIS
IFNEQELELLISGLPDIDVDDWKSNTEYQNYNPSSQQIQWFWRVVRSFDKEERAKLLQFVTGTSKVPLNGFKELE
GMNGINRFNIHRDYGNKDRLPSSHTCFNQLDLPEYDSYDVLRSQILKAITQGSEYFGFA*
Coding >OphauB2|7487
ATGGGCAAGATCACAAAGGTTATGCAGGCTCGACACAAGGAGACTATGTCTCCCTGGCTAGAGAACTTTGTTCTC
ACCGCATCCGAGGCTTCGTTACCGTCCTTGCCAAAGCAGCTGGCTAGTTTTCCCTCTCGATGGCCGTTCAGTCGG
GGCGATCTCTACCATTGGATTCCGCTACTCAACCGATTCGATTCCATTCTTGAGCAGCTTTGCAAAACCTATAAT
CTGTCTCAAGGGCCTCAGTCTCGAGACTTTGGCTGTGATTTGCTGCTCAATCAATGCAAGGACTCCATCTTCCAT
AATGAAACAGCTTGGAATGAAAGCCAGTTGATGCAAATGGGCTATCCGCCAGATGGTGATAGAGTACTGGCAGAA
GCGACTCTGGAATTTACTCGCATGCTCCTAGAGCATTGCGGCAACAGGAGCATCTATGCCAGCAGTGCCCACCTC
AACGACTTACTCAATTCCACGTCTCTGTCCATACTAATTTCCACCTTGAAGGTGGGAGTCGAGCTTGCTCAGAGG
TATCAAGCGTCTGTTAAGAGACTTGCCCAGAATACTTCTCGGCTCATCAGCACCGCTCTGTTGACAAACCATTAC
AATATTGACCTTGATCGCGTGCAGCAGCTTGCCATGCCATTTGTCAAGACTCCAATAGCGAGTTTATCCGAATCT
GTGACCCTGACAACACCAGTTGCGAATAAGGGCAAGGATAAGGCACACGGCGGAGGCAGTAGAGTCGCTACATCC
ATGTATGCCAACGATCTCGTGGCTGTTGCGACTTCGGATGACAAGCAATGGAAGGAGTGGGAGGACGTGAAGGTC
TATTACTTTCCTCTTGATATCCCGACTGCCCCCATGGCATATTCGGATCCTAGCCGTTCGACTATTCCAACCATC
CCAACCACTCCTACACCCTTGCGCAAAGCTTCCACAAGCATGAGCGCTCAGCAACACAGCACGCCTAAGTCGCGA
AATATCTCAGCTGACGATTCCTCCCCAATCACTCCACGCACCCCTGGTCTTATTGAAGATTCAGTAAACCCAGGC
CAGAAGCTGTTTGAGGTGCCGAGATCAGTTGTTGCCGCCTTGCCTTTGCATCAGCTTGTTCTGCGGTGTCCTGAT
GACATGCCACCTGCTTCCAAGTACGAAGCATTCAATCGGCTTCGAGTTGCAAAGGCCCTAGGAAGTTCTATTGAA
TCACGCCGCCAGATCTTGGCTGTTCGACTCCTTGCCATTTCCAACTTGGCTTACATTCACTCTGACAGCAACTTT
GTTGAAAAAGTTCTACGTCATGACAACGACGAAACTCGAAGGTATCAACTCGTGTACCAACTTTCAGAGTTGATT
CACCCCTCTGCCGATAATAACATCGAGGTGCCTTTGTGGCTGCAGTCTATCGGGCTTAGTCTGCTTGAAGCTATG
TCTGGCATTCACTCCAAAGCACAAGATCTCTCGTCAGCTCTCAACACCAATGTTAATCATGGAATTCTTCTCTAC
GTCATCAGAAAGGCAGTGGCTGGAATGGCGAGTGATGTCGACGATCAAGACAACGGAGACCACACGACTGAACTT
GACGAGTGGCGCAACAGCCTTTTTTCTCTGACGCTTCATCTATCCATGCAACCACGTGTTGGGAGCGAGATGGTT
TCAGCAGGTTTGATGGATGCTCTGGTAGAGGTACTAAGTCTTCGCACAAGAATCTCGCAGAGGCACCATGCCATG
GTGATGGCCTTCTTGGACGGCTTGATTTGGTCTTTTCAGACGGCCTTTGTTATCTTCCTCCAGGCTAATGGCTTG
GATGCGGTGTCCAAATTGCTGGTGGACACTGTCACCGACACACAATCTTGGCTCACTACTTCTAAGCCCATTGGG
CCCGAGCACCGCTCAAGCGCTGTCGACTATCAGATCCCTTACTACAAGCAGCAGACGCTCAAATGGCTGACCAGG
TTCATACACCATATCATGACGAGTGCGTATTCGTTCAGTGGGAATACAGATCGCCTTTTACGGAACCTTGCCGAG
AAGTCTGACCTGCTCGGAAGTTTGCGTGACATCATCCAGGACAAAGAGAGATATGGCTCCGTGGTATGGACAAAC
TCGGTCACTATTTTGAGCGATTTCATCAACAACGATCCGGCAAACTATGCTGCGATAATGGAGTCTGGTATGATC
AAGACTTTTCTTGAGGCGGTCACGAACCGGTCCATTCCCGCCCATCTTGCCGACAGCAAGAGGGATGATAGCGGC
GATGACGAAGGGTCCTCGGATAGCTCAGCTATCTCAACTCTGATTAGTCAAGATGAGCGTTCCCATCCTCCTTCC
GAAGATATGCTGCAACATGAAGAACGTGGCCCTTTGGCCGCTGGCATCTTAGCGTCGTCGGACGCCATCAACATT
GTGCCTCACGTCCTGAGCTCCATTTCTCTCAATAACTCGGGGATGAAAATGGTGGTTCTGTCACGAGCCATCGAT
GCCTTTTTCCAGGTATTCGAAAGCCCTGCACATGTCAAGTGTCTCGACATGGAATGTGATCTGGTGCAAAATATT
GGAAACAATTTCGATGAGTTTGCTCGCCACCACCCGCCTCTGCGACCATGCATCTCTAATGCGGTTATCGATCTT
GTCGCCCGCTTGCGTTTTCTTGGTCTCGAGAAATCTCGCACGGCTGGCTGGGGCGCCAAACTCTTTATTGCGTCT
AGAGACGGCTCGCTGTTATCGGTAAATGAATTTGGAGTACTGGAGGATGCAAGTCACCTTTCACCTCAAGTTCGC
GAGCAAGCCATCTTGGGCGACACTGATGTTGACATGTCCGATGTTGTTGCTCCGGACGAGTTGAGGCCGTCGAAA
CGAGGCAATGGGGAGCCGGGGGCACACATGGAGTCAATCACGCCCTATATTCACGCACTGGCCAACTTTCTCGCT
GCATACCTGAACAACGCTACTCTCAAGATGATGTTTATACGCAAGGGCGGCATCGAGCTGCTTTTGGATATTTGT
GAATCGCCGAGTCTTCCAGCCTCCTTTGGGGAGTCTGCAGCATCAAGAGTACTCAATCAGGTTGTGTCGCAACTA
GTTGAACAGTCTCCTGTTCGCGCTCTTCCTTCCTTGCTGAGACGCGCTCAAGCCTCAGTGGATGTACTCGGACCT
CTAGCTGCCAAAACTCGAAATTTGCCACCATATTTTGCGCCCTTCCTCGCACCAGACCTAGGACGCTCGCGTAAT
GAGCCGGAGACATCCACAAGCGTCGCGACTGGCACGACGCTCGTCAAAGGCCTTCTCAATGCACAAACTTTTATA
AAGATTATAGCTGACTGCTTTGTCACGACAAGAAGCAGCGGGCTTTCCTTCTATCCAGTCAATGTCTATGATTAC
TACCTTACTCTGGTTAAGTCCATCGGGCCTCTGCTGCGAGGTGTCTTAGCAGAAGAGGCGGCAGAATTGTCTGTT
GTGCCCCAGCATTGGTCATTGAGGCGTCATTCTTCTCTGGGCGACAATAACACTTCCTCGAGTGCAGATGGCGGA
ATGGACGATGCGCCGCTTTCAGGAGTCTTGAACGCTGCGAGCAGTTGGGGCGCCACCACTGCAGACGCCAGCGAT
GGCGCCCCTGCGGCACGACCTACAGAACAAGAGCAGTCCAGTCCGCGGTTCCAAAATTACGAAACTTTGAGAGTG
TTGCTGCATCCCATGATTCCGACGTCTTTTCCCTTTCTGCAATCTTTGGGAAGATCTCTCCTGCCGAGGCGCAGC
GAGCCTATACATCCTGAACCCTACTCCAGAAGTCGACATCTCGATCTCGCAAAAGCTCTGGCCAATTCTATATTG
AGTCACTTGCGCGCTTCAGTTGCATCTCCGGGGCCAACGTCAAAGGAGTTTCATTACTGGATCATTATGCTTCAC
ACCATCAATGAAATGCTCATTGATCATCCGTCTGGAAGGCAAAGCGATCGCTCCAACGTGCACATCATTTTGCCT
GTTCTCCTTGCTTTCAAGGAGCAGGGAGGCTTGAGAGTGCTCAATTCGATGCTTGGGGTCTATTCTCGCTCTGTT
CGGCAGTCTACAGAGAATCCATCTGACGAAGCATCATCCAAAGCCAAAGTGGCAGCATTCGGGCTTAAAAAGGTG
CTTGACTTGTACTTTCTTCTTGTCAACGGGAAGTATCTATCGGATACTACTACCTATTTCAACATCCAAGCTCGA
AATGCAGACAGGGCAAATAGTTTGGCTTTGATCCAACAAATCGTGGTTGACATCCGCGCAGCCATTTTACCATCA
ATTATGGAACTCTGGGATTCTGATTTCGTACATAAAGTGCCGGATACGACTGTCAAGCGCCTGCTTGACATTCTC
AAGTTGATTTCAGCAGGCGAGAACGAGCCACAGACTATCAGCAAGCAACTTGTTCCATTTAGCTGCTTTAACTAC
GATGACGCAAGATTTTCATGGAAGCCACTTCAAAACGTTATTAACGAGACTGTAGGGGCTGGCTATGATGAAGAT
CTGGCCCAGGAAGCTGCATATCGAGCACTTGGTCACACGCTTGCTACTCAAGAGTACTGCCGAGCTCATAAGGAA
GGGCTGGCTGGTCCACGCAATCCTGTCCCTGTTGAAGATGCTAATGTGCCTCGTTTGTCTCCAACCAGGCAAGAG
CCCACGTCACAAGATCGAGATCCTTCTAGCGGGCCAAGTATGCCAGACGCCGAGCGCATGTCACTGGATTCACTT
CCCGATCTGACTACAGAGGGGCTACGAGAGATGATAGGTCGCTCAGATCAACTGGCTGAAGGGGGTCAAGAGTCT
ACGTCTGGTCAAAAGGCTACAACATTAGCCACTTCTAGTGAAGAAGCTACCAAAATTCAGCATGCCGCCTCACAG
CTTGCGACAGCCAAGGAAAATTTGGACAATATGCGGGCCAAGCTGAGAGACAGTCTCATTGACCAATGTTTGGAT
GTCATCAGAGCTCATCCAGAGACGGCAATAGAGGTTTCAGATCTCATCATCTCTGTCGTCCTCCGCCGACAAAAT
TCCGAGGCCCATGCGGACGTTGCATCTACCCTTACCCAAGCCTTGTCATCTCTAGGGACTGACGATGAAGAGAGG
AAACGCAATGGCTCGTGTATTGCCGCGTATGCGCATCTTTTGGCCCTGTTGCTACAGGACGAGAAGTTCTTTGAA
CGCAACATGAAGATTCTTGAAGACAGAGTAGAGGACTACATCAGCTTCTTGAGGGTCCCTATGTCATCTTCTACA
GATGATCTGCCTCCTTGGATACCCTTCATCCTGCTTATTCTAGAATTTTTCCTCTGCCATGACGAACGGCCGGTG
GCGGCAGAGTGGACAGCTCCCAAGTCTCTCGAGGAGCCAATTGCCCAACCCGTGATTCAAACAAGCACTGTCTTG
GTGAACGACCAGCAACGTTCCCAGATCCTGAACTCGCTGCTTGACTTGTTACCTAGAATTGGCAAAGAAGAGACA
TTAGCGACCTCGGTTCTAAGGGTTCTGATGATTTTGACACGAAGACGACAAGCGGCAAAGGCTGTTGGTGAGAAG
AAGAATTTGCAGAGACTCTTCCTCATGGCCAAACAGCTGTCGGGGTCTGGCTCTGAGCGCCTCAAGCAGACAAGG
CTGACGACGCACATCATCACTATTCTGCGCCACGTCATTGAGGACGAAGAAATCATCAAGCAGATTATGCGAGCA
GAGATTCAGACTGAATTCCCCAACATACAGCGGAATCAAAGGGGACCTACTGATGTCACTTCATATTTGCGAGCC
ATGGCATCCATTGCTCTTCGAGCTCCGGAACTATTTGTGGATGTCAGCAACGAGCTGCTAGAATTCACAAGATGG
CACTCTGGTCCAGTTGAAGGAATTCGGTCGCAGCCACTAGGGCTCAAGGCATCGCACAAGGACAAAGATCAGACC
AAATCGGCCAATGAAGAAGCGCAGCAAGAGACCCATCAGGACCTAGACGTTAAACAGTCGACAGAGCCGGCCGAC
AAGGAAATGGTTGATGCACCGAGGATACAGCACGACAGCAAGCGTCCAGTGGTGGAAAACCCAGACGGAGTCATT
CATTTCCTGCTCTGTGAGCTTGTCAATTACCGTGAAGTCGACGACAAGGAGCCGCCGGTGGCAGAAAAAGAGTCA
AAGAGTGAGAGTCGTGAATCGAGCACGCAGAGCATTCAGGCTGCCGCTGCCAGCAATGTGACACCGACTTCCAAG
GACAAGAAGCCGTCAAAGCCAGTCTTCAAGGCTGAAGAGCACCCAATCTTTGTCTACCGGTGCTTTTTACTCAAC
TGCCTTGCCGAATTGCTGCAAAGCTACACGAGGACTAAGGTCGAGTTCATTAACTTTAAACGAAGTGCCCCTCCC
CTAACTACGCAGACTCCAATCAAGCCTCGATCTAGCATCCTGAATTATCTCATTTATGATTTGCTTTGTCAGGGT
AACCTCAATGGAACAACAGACACGATTGCATCGAAAAAGAAGGCTGCGACATCATCCCTGACACAAAAGGTTCTT
GTGGCTCTTGTTACAAAGACAAGCGAGAGGCCAATGGAAAATATTCGTGATAAATTTGCCCATGACGACGAGCCG
GACCTTCTCTTTGTGCGCAAATTTGTTCTCGACACTATTCTCAAAGCGTACGAAAAGGCGCCACTGGCTGATGAG
CCTCTGGAAACACGCTATACTCGAATGCAGTGCCTGGCAGAGCTCATGAACTGCATAGTGGGAGAAAAGGACAAA
GACGTACCCTCCACAGCATCTCGGAGTGTCAATATGCAGTTGCGCTCTCAAGCACAATTGCGACGCCTCATGTAT
GAGAAGGGATTTGTGGAGAAGTTGACATCATCCATTGCGGAAATCAGCCTCAACTATCCCGGTGTCAAACGAGCC
ATCAAGTACATCTTGCGCGTGCTTCGTGTACTGACTGCAACTGCCAAAGAGCTCAGCCTTCTCAACTTGGTGGGG
GAGCCCATCTCAGACCCGGCTGCTGCCGATCAAAGCGATGAGGACTTTGCCTCAACATCGTCTCTCTCAGACCTA
CTCGATGACCGCGAGGAAACTCCAGATTTGTACCGCAATTCTGCTTTGGGCATGCTCGAGCCTCGAGGCCCAGAT
GATGAATCAGAGGACGAAGATGACGATGAGGATGAAGACATGTACGGCGACGAATATGAAGATGAGGACATGGAG
GAAATGTCGGACGAGGAAGACGACATCAGTGAAGACGAAGAGCTAGGTGAAATGGGCGAGATTGAGGGTTTGCAC
GGTGACTCTGGTGTTGTTGAAGTCATCATGGATGGTGACGAAGACGACGACGAGACTAGCGATGATGACGATGAT
GACGATGACGATGATGACGACGAACTTGATTCCGCAGATATGGAAGACATTGAGGATCGAGTCGAGATTGTGGAC
GAAGAAGGAAACCCAATGGAAGAGGATGGCGATTCTGGCTGGGAGAGCGAGAGTGATGGCGAGGACGAGGAAGGT
GCCGAAGCAGAGGACCTTGACTTTGAAGCAGAAGCCCAAGACGAAGATGAGGTGCATATGCACGACATGGTTCCC
AGTGAGGTTATTGACAATATGGCGAGGGCCATGATGAGAGATGATGGGTACGATGGCGAGGAGTTTGGACTGCTA
GACGACGGTGAAGATGAAGCAGAAGATGAGGAGGAGCAAGAAGAAGACGAAGAGTTCATGTATGGGCAATTTGAT
AACGACGAGCCGCCATCTGTGCCAGCGCCAGCAATCACATGGGAGACTATGAACGTGAATGCGAATGAAGACCAT
CGCCAAATGGTCTTTATAGATGGTGGAAGGCGTCCTGTTGTGACAAGAATGGACCGTGGTCCCTTTCATTCGCGC
TTCATGACAGCCTCAAACAGAGACCACATGGACTTTCGCAGCTACTTTTCTCGTGGCAATCGCACGACACACGCG
CAGCCCAACGCAGAGGATGGCGTGAATCCTTTGCTGCGGCGTCACCGGCATGGATCGGATGCTCCCCCACGGTCT
GGACATGGACACTCGGTGGGTCTCAGACTGCCAGAGGGTGTTTTTGGAGGCGGCAGGCATGGCATTGACGGTCCC
ATGGGTCTGTTGGGGGAGCTTATGGAGTTTCTGCCAATGATGAGCCGTAATGGAGGTGGCCAGGCCTTCCATTTC
CACATAGCGGGGCCGACAGGTTCTCGTGAGGCGCGTGACGTGGGCACAAGCAGGCTGTCCCGGAGCGACCAGCGC
CGCGAGGGCGCAGGCCAAGAGCCACATCAAGCAGTCTCGTTCTCGCCGGAATCAACACTGGATCGCTATCAGGGC
GAGGCCAGAATGATTTTTGGGACCAACATGGCGGCAGATGCGTCGAAACTGGGCAACATCATCACGGGCAAGCTT
GCGCCTTTGGCCATTGAGCAAGAGAAGAAGATGAAGATGGGCGAAGAAGAAAACAAGAAGAAGAGGGAGGAGGAG
CGGAAGCAGCGTGAAGAAGAAGAGCGCAAGGCTCGCGAGGACAATGCAGCTGTCCAGGCAGCCATGGACCAGATT
GAGGCGGAAGCGCGACAGGCACTTGAGCGCAACGCAGCAGGCGCCGAGCAACAAGATGGCGACACGAGCCATGAG
GAGGGAGAGGAAAGGCAGGATGAGTCGGGGGGCGCCATGGAGGGCGTTGAGATGTGTGTATCTGCCACGGGCCAT
GGCGATGATGGTGAAGAGGGCAGAGGAGAGAGTGGCAGCCAACGACGAGTCTTGACGACTCTGAGGGGTGAGCAA
GTCGACGTGACAGAGTTGGGCATCGACCCCGACTATCTGGCAGCGTTGCCGGAAGAATTCCGAGAAGAAGTGATT
GCTCAGACTGTGAGCGAGCGGCGGTCACAGGCGCGCGAAGGGGCTGCAATTGCTGGAGGGGAGCCGACGGAAGTC
TTCCAGGAGTTTCTTGATGCGCTCCCGGAGGAGCTCCGGCTGGAGATTGCGCAGCAGGAGCGACAAGACGAGCGG
CGGCGACTGCGAGAAGAGAGCCGTCGCCAAGCCCAAGCGGGAGGAGGCAGTGCCATGGCAGCAGACATGGATCCG
GCCAGCATCCTGCTTACCTTTCCCCCGGAGCTGCGGGAGCAAGCCTTGATTGACCAAGGAGAAGACCTCATGGAC
CAGCTGCCTCCGGAAATGGCGGCTCAAGCTCGGGCGTTGGCTCAAGCTCGGGCTCCGCATGATCAGTCGGTGTCG
CAGCAGCAGCAGGGCATTCGCTCCGTGGTGACGACGGGTAGGGTGGCATCGGGGACTTCGAGGGCGACGGAGGCT
GTGGTGAGGCGAGAAACAGAGACGATTGTGCGGGCTCCGCGTCGAACCGTGGTTCAGATGCTGGACAAGTCGGGC
ATCGCGACACTGCTGCGCCTCATGTTTATTGCGCAGCAAGGGTCGATCCGCAACTATCTCTTCAGCGTGTTTGCT
GATGTGTGCGAGAACCGGCAAAACAGACTCGAGGTCATCAGCAGCCTGCTGCAAATTCTGCAGGAAGGCAGCACC
GACATGAATGCTGTGGAGCGCAGCTTCAGCCAGCTTTCGCTGCGGGCACGGCGGAGCAAGGAAAAGGATGGCGAG
CAAAAGACGGCGCACAGCTTCAAGCGCACGCTGTCGTCGCTGGGGCTGGTTGGGTCGGTGCAGACCAACTCGGAA
ACGTCTCCCCTCTTGGTGGTGCAGCAGTGCCTGGACCTGCTGGTGGAGCTGTGCACTAGAAGCTACCAAGTGCCC
TGGCTGTTTTTGACGGAGCATGAGATTGTCGGGTCGACGCTCAAGAGGGCCCTGAGCCGCAAGGGCAAGGTCAAG
GACACCAAGGCGCACAAGTACGCCATCAACTCGCTCTTGACGCTGCTGGACCGCGACTTGGTGACGGACAGCACG
CCCGTCATGACGCACCTGGCCGACCTGCTCAACCAAGTGACACTGCCGCTGCAGAACCTGGAGCGCCGACGTCGC
GAGGCTCTGCAAGCGGCCAAGGAGTCGTCGGGGCCGGGCCAAGGCGAAGCTGGCGACACGGCAGGGCCTGAAGCA
GCAGCAGCCGGTTCCGCGGCGCAAAGGAGCGACGCCGAGGCGGACAAGGAGTCTGCGCAGAAGCGCCATCGGCAG
CTGCACCCGCCCGTCATTCCAGCGCAAAACCTGACGCTGGTGAACCTGTCGACGATTCCGGGCGCCAAGGAGACT
TTTGGTCAGGAGCTGGCGGTGACGGGCACCGAGATTCAGGGGAACAAGCTGCTGCGCGTGCTGACGGCCCTCGAC
CACCTCTTTGACACTAGCAAGAAGAAGACTCGGGACAAGGCAGACGAGGCAGCCATGGAGCGTGATAAGCAGTTC
CTCGTCACCTCGCTCTACCACAACTCGACCTTTGCCGCCATGTGGGACAAGCTGGGCGCCTGTCTGAGCGCCATC
CGCAAGCGCGAGGCCATGCTCAACGTGGCCACGATTCTCTTGCCCCTCATTGAGTCCCTCATGGTGGACATGCTT
TTGTCGAGCCCGCCGCCAGAGTCGCGCACGGCCAGTCTCTTCTTCAGCTTTACCGAAGAGCACCGCCGCATCCTC
AACGAGCTGAACCCAAAGGTGCTCGAGTTTGACAACAAGCGCAACTACTTTAACCGCAGCCTGTCGTCGGGCGAC
GAGATGAAGTTTGGCAAGCTCAACATCCGCTTCCACGGCGAAGAGGGCGTCGATGCCGGTGGCGTGACGCGCGAG
TGGTTCCAGGTATTGGCCCGTCAAATGTTTGACCCCAACTATGCCCTCTTTATCCCTGTCTCGTCGGACCGCACC
ACGTTTCATCCAAACAAGCTGAGCGGCATCAATGACGAGCATCTCATGTTCTTCAAGTTTATTGGCCGCATCATT
GGCAAGGCTCTCTACGAAGGCCGCCTATTGGATTGCTTTTTTAGCCGCGCCGTCTACAAGCGCATCCTTGGCAAG
TCCGTCTCGGTCAAGGACATGGAGTCGTTTGACCCCGACTACTACAAGTCGCTCTGCTGGATGCTTGACAATGAC
ATCACCGACATCATCACCGAGACCTTTTCCCTCGAGGACGATGAGTTTGGCGTCACAACTGTCGTCGACTTGATT
CCCACTGGCCGCGAAATCGCCGTTACTGAAGAAAACAAGCACGAATACGTCCGCCTCGTCGTTGAGCACAAGCTG
CTTTCATCGGTTAAGGACCAGATGGAAAACTTCCTCAAGGGCTTCCACGAAATCGTGCCTGCTGGCCTCATTTCA
ATCTTCAACGAGCAAGAGCTAGAACTCTTGATTTCGGGTCTTCCCGACATTGACGTTGATGACTGGAAGAGCAAC
ACGGAGTATCAAAACTACAACCCCTCGTCGCAACAAATACAGTGGTTTTGGCGAGTCGTTAGGTCCTTTGACAAG
GAAGAGCGGGCCAAGCTTCTGCAGTTTGTCACTGGCACAAGCAAGGTTCCCCTCAATGGCTTCAAGGAGCTTGAG
GGCATGAACGGCATCAATCGCTTCAATATCCACCGTGATTACGGCAACAAGGATCGACTACCCTCGTCGCACACG
TGCTTCAATCAACTTGACCTTCCAGAGTATGATTCGTACGACGTGCTGCGATCGCAGATTCTCAAGGCCATTACC
CAGGGAAGCGAATACTTTGGGTTTGCCTAA
Transcript >OphauB2|7487
ATGGGCAAGATCACAAAGGTTATGCAGGCTCGACACAAGGAGACTATGTCTCCCTGGCTAGAGAACTTTGTTCTC
ACCGCATCCGAGGCTTCGTTACCGTCCTTGCCAAAGCAGCTGGCTAGTTTTCCCTCTCGATGGCCGTTCAGTCGG
GGCGATCTCTACCATTGGATTCCGCTACTCAACCGATTCGATTCCATTCTTGAGCAGCTTTGCAAAACCTATAAT
CTGTCTCAAGGGCCTCAGTCTCGAGACTTTGGCTGTGATTTGCTGCTCAATCAATGCAAGGACTCCATCTTCCAT
AATGAAACAGCTTGGAATGAAAGCCAGTTGATGCAAATGGGCTATCCGCCAGATGGTGATAGAGTACTGGCAGAA
GCGACTCTGGAATTTACTCGCATGCTCCTAGAGCATTGCGGCAACAGGAGCATCTATGCCAGCAGTGCCCACCTC
AACGACTTACTCAATTCCACGTCTCTGTCCATACTAATTTCCACCTTGAAGGTGGGAGTCGAGCTTGCTCAGAGG
TATCAAGCGTCTGTTAAGAGACTTGCCCAGAATACTTCTCGGCTCATCAGCACCGCTCTGTTGACAAACCATTAC
AATATTGACCTTGATCGCGTGCAGCAGCTTGCCATGCCATTTGTCAAGACTCCAATAGCGAGTTTATCCGAATCT
GTGACCCTGACAACACCAGTTGCGAATAAGGGCAAGGATAAGGCACACGGCGGAGGCAGTAGAGTCGCTACATCC
ATGTATGCCAACGATCTCGTGGCTGTTGCGACTTCGGATGACAAGCAATGGAAGGAGTGGGAGGACGTGAAGGTC
TATTACTTTCCTCTTGATATCCCGACTGCCCCCATGGCATATTCGGATCCTAGCCGTTCGACTATTCCAACCATC
CCAACCACTCCTACACCCTTGCGCAAAGCTTCCACAAGCATGAGCGCTCAGCAACACAGCACGCCTAAGTCGCGA
AATATCTCAGCTGACGATTCCTCCCCAATCACTCCACGCACCCCTGGTCTTATTGAAGATTCAGTAAACCCAGGC
CAGAAGCTGTTTGAGGTGCCGAGATCAGTTGTTGCCGCCTTGCCTTTGCATCAGCTTGTTCTGCGGTGTCCTGAT
GACATGCCACCTGCTTCCAAGTACGAAGCATTCAATCGGCTTCGAGTTGCAAAGGCCCTAGGAAGTTCTATTGAA
TCACGCCGCCAGATCTTGGCTGTTCGACTCCTTGCCATTTCCAACTTGGCTTACATTCACTCTGACAGCAACTTT
GTTGAAAAAGTTCTACGTCATGACAACGACGAAACTCGAAGGTATCAACTCGTGTACCAACTTTCAGAGTTGATT
CACCCCTCTGCCGATAATAACATCGAGGTGCCTTTGTGGCTGCAGTCTATCGGGCTTAGTCTGCTTGAAGCTATG
TCTGGCATTCACTCCAAAGCACAAGATCTCTCGTCAGCTCTCAACACCAATGTTAATCATGGAATTCTTCTCTAC
GTCATCAGAAAGGCAGTGGCTGGAATGGCGAGTGATGTCGACGATCAAGACAACGGAGACCACACGACTGAACTT
GACGAGTGGCGCAACAGCCTTTTTTCTCTGACGCTTCATCTATCCATGCAACCACGTGTTGGGAGCGAGATGGTT
TCAGCAGGTTTGATGGATGCTCTGGTAGAGGTACTAAGTCTTCGCACAAGAATCTCGCAGAGGCACCATGCCATG
GTGATGGCCTTCTTGGACGGCTTGATTTGGTCTTTTCAGACGGCCTTTGTTATCTTCCTCCAGGCTAATGGCTTG
GATGCGGTGTCCAAATTGCTGGTGGACACTGTCACCGACACACAATCTTGGCTCACTACTTCTAAGCCCATTGGG
CCCGAGCACCGCTCAAGCGCTGTCGACTATCAGATCCCTTACTACAAGCAGCAGACGCTCAAATGGCTGACCAGG
TTCATACACCATATCATGACGAGTGCGTATTCGTTCAGTGGGAATACAGATCGCCTTTTACGGAACCTTGCCGAG
AAGTCTGACCTGCTCGGAAGTTTGCGTGACATCATCCAGGACAAAGAGAGATATGGCTCCGTGGTATGGACAAAC
TCGGTCACTATTTTGAGCGATTTCATCAACAACGATCCGGCAAACTATGCTGCGATAATGGAGTCTGGTATGATC
AAGACTTTTCTTGAGGCGGTCACGAACCGGTCCATTCCCGCCCATCTTGCCGACAGCAAGAGGGATGATAGCGGC
GATGACGAAGGGTCCTCGGATAGCTCAGCTATCTCAACTCTGATTAGTCAAGATGAGCGTTCCCATCCTCCTTCC
GAAGATATGCTGCAACATGAAGAACGTGGCCCTTTGGCCGCTGGCATCTTAGCGTCGTCGGACGCCATCAACATT
GTGCCTCACGTCCTGAGCTCCATTTCTCTCAATAACTCGGGGATGAAAATGGTGGTTCTGTCACGAGCCATCGAT
GCCTTTTTCCAGGTATTCGAAAGCCCTGCACATGTCAAGTGTCTCGACATGGAATGTGATCTGGTGCAAAATATT
GGAAACAATTTCGATGAGTTTGCTCGCCACCACCCGCCTCTGCGACCATGCATCTCTAATGCGGTTATCGATCTT
GTCGCCCGCTTGCGTTTTCTTGGTCTCGAGAAATCTCGCACGGCTGGCTGGGGCGCCAAACTCTTTATTGCGTCT
AGAGACGGCTCGCTGTTATCGGTAAATGAATTTGGAGTACTGGAGGATGCAAGTCACCTTTCACCTCAAGTTCGC
GAGCAAGCCATCTTGGGCGACACTGATGTTGACATGTCCGATGTTGTTGCTCCGGACGAGTTGAGGCCGTCGAAA
CGAGGCAATGGGGAGCCGGGGGCACACATGGAGTCAATCACGCCCTATATTCACGCACTGGCCAACTTTCTCGCT
GCATACCTGAACAACGCTACTCTCAAGATGATGTTTATACGCAAGGGCGGCATCGAGCTGCTTTTGGATATTTGT
GAATCGCCGAGTCTTCCAGCCTCCTTTGGGGAGTCTGCAGCATCAAGAGTACTCAATCAGGTTGTGTCGCAACTA
GTTGAACAGTCTCCTGTTCGCGCTCTTCCTTCCTTGCTGAGACGCGCTCAAGCCTCAGTGGATGTACTCGGACCT
CTAGCTGCCAAAACTCGAAATTTGCCACCATATTTTGCGCCCTTCCTCGCACCAGACCTAGGACGCTCGCGTAAT
GAGCCGGAGACATCCACAAGCGTCGCGACTGGCACGACGCTCGTCAAAGGCCTTCTCAATGCACAAACTTTTATA
AAGATTATAGCTGACTGCTTTGTCACGACAAGAAGCAGCGGGCTTTCCTTCTATCCAGTCAATGTCTATGATTAC
TACCTTACTCTGGTTAAGTCCATCGGGCCTCTGCTGCGAGGTGTCTTAGCAGAAGAGGCGGCAGAATTGTCTGTT
GTGCCCCAGCATTGGTCATTGAGGCGTCATTCTTCTCTGGGCGACAATAACACTTCCTCGAGTGCAGATGGCGGA
ATGGACGATGCGCCGCTTTCAGGAGTCTTGAACGCTGCGAGCAGTTGGGGCGCCACCACTGCAGACGCCAGCGAT
GGCGCCCCTGCGGCACGACCTACAGAACAAGAGCAGTCCAGTCCGCGGTTCCAAAATTACGAAACTTTGAGAGTG
TTGCTGCATCCCATGATTCCGACGTCTTTTCCCTTTCTGCAATCTTTGGGAAGATCTCTCCTGCCGAGGCGCAGC
GAGCCTATACATCCTGAACCCTACTCCAGAAGTCGACATCTCGATCTCGCAAAAGCTCTGGCCAATTCTATATTG
AGTCACTTGCGCGCTTCAGTTGCATCTCCGGGGCCAACGTCAAAGGAGTTTCATTACTGGATCATTATGCTTCAC
ACCATCAATGAAATGCTCATTGATCATCCGTCTGGAAGGCAAAGCGATCGCTCCAACGTGCACATCATTTTGCCT
GTTCTCCTTGCTTTCAAGGAGCAGGGAGGCTTGAGAGTGCTCAATTCGATGCTTGGGGTCTATTCTCGCTCTGTT
CGGCAGTCTACAGAGAATCCATCTGACGAAGCATCATCCAAAGCCAAAGTGGCAGCATTCGGGCTTAAAAAGGTG
CTTGACTTGTACTTTCTTCTTGTCAACGGGAAGTATCTATCGGATACTACTACCTATTTCAACATCCAAGCTCGA
AATGCAGACAGGGCAAATAGTTTGGCTTTGATCCAACAAATCGTGGTTGACATCCGCGCAGCCATTTTACCATCA
ATTATGGAACTCTGGGATTCTGATTTCGTACATAAAGTGCCGGATACGACTGTCAAGCGCCTGCTTGACATTCTC
AAGTTGATTTCAGCAGGCGAGAACGAGCCACAGACTATCAGCAAGCAACTTGTTCCATTTAGCTGCTTTAACTAC
GATGACGCAAGATTTTCATGGAAGCCACTTCAAAACGTTATTAACGAGACTGTAGGGGCTGGCTATGATGAAGAT
CTGGCCCAGGAAGCTGCATATCGAGCACTTGGTCACACGCTTGCTACTCAAGAGTACTGCCGAGCTCATAAGGAA
GGGCTGGCTGGTCCACGCAATCCTGTCCCTGTTGAAGATGCTAATGTGCCTCGTTTGTCTCCAACCAGGCAAGAG
CCCACGTCACAAGATCGAGATCCTTCTAGCGGGCCAAGTATGCCAGACGCCGAGCGCATGTCACTGGATTCACTT
CCCGATCTGACTACAGAGGGGCTACGAGAGATGATAGGTCGCTCAGATCAACTGGCTGAAGGGGGTCAAGAGTCT
ACGTCTGGTCAAAAGGCTACAACATTAGCCACTTCTAGTGAAGAAGCTACCAAAATTCAGCATGCCGCCTCACAG
CTTGCGACAGCCAAGGAAAATTTGGACAATATGCGGGCCAAGCTGAGAGACAGTCTCATTGACCAATGTTTGGAT
GTCATCAGAGCTCATCCAGAGACGGCAATAGAGGTTTCAGATCTCATCATCTCTGTCGTCCTCCGCCGACAAAAT
TCCGAGGCCCATGCGGACGTTGCATCTACCCTTACCCAAGCCTTGTCATCTCTAGGGACTGACGATGAAGAGAGG
AAACGCAATGGCTCGTGTATTGCCGCGTATGCGCATCTTTTGGCCCTGTTGCTACAGGACGAGAAGTTCTTTGAA
CGCAACATGAAGATTCTTGAAGACAGAGTAGAGGACTACATCAGCTTCTTGAGGGTCCCTATGTCATCTTCTACA
GATGATCTGCCTCCTTGGATACCCTTCATCCTGCTTATTCTAGAATTTTTCCTCTGCCATGACGAACGGCCGGTG
GCGGCAGAGTGGACAGCTCCCAAGTCTCTCGAGGAGCCAATTGCCCAACCCGTGATTCAAACAAGCACTGTCTTG
GTGAACGACCAGCAACGTTCCCAGATCCTGAACTCGCTGCTTGACTTGTTACCTAGAATTGGCAAAGAAGAGACA
TTAGCGACCTCGGTTCTAAGGGTTCTGATGATTTTGACACGAAGACGACAAGCGGCAAAGGCTGTTGGTGAGAAG
AAGAATTTGCAGAGACTCTTCCTCATGGCCAAACAGCTGTCGGGGTCTGGCTCTGAGCGCCTCAAGCAGACAAGG
CTGACGACGCACATCATCACTATTCTGCGCCACGTCATTGAGGACGAAGAAATCATCAAGCAGATTATGCGAGCA
GAGATTCAGACTGAATTCCCCAACATACAGCGGAATCAAAGGGGACCTACTGATGTCACTTCATATTTGCGAGCC
ATGGCATCCATTGCTCTTCGAGCTCCGGAACTATTTGTGGATGTCAGCAACGAGCTGCTAGAATTCACAAGATGG
CACTCTGGTCCAGTTGAAGGAATTCGGTCGCAGCCACTAGGGCTCAAGGCATCGCACAAGGACAAAGATCAGACC
AAATCGGCCAATGAAGAAGCGCAGCAAGAGACCCATCAGGACCTAGACGTTAAACAGTCGACAGAGCCGGCCGAC
AAGGAAATGGTTGATGCACCGAGGATACAGCACGACAGCAAGCGTCCAGTGGTGGAAAACCCAGACGGAGTCATT
CATTTCCTGCTCTGTGAGCTTGTCAATTACCGTGAAGTCGACGACAAGGAGCCGCCGGTGGCAGAAAAAGAGTCA
AAGAGTGAGAGTCGTGAATCGAGCACGCAGAGCATTCAGGCTGCCGCTGCCAGCAATGTGACACCGACTTCCAAG
GACAAGAAGCCGTCAAAGCCAGTCTTCAAGGCTGAAGAGCACCCAATCTTTGTCTACCGGTGCTTTTTACTCAAC
TGCCTTGCCGAATTGCTGCAAAGCTACACGAGGACTAAGGTCGAGTTCATTAACTTTAAACGAAGTGCCCCTCCC
CTAACTACGCAGACTCCAATCAAGCCTCGATCTAGCATCCTGAATTATCTCATTTATGATTTGCTTTGTCAGGGT
AACCTCAATGGAACAACAGACACGATTGCATCGAAAAAGAAGGCTGCGACATCATCCCTGACACAAAAGGTTCTT
GTGGCTCTTGTTACAAAGACAAGCGAGAGGCCAATGGAAAATATTCGTGATAAATTTGCCCATGACGACGAGCCG
GACCTTCTCTTTGTGCGCAAATTTGTTCTCGACACTATTCTCAAAGCGTACGAAAAGGCGCCACTGGCTGATGAG
CCTCTGGAAACACGCTATACTCGAATGCAGTGCCTGGCAGAGCTCATGAACTGCATAGTGGGAGAAAAGGACAAA
GACGTACCCTCCACAGCATCTCGGAGTGTCAATATGCAGTTGCGCTCTCAAGCACAATTGCGACGCCTCATGTAT
GAGAAGGGATTTGTGGAGAAGTTGACATCATCCATTGCGGAAATCAGCCTCAACTATCCCGGTGTCAAACGAGCC
ATCAAGTACATCTTGCGCGTGCTTCGTGTACTGACTGCAACTGCCAAAGAGCTCAGCCTTCTCAACTTGGTGGGG
GAGCCCATCTCAGACCCGGCTGCTGCCGATCAAAGCGATGAGGACTTTGCCTCAACATCGTCTCTCTCAGACCTA
CTCGATGACCGCGAGGAAACTCCAGATTTGTACCGCAATTCTGCTTTGGGCATGCTCGAGCCTCGAGGCCCAGAT
GATGAATCAGAGGACGAAGATGACGATGAGGATGAAGACATGTACGGCGACGAATATGAAGATGAGGACATGGAG
GAAATGTCGGACGAGGAAGACGACATCAGTGAAGACGAAGAGCTAGGTGAAATGGGCGAGATTGAGGGTTTGCAC
GGTGACTCTGGTGTTGTTGAAGTCATCATGGATGGTGACGAAGACGACGACGAGACTAGCGATGATGACGATGAT
GACGATGACGATGATGACGACGAACTTGATTCCGCAGATATGGAAGACATTGAGGATCGAGTCGAGATTGTGGAC
GAAGAAGGAAACCCAATGGAAGAGGATGGCGATTCTGGCTGGGAGAGCGAGAGTGATGGCGAGGACGAGGAAGGT
GCCGAAGCAGAGGACCTTGACTTTGAAGCAGAAGCCCAAGACGAAGATGAGGTGCATATGCACGACATGGTTCCC
AGTGAGGTTATTGACAATATGGCGAGGGCCATGATGAGAGATGATGGGTACGATGGCGAGGAGTTTGGACTGCTA
GACGACGGTGAAGATGAAGCAGAAGATGAGGAGGAGCAAGAAGAAGACGAAGAGTTCATGTATGGGCAATTTGAT
AACGACGAGCCGCCATCTGTGCCAGCGCCAGCAATCACATGGGAGACTATGAACGTGAATGCGAATGAAGACCAT
CGCCAAATGGTCTTTATAGATGGTGGAAGGCGTCCTGTTGTGACAAGAATGGACCGTGGTCCCTTTCATTCGCGC
TTCATGACAGCCTCAAACAGAGACCACATGGACTTTCGCAGCTACTTTTCTCGTGGCAATCGCACGACACACGCG
CAGCCCAACGCAGAGGATGGCGTGAATCCTTTGCTGCGGCGTCACCGGCATGGATCGGATGCTCCCCCACGGTCT
GGACATGGACACTCGGTGGGTCTCAGACTGCCAGAGGGTGTTTTTGGAGGCGGCAGGCATGGCATTGACGGTCCC
ATGGGTCTGTTGGGGGAGCTTATGGAGTTTCTGCCAATGATGAGCCGTAATGGAGGTGGCCAGGCCTTCCATTTC
CACATAGCGGGGCCGACAGGTTCTCGTGAGGCGCGTGACGTGGGCACAAGCAGGCTGTCCCGGAGCGACCAGCGC
CGCGAGGGCGCAGGCCAAGAGCCACATCAAGCAGTCTCGTTCTCGCCGGAATCAACACTGGATCGCTATCAGGGC
GAGGCCAGAATGATTTTTGGGACCAACATGGCGGCAGATGCGTCGAAACTGGGCAACATCATCACGGGCAAGCTT
GCGCCTTTGGCCATTGAGCAAGAGAAGAAGATGAAGATGGGCGAAGAAGAAAACAAGAAGAAGAGGGAGGAGGAG
CGGAAGCAGCGTGAAGAAGAAGAGCGCAAGGCTCGCGAGGACAATGCAGCTGTCCAGGCAGCCATGGACCAGATT
GAGGCGGAAGCGCGACAGGCACTTGAGCGCAACGCAGCAGGCGCCGAGCAACAAGATGGCGACACGAGCCATGAG
GAGGGAGAGGAAAGGCAGGATGAGTCGGGGGGCGCCATGGAGGGCGTTGAGATGTGTGTATCTGCCACGGGCCAT
GGCGATGATGGTGAAGAGGGCAGAGGAGAGAGTGGCAGCCAACGACGAGTCTTGACGACTCTGAGGGGTGAGCAA
GTCGACGTGACAGAGTTGGGCATCGACCCCGACTATCTGGCAGCGTTGCCGGAAGAATTCCGAGAAGAAGTGATT
GCTCAGACTGTGAGCGAGCGGCGGTCACAGGCGCGCGAAGGGGCTGCAATTGCTGGAGGGGAGCCGACGGAAGTC
TTCCAGGAGTTTCTTGATGCGCTCCCGGAGGAGCTCCGGCTGGAGATTGCGCAGCAGGAGCGACAAGACGAGCGG
CGGCGACTGCGAGAAGAGAGCCGTCGCCAAGCCCAAGCGGGAGGAGGCAGTGCCATGGCAGCAGACATGGATCCG
GCCAGCATCCTGCTTACCTTTCCCCCGGAGCTGCGGGAGCAAGCCTTGATTGACCAAGGAGAAGACCTCATGGAC
CAGCTGCCTCCGGAAATGGCGGCTCAAGCTCGGGCGTTGGCTCAAGCTCGGGCTCCGCATGATCAGTCGGTGTCG
CAGCAGCAGCAGGGCATTCGCTCCGTGGTGACGACGGGTAGGGTGGCATCGGGGACTTCGAGGGCGACGGAGGCT
GTGGTGAGGCGAGAAACAGAGACGATTGTGCGGGCTCCGCGTCGAACCGTGGTTCAGATGCTGGACAAGTCGGGC
ATCGCGACACTGCTGCGCCTCATGTTTATTGCGCAGCAAGGGTCGATCCGCAACTATCTCTTCAGCGTGTTTGCT
GATGTGTGCGAGAACCGGCAAAACAGACTCGAGGTCATCAGCAGCCTGCTGCAAATTCTGCAGGAAGGCAGCACC
GACATGAATGCTGTGGAGCGCAGCTTCAGCCAGCTTTCGCTGCGGGCACGGCGGAGCAAGGAAAAGGATGGCGAG
CAAAAGACGGCGCACAGCTTCAAGCGCACGCTGTCGTCGCTGGGGCTGGTTGGGTCGGTGCAGACCAACTCGGAA
ACGTCTCCCCTCTTGGTGGTGCAGCAGTGCCTGGACCTGCTGGTGGAGCTGTGCACTAGAAGCTACCAAGTGCCC
TGGCTGTTTTTGACGGAGCATGAGATTGTCGGGTCGACGCTCAAGAGGGCCCTGAGCCGCAAGGGCAAGGTCAAG
GACACCAAGGCGCACAAGTACGCCATCAACTCGCTCTTGACGCTGCTGGACCGCGACTTGGTGACGGACAGCACG
CCCGTCATGACGCACCTGGCCGACCTGCTCAACCAAGTGACACTGCCGCTGCAGAACCTGGAGCGCCGACGTCGC
GAGGCTCTGCAAGCGGCCAAGGAGTCGTCGGGGCCGGGCCAAGGCGAAGCTGGCGACACGGCAGGGCCTGAAGCA
GCAGCAGCCGGTTCCGCGGCGCAAAGGAGCGACGCCGAGGCGGACAAGGAGTCTGCGCAGAAGCGCCATCGGCAG
CTGCACCCGCCCGTCATTCCAGCGCAAAACCTGACGCTGGTGAACCTGTCGACGATTCCGGGCGCCAAGGAGACT
TTTGGTCAGGAGCTGGCGGTGACGGGCACCGAGATTCAGGGGAACAAGCTGCTGCGCGTGCTGACGGCCCTCGAC
CACCTCTTTGACACTAGCAAGAAGAAGACTCGGGACAAGGCAGACGAGGCAGCCATGGAGCGTGATAAGCAGTTC
CTCGTCACCTCGCTCTACCACAACTCGACCTTTGCCGCCATGTGGGACAAGCTGGGCGCCTGTCTGAGCGCCATC
CGCAAGCGCGAGGCCATGCTCAACGTGGCCACGATTCTCTTGCCCCTCATTGAGTCCCTCATGGTGGACATGCTT
TTGTCGAGCCCGCCGCCAGAGTCGCGCACGGCCAGTCTCTTCTTCAGCTTTACCGAAGAGCACCGCCGCATCCTC
AACGAGCTGAACCCAAAGGTGCTCGAGTTTGACAACAAGCGCAACTACTTTAACCGCAGCCTGTCGTCGGGCGAC
GAGATGAAGTTTGGCAAGCTCAACATCCGCTTCCACGGCGAAGAGGGCGTCGATGCCGGTGGCGTGACGCGCGAG
TGGTTCCAGGTATTGGCCCGTCAAATGTTTGACCCCAACTATGCCCTCTTTATCCCTGTCTCGTCGGACCGCACC
ACGTTTCATCCAAACAAGCTGAGCGGCATCAATGACGAGCATCTCATGTTCTTCAAGTTTATTGGCCGCATCATT
GGCAAGGCTCTCTACGAAGGCCGCCTATTGGATTGCTTTTTTAGCCGCGCCGTCTACAAGCGCATCCTTGGCAAG
TCCGTCTCGGTCAAGGACATGGAGTCGTTTGACCCCGACTACTACAAGTCGCTCTGCTGGATGCTTGACAATGAC
ATCACCGACATCATCACCGAGACCTTTTCCCTCGAGGACGATGAGTTTGGCGTCACAACTGTCGTCGACTTGATT
CCCACTGGCCGCGAAATCGCCGTTACTGAAGAAAACAAGCACGAATACGTCCGCCTCGTCGTTGAGCACAAGCTG
CTTTCATCGGTTAAGGACCAGATGGAAAACTTCCTCAAGGGCTTCCACGAAATCGTGCCTGCTGGCCTCATTTCA
ATCTTCAACGAGCAAGAGCTAGAACTCTTGATTTCGGGTCTTCCCGACATTGACGTTGATGACTGGAAGAGCAAC
ACGGAGTATCAAAACTACAACCCCTCGTCGCAACAAATACAGTGGTTTTGGCGAGTCGTTAGGTCCTTTGACAAG
GAAGAGCGGGCCAAGCTTCTGCAGTTTGTCACTGGCACAAGCAAGGTTCCCCTCAATGGCTTCAAGGAGCTTGAG
GGCATGAACGGCATCAATCGCTTCAATATCCACCGTGATTACGGCAACAAGGATCGACTACCCTCGTCGCACACG
TGCTTCAATCAACTTGACCTTCCAGAGTATGATTCGTACGACGTGCTGCGATCGCAGATTCTCAAGGCCATTACC
CAGGGAAGCGAATACTTTGGGTTTGCCTAA
Gene >OphauB2|7487
ATGGGCAAGATCACAAAGGTTATGCAGGCTCGACACAAGGAGACTATGGTATGTACATCCCGTGTGTCGAGAGAT
ACTTTGAGACTAGCCGTACTTTCATCTCCCCTTGTCGACTGCAAGCTCTGACAACGACTTTCGTGACAGTCTCCC
TGGCTAGAGAACTTTGTTCTCACCGCATCCGAGGCTTCGTTACCGTCCTTGCCAAAGCAGCTGGCTAGTTTTCCC
TCTCGATGGCCGTTCAGTCGGGGCGATCTCTACCATTGGATTCCGCTACTCAACCGATTCGATTCCATTCTTGAG
CAGCTTTGCAAAACCTATAATCTGTCTCAAGGGCCTCAGTCTCGAGACTTTGGCTGTGATTTGCTGCTCAATCAA
TGCAAGGACTCCATCTTCCATAATGAAACAGCTTGGAATGAAAGCCAGTTGATGCAAATGGGCTATCCGCCAGAT
GGTGATAGAGTACTGGCAGAAGCGACTCTGGAATTTACTCGCATGCTCCTAGAGCATTGCGGCAACAGGAGCATC
TATGCCAGCAGTGCCCACCTCAACGACTTACTCAATTCCACGTCTCTGTCCATACTAATTTCCACCTTGAAGGTG
GGAGTCGAGCTTGCTCAGAGGTATCAAGCGTCTGTTAAGAGACTTGCCCAGAATACTTCTCGGCTCATCAGCACC
GCTCTGTTGACAAACCATTACAATATTGACCTTGATCGCGTGCAGCAGCTTGCCATGCCATTTGTCAAGACTCCA
ATAGCGAGTTTATCCGAATCTGTGACCCTGACAACACCAGTTGCGAATAAGGGCAAGGATAAGGCACACGGCGGA
GGCAGTAGAGTCGCTACATCCATGTATGCCAACGATCTCGTGGCTGTTGCGACTTCGGATGACAAGCAATGGAAG
GAGTGGGAGGACGTGAAGGTCTATTACTTTCCTCTTGATATCCCGACTGCCCCCATGGCATATTCGGATCCTAGC
CGTTCGACTATTCCAACCATCCCAACCACTCCTACACCCTTGCGCAAAGCTTCCACAAGCATGAGCGCTCAGCAA
CACAGCACGCCTAAGTCGCGAAATATCTCAGCTGACGATTCCTCCCCAATCACTCCACGCACCCCTGGTCTTATT
GAAGATTCAGTAAACCCAGGCCAGAAGCTGTTTGAGGTGCCGAGATCAGTTGTTGCCGCCTTGCCTTTGCATCAG
CTTGTTCTGCGGTGTCCTGATGACATGCCACCTGCTTCCAAGTACGAAGCATTCAATCGGCTTCGAGTTGCAAAG
GCCCTAGGAAGTTCTATTGAATCACGCCGCCAGATCTTGGCTGTTCGACTCCTTGCCATTTCCAACTTGGCTTAC
ATTCACTCTGACAGCAACTTTGTTGAAAAAGTTCTACGTCATGACAACGACGAAACTCGAAGGTATCAACTCGTG
TACCAACTTTCAGAGTTGATTCACCCCTCTGCCGATAATAACATCGAGGTGCCTTTGTGGCTGCAGTCTATCGGG
CTTAGTCTGCTTGAAGCTATGTCTGGCATTCACTCCAAAGCACAAGATCTCTCGTCAGCTCTCAACACCAATGTT
AATCATGGAATTCTTCTCTACGTCATCAGAAAGGCAGTGGCTGGAATGGCGAGTGATGTCGACGATCAAGACAAC
GGAGACCACACGACTGAACTTGACGAGTGGCGCAACAGCCTTTTTTCTCTGACGCTTCATCTATCCATGCAACCA
CGTGTTGGGAGCGAGATGGTTTCAGCAGGTTTGATGGATGCTCTGGTAGAGGTACTAAGTCTTCGCACAAGAATC
TCGCAGAGGCACCATGCCATGGTGATGGCCTTCTTGGACGGCTTGATTTGGTCTTTTCAGACGGCCTTTGTTATC
TTCCTCCAGGCTAATGGCTTGGATGCGGTGTCCAAATTGCTGGTGGACACTGTCACCGACACACAATCTTGGCTC
ACTACTTCTAAGCCCATTGGGCCCGAGCACCGCTCAAGCGCTGTCGACTATCAGATCCCTTACTACAAGCAGCAG
ACGCTCAAATGGCTGACCAGGTTCATACACCATATCATGACGAGTGCGTATTCGTTCAGTGGGAATACAGATCGC
CTTTTACGGAACCTTGCCGAGAAGTCTGACCTGCTCGGAAGTTTGCGTGACATCATCCAGGACAAAGAGAGATAT
GGCTCCGTGGTATGGACAAACTCGGTCACTATTTTGAGCGATTTCATCAACAACGATCCGGCAAACTATGCTGCG
ATAATGGAGTCTGGTATGATCAAGACTTTTCTTGAGGCGGTCACGAACCGGTCCATTCCCGCCCATCTTGCCGAC
AGCAAGAGGGATGATAGCGGCGATGACGAAGGGTCCTCGGATAGCTCAGCTATCTCAACTCTGATTAGTCAAGAT
GAGCGTTCCCATCCTCCTTCCGAAGATATGCTGCAACATGAAGAACGTGGCCCTTTGGCCGCTGGCATCTTAGCG
TCGTCGGACGCCATCAACATTGTGCCTCACGTCCTGAGCTCCATTTCTCTCAATAACTCGGGGATGAAAATGGTG
GTTCTGTCACGAGCCATCGATGCCTTTTTCCAGGTATTCGAAAGCCCTGCACATGTCAAGTGTCTCGACATGGAA
TGTGATCTGGTGCAAAATATTGGAAACAATTTCGATGAGTTTGCTCGCCACCACCCGCCTCTGCGACCATGCATC
TCTAATGCGGTTATCGATCTTGTCGCCCGCTTGCGTTTTCTTGGTCTCGAGAAATCTCGCACGGCTGGCTGGGGC
GCCAAACTCTTTATTGCGTCTAGAGACGGCTCGCTGTTATCGGTAAATGAATTTGGAGTACTGGAGGATGCAAGT
CACCTTTCACCTCAAGTTCGCGAGCAAGCCATCTTGGGCGACACTGATGTTGACATGTCCGATGTTGTTGCTCCG
GACGAGTTGAGGCCGTCGAAACGAGGCAATGGGGAGCCGGGGGCACACATGGAGTCAATCACGCCCTATATTCAC
GCACTGGCCAACTTTCTCGCTGCATACCTGAACAACGCTACTCTCAAGATGATGTTTATACGCAAGGGCGGCATC
GAGCTGCTTTTGGATATTTGTGAATCGCCGAGTCTTCCAGCCTCCTTTGGGGAGTCTGCAGCATCAAGAGTACTC
AATCAGGTTGTGTCGCAACTAGTTGAACAGTCTCCTGTTCGCGCTCTTCCTTCCTTGCTGAGACGCGCTCAAGCC
TCAGTGGATGTACTCGGACCTCTAGCTGCCAAAACTCGAAATTTGCCACCATATTTTGCGCCCTTCCTCGCACCA
GACCTAGGACGCTCGCGTAATGAGCCGGAGACATCCACAAGCGTCGCGACTGGCACGACGCTCGTCAAAGGCCTT
CTCAATGCACAAACTTTTATAAAGATTATAGCTGACTGCTTTGTCACGACAAGAAGCAGCGGGCTTTCCTTCTAT
CCAGTCAATGTCTATGATTACTACCTTACTCTGGTTAAGTCCATCGGGCCTCTGCTGCGAGGTGTCTTAGCAGAA
GAGGCGGCAGAATTGTCTGTTGTGCCCCAGCATTGGTCATTGAGGCGTCATTCTTCTCTGGGCGACAATAACACT
TCCTCGAGTGCAGATGGCGGAATGGACGATGCGCCGCTTTCAGGAGTCTTGAACGCTGCGAGCAGTTGGGGCGCC
ACCACTGCAGACGCCAGCGATGGCGCCCCTGCGGCACGACCTACAGAACAAGAGCAGTCCAGTCCGCGGTTCCAA
AATTACGAAACTTTGAGAGTGTTGCTGCATCCCATGATTCCGACGTCTTTTCCCTTTCTGCAATCTTTGGGAAGA
TCTCTCCTGCCGAGGCGCAGCGAGCCTATACATCCTGAACCCTACTCCAGAAGTCGACATCTCGATCTCGCAAAA
GCTCTGGCCAATTCTATATTGAGTCACTTGCGCGCTTCAGTTGCATCTCCGGGGCCAACGTCAAAGGAGTTTCAT
TACTGGATCATTATGCTTCACACCATCAATGAAATGCTCATTGATCATCCGTCTGGAAGGCAAAGCGATCGCTCC
AACGTGCACATCATTTTGCCTGTTCTCCTTGCTTTCAAGGAGCAGGGAGGCTTGAGAGTGCTCAATTCGATGCTT
GGGGTCTATTCTCGCTCTGTTCGGCAGTCTACAGAGAATCCATCTGACGAAGCATCATCCAAAGCCAAAGTGGCA
GCATTCGGGCTTAAAAAGGTGCTTGACTTGTACTTTCTTCTTGTCAACGGGAAGTATCTATCGGATACTACTACC
TATTTCAACATCCAAGCTCGAAATGCAGACAGGGCAAATAGTTTGGCTTTGATCCAACAAATCGTGGTTGACATC
CGCGCAGCCATTTTACCATCAATTATGGAACTCTGGGATTCTGATTTCGTACATAAAGTGCCGGATACGACTGTC
AAGCGCCTGCTTGACATTCTCAAGTTGATTTCAGCAGGCGAGAACGAGCCACAGACTATCAGCAAGCAACTTGTT
CCATTTAGCTGCTTTAACTACGATGACGCAAGATTTTCATGGAAGCCACTTCAAAACGTTATTAACGAGACTGTA
GGGGCTGGCTATGATGAAGATCTGGCCCAGGAAGCTGCATATCGAGCACTTGGTCACACGCTTGCTACTCAAGAG
TACTGCCGAGCTCATAAGGAAGGGCTGGCTGGTCCACGCAATCCTGTCCCTGTTGAAGATGCTAATGTGCCTCGT
TTGTCTCCAACCAGGCAAGAGCCCACGTCACAAGATCGAGATCCTTCTAGCGGGCCAAGTATGCCAGACGCCGAG
CGCATGTCACTGGATTCACTTCCCGATCTGACTACAGAGGGGCTACGAGAGATGATAGGTCGCTCAGATCAACTG
GCTGAAGGGGGTCAAGAGTCTACGTCTGGTCAAAAGGCTACAACATTAGCCACTTCTAGTGAAGAAGCTACCAAA
ATTCAGCATGCCGCCTCACAGCTTGCGACAGCCAAGGAAAATTTGGACAATATGCGGGCCAAGCTGAGAGACAGT
CTCATTGACCAATGTTTGGATGTCATCAGAGCTCATCCAGAGACGGCAATAGAGGTTTCAGATCTCATCATCTCT
GTCGTCCTCCGCCGACAAAATTCCGAGGCCCATGCGGACGTTGCATCTACCCTTACCCAAGCCTTGTCATCTCTA
GGGACTGACGATGAAGAGAGGAAACGCAATGGCTCGTGTATTGCCGCGTATGCGCATCTTTTGGCCCTGTTGCTA
CAGGACGAGAAGTTCTTTGAACGCAACATGAAGATTCTTGAAGACAGAGTAGAGGACTACATCAGCTTCTTGAGG
GTCCCTATGTCATCTTCTACAGATGATCTGCCTCCTTGGATACCCTTCATCCTGCTTATTCTAGAATTTTTCCTC
TGCCATGACGAACGGCCGGTGGCGGCAGAGTGGACAGCTCCCAAGTCTCTCGAGGAGCCAATTGCCCAACCCGTG
ATTCAAACAAGCACTGTCTTGGTGAACGACCAGCAACGTTCCCAGATCCTGAACTCGCTGCTTGACTTGTTACCT
AGAATTGGCAAAGAAGAGACATTAGCGACCTCGGTTCTAAGGGTTCTGATGATTTTGACACGAAGACGACAAGCG
GCAAAGGCTGTTGGTGAGAAGAAGAATTTGCAGAGACTCTTCCTCATGGCCAAACAGCTGTCGGGGTCTGGCTCT
GAGCGCCTCAAGCAGACAAGGCTGACGACGCACATCATCACTATTCTGCGCCACGTCATTGAGGACGAAGAAATC
ATCAAGCAGATTATGCGAGCAGAGATTCAGACTGAATTCCCCAACATACAGCGGAATCAAAGGGGACCTACTGAT
GTCACTTCATATTTGCGAGCCATGGCATCCATTGCTCTTCGAGCTCCGGAACTATTTGTGGATGTCAGCAACGAG
CTGCTAGAATTCACAAGATGGCACTCTGGTCCAGTTGAAGGAATTCGGTCGCAGCCACTAGGGCTCAAGGCATCG
CACAAGGACAAAGATCAGACCAAATCGGCCAATGAAGAAGCGCAGCAAGAGACCCATCAGGACCTAGACGTTAAA
CAGTCGACAGAGCCGGCCGACAAGGAAATGGTTGATGCACCGAGGATACAGCACGACAGCAAGCGTCCAGTGGTG
GAAAACCCAGACGGAGTCATTCATTTCCTGCTCTGTGAGCTTGTCAATTACCGTGAAGTCGACGACAAGGAGCCG
CCGGTGGCAGAAAAAGAGTCAAAGAGTGAGAGTCGTGAATCGAGCACGCAGAGCATTCAGGCTGCCGCTGCCAGC
AATGTGACACCGACTTCCAAGGACAAGAAGCCGTCAAAGCCAGTCTTCAAGGCTGAAGAGCACCCAATCTTTGTC
TACCGGTGCTTTTTACTCAACTGCCTTGCCGAATTGCTGCAAAGCTACACGAGGACTAAGGTCGAGTTCATTAAC
TTTAAACGAAGTGCCCCTCCCCTAACTACGCAGACTCCAATCAAGCCTCGATCTAGCATCCTGAATTATCTCATT
TATGATTTGCTTTGTCAGGGTAACCTCAATGGAACAACAGACACGATTGCATCGAAAAAGAAGGCTGCGACATCA
TCCCTGACACAAAAGGTTCTTGTGGCTCTTGTTACAAAGACAAGCGAGAGGCCAATGGAAAATATTCGTGATAAA
TTTGCCCATGACGACGAGCCGGACCTTCTCTTTGTGCGCAAATTTGTTCTCGACACTATTCTCAAAGCGTACGAA
AAGGCGCCACTGGCTGATGAGCCTCTGGAAACACGCTATACTCGAATGCAGTGCCTGGCAGAGCTCATGAACTGC
ATAGTGGGAGAAAAGGACAAAGACGTACCCTCCACAGCATCTCGGAGTGTCAATATGCAGTTGCGCTCTCAAGCA
CAATTGCGACGCCTCATGTATGAGAAGGGATTTGTGGAGAAGTTGACATCATCCATTGCGGAAATCAGCCTCAAC
TATCCCGGTGTCAAACGAGCCATCAAGTACATCTTGCGCGTGCTTCGTGTACTGACTGCAACTGCCAAAGAGCTC
AGCCTTCTCAACTTGGTGGGGGAGCCCATCTCAGACCCGGCTGCTGCCGATCAAAGCGATGAGGACTTTGCCTCA
ACATCGTCTCTCTCAGACCTACTCGATGACCGCGAGGAAACTCCAGATTTGTACCGCAATTCTGCTTTGGGCATG
CTCGAGCCTCGAGGCCCAGATGATGAATCAGAGGACGAAGATGACGATGAGGATGAAGACATGTACGGCGACGAA
TATGAAGATGAGGACATGGAGGAAATGTCGGACGAGGAAGACGACATCAGTGAAGACGAAGAGCTAGGTGAAATG
GGCGAGATTGAGGGTTTGCACGGTGACTCTGGTGTTGTTGAAGTCATCATGGATGGTGACGAAGACGACGACGAG
ACTAGCGATGATGACGATGATGACGATGACGATGATGACGACGAACTTGATTCCGCAGATATGGAAGACATTGAG
GATCGAGTCGAGATTGTGGACGAAGAAGGAAACCCAATGGAAGAGGATGGCGATTCTGGCTGGGAGAGCGAGAGT
GATGGCGAGGACGAGGAAGGTGCCGAAGCAGAGGACCTTGACTTTGAAGCAGAAGCCCAAGACGAAGATGAGGTG
CATATGCACGACATGGTTCCCAGTGAGGTTATTGACAATATGGCGAGGGCCATGATGAGAGATGATGGGTACGAT
GGCGAGGAGTTTGGACTGCTAGACGACGGTGAAGATGAAGCAGGTACGTATTGCTCTTGATGCCTTTCTAGTAGG
ACTTTGCTTGCATGGGCAGTGGCTTATTGATGCATATAGAAGATGAGGAGGAGCAAGAAGAAGACGAAGAGTTCA
TGTATGGGCAATGTAAGTCAAGGCTGAGGATGTGAGAAATGATGGGACAAAGGCCCGCTGACGAGTGGCCATGCA
GTTGATAACGACGAGCCGCCATCTGTGCCAGCGCCAGCAATCACATGGGAGACTATGAACGTGAATGCGAATGAA
GACCATCGCCAAATGGTCTTTATAGATGGTGGAAGGCGTCCTGTTGTGACAAGAATGGACCGTGGTCCCTTTCAT
TCGCGCTTCATGACAGCCTCAAACAGAGACCACATGGGTAAGTCGAAGGGCAAATTGTGTGTTCAGAGCTCTGCT
TACCCGTTGCAAAAGACTTTCGCAGCTACTTTTCTCGTGGCAATCGCACGACACACGCGCAGCCCAACGCAGAGG
ATGGCGTGAATCCTTTGCTGCGGCGTCACCGGCATGGATCGGATGCTCCCCCACGGTCTGGACATGGACACTCGG
TGGGTCTCAGACTGCCAGAGGGTGTTTTTGGAGGCGGCAGGCATGGCATTGACGGTCCCATGGGTCTGTTGGGGG
AGCTTATGGAGTTTCTGCCAATGATGAGCCGTAATGGAGGTGGCCAGGCCTTCCATTTCCACATAGCGGGGCCGA
CAGGTTCTCGTGAGGCGCGTGACGTGGGCACAAGCAGGCTGTCCCGGAGCGACCAGCGCCGCGAGGGCGCAGGCC
AAGAGCCACATCAAGCAGTCTCGTTCTCGCCGGAATCAACACTGGATCGCTATCAGGGCGAGGCCAGAATGATTT
TTGGGACCAACATGGCGGCAGATGCGTCGAAACTGGGCAACATCATCACGGGCAAGCTTGCGCCTTTGGCCATTG
AGCAAGAGAAGAAGATGAAGATGGGCGAAGAAGAAAACAAGAAGAAGAGGGAGGAGGAGCGGAAGCAGCGTGAAG
AAGAAGAGCGCAAGGCTCGCGAGGACAATGCAGCTGTCCAGGCAGCCATGGACCAGATTGAGGCGGAAGCGCGAC
AGGCACTTGAGCGCAACGCAGCAGGCGCCGAGCAACAAGATGGCGACACGAGCCATGAGGAGGGAGAGGAAAGGC
AGGATGAGTCGGGGGGCGCCATGGAGGGCGTTGAGATGTGTGTATCTGCCACGGGCCATGGCGATGATGGTGAAG
AGGGCAGAGGAGAGAGTGGCAGCCAACGACGAGTCTTGACGACTCTGAGGGGTGAGCAAGTCGACGTGACAGAGT
TGGGCATCGACCCCGACTATCTGGCAGCGTTGCCGGAAGAATTCCGAGAAGAAGTGATTGCTCAGACTGTGAGCG
AGCGGCGGTCACAGGCGCGCGAAGGGGCTGCAATTGCTGGAGGGGAGCCGACGGAAGTCTTCCAGGAGTTTCTTG
ATGCGCTCCCGGAGGAGCTCCGGCTGGAGATTGCGCAGCAGGAGCGACAAGACGAGCGGCGGCGACTGCGAGAAG
AGAGCCGTCGCCAAGCCCAAGCGGGAGGAGGCAGTGCCATGGCAGCAGACATGGATCCGGCCAGCATCCTGCTTA
CCTTTCCCCCGGAGCTGCGGGAGCAAGCCTTGATTGACCAAGGAGAAGACCTCATGGACCAGCTGCCTCCGGAAA
TGGCGGCTCAAGCTCGGGCGTTGGCTCAAGCTCGGGCTCCGCATGATCAGTCGGTGTCGCAGCAGCAGCAGGGCA
TTCGCTCCGTGGTGACGACGGGTAGGGTGGCATCGGGGACTTCGAGGGCGACGGAGGCTGTGGTGAGGCGAGAAA
CAGAGACGATTGTGCGGGCTCCGCGTCGAACCGTGGTTCAGATGCTGGACAAGTCGGGCATCGCGACACTGCTGC
GCCTCATGTTTATTGCGCAGCAAGGGTCGATCCGCAACTATCTCTTCAGCGTGTTTGCTGATGTGTGCGAGAACC
GGCAAAACAGACTCGAGGTCATCAGCAGCCTGCTGCAAATTCTGCAGGAAGGCAGCACCGACATGAATGCTGTGG
AGCGCAGCTTCAGCCAGCTTTCGCTGCGGGCACGGCGGAGCAAGGAAAAGGATGGCGAGCAAAAGACGGCGCACA
GCTTCAAGCGCACGCTGTCGTCGCTGGGGCTGGTTGGGTCGGTGCAGACCAACTCGGAAACGTCTCCCCTCTTGG
TGGTGCAGCAGTGCCTGGACCTGCTGGTGGAGCTGTGCACTAGAAGCTACCAAGTGCCCTGGCTGTTTTTGACGG
AGCATGAGATTGTCGGGTCGACGCTCAAGAGGGCCCTGAGCCGCAAGGGCAAGGTCAAGGACACCAAGGCGCACA
AGTACGCCATCAACTCGCTCTTGACGCTGCTGGACCGCGACTTGGTGACGGACAGCACGCCCGTCATGACGCACC
TGGCCGACCTGCTCAACCAAGTGACACTGCCGCTGCAGAACCTGGAGCGCCGACGTCGCGAGGCTCTGCAAGCGG
CCAAGGAGTCGTCGGGGCCGGGCCAAGGCGAAGCTGGCGACACGGCAGGGCCTGAAGCAGCAGCAGCCGGTTCCG
CGGCGCAAAGGAGCGACGCCGAGGCGGACAAGGAGTCTGCGCAGAAGCGCCATCGGCAGCTGCACCCGCCCGTCA
TTCCAGCGCAAAACCTGACGCTGGTGGTGCGCATCTTTGTGGCTCGAGAGTGCAGCTCCAAGACGTTTCAAAACA
CCATCTGCACCATCAAGAACCTGTCGACGATTCCGGGCGCCAAGGAGACTTTTGGTCAGGAGCTGGTGCGCCAGG
CGCGGCTGCTGAGCGAGAGCATCGTGGCCGACTTGGACAATTTGCTGCCTCACATCGACAAGGCGGTGACGGGCA
CCGAGATTCAGGGGGTAGCACTGGCCAAGTTTTCTCCTGGCGCGTCGGACCAGAACAAGCTGCTGCGCGTGCTGA
CGGCCCTCGACCACCTCTTTGACACTAGCAAGAAGAAGACTCGGGACAAGGCAGACGAGGCAGCCATGGAGCGTG
ATAAGCAGTTCCTCGTCACCTCGCTCTACCACAACTCGACCTTTGCCGCCATGTGGGACAAGCTGGGCGCCTGTC
TGAGCGCCATCCGCAAGCGCGAGGCCATGCTCAACGTGGCCACGATTCTCTTGCCCCTCATTGAGTCCCTCATGG
TGGTGTGCAAGAACACAACGACGCCCGAGGAGCAGCCCCAGAGCTTGCTGGCCAAGGACATGCTTTTGTCGAGCC
CGCCGCCAGAGTCGCGCACGGCCAGTCTCTTCTTCAGCTTTACCGAAGAGCACCGCCGCATCCTCAACGAGCTGG
TGCGCCAAAACCCCAAGCTCATGTCTGGCACCTTTGCCCTGCTCGTCAAGAACCCAAAGGTGCTCGAGTTTGACA
ACAAGCGCAACTACTTTAACCGCAGCGTGCACTCTCGCATTGGTCAGAATAATATGCGTCCAACGTATCCAGCCC
TGCAGCTGTCGGTCCGTCGTGACCACGTCTTCCATGACTCGTTCAAGTCGCTCTACTTCAAGTCGGGCGACGAGA
TGAAGTTTGGCAAGCTCAACATCCGCTTCCACGGCGAAGAGGGCGTCGATGCCGGTGGCGTGACGCGCGAGTGGT
TCCAGGTATTGGCCCGTCAAATGTTTGACCCCAACTATGCCCTCTTTATCCCTGTCTCGTCGGACCGCACCACGT
TTCATCCAAACAAGCTGAGCGGCATCAATGACGAGCATCTCATGTTCTTCAAGTTTATTGGCCGCATCATTGGCA
AGGCTCTCTACGAAGGCCGCCTATTGGATTGCTTTTTTAGCCGCGCCGTCTACAAGCGCATCCTTGGCAAGTCCG
TCTCGGTCAAGGACATGGAGTCGTTTGACCCCGACTACTACAAGTCGCTCTGCTGGATGCTTGACAATGACATCA
CCGACATCATCACCGAGACCTTTTCCCTCGAGGACGATGAGTTTGGCGTCACAACTGTCGTCGACTTGATTCCCA
CTGGCCGCGAAATCGCCGTTACTGAAGAAAACAAGCACGAATACGTCCGCCTCGTCGTTGAGCACAAGCTGCTTT
CATCGGTTAAGGACCAGATGGAAAACTTCCTCAAGGGTCAGTCTTGCCCTCCAATGCCATCCCAATCATGGCCCT
CTGGTTTTGCATGCTAACACGTGACGCAGGCTTCCACGAAATCGTGCCTGCTGGCCTCATTTCAATCTTCAACGA
GCAAGAGCTAGAACTCTTGATTTCGGGTCTTCCCGACATTGACGTTGATGACTGGAAGAGCAACACGGAGTATCA
AAACTACAACCCCTCGTCGCAACAAATACAGTGGTTTTGGCGAGTCGTTAGGTCCTTTGACAAGGAAGAGCGGGC
CAAGCTTCTGCAGTTTGTCACTGGCACAAGCAAGGTTCCCCTCAATGGCTTCAAGGAGCTTGAGGGCATGAACGG
CATCAATCGCTTCAATATCCACCGTGATTACGGCAACAAGGATCGACTACCCTCGTCGCACACGTGCTTCAATCG
TGAGTTTTTTTATTTTTTTTATTTTTTATTTTTTTTTATTTTTTGCGTCTCTGTGATTTTGACCAATAATTTTGC
CTTTTTGAGCCGTGCTAATTTCATTTCTGCAGAACTTGACCTTCCAGAGTATGATTCGTACGACGTGCTGCGATC
GCAGATTCTCAAGGCCATTACCCAGGGAAGCGAATACTTTGGGTTTGCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail