Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7486
Gene name
LocationContig_8:232622..235542
Strand-
Gene length (bp)2920
Transcript length (bp)2613
Coding sequence length (bp)2613
Protein length (aa) 871

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 2.1E-48 452 646

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q755I4|GYP5_ASHGO GTPase-activating protein GYP5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GYP5 PE=3 SV=2 480 855 1.0E-72
sp|Q12344|GYP5_YEAST GTPase-activating protein GYP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYP5 PE=1 SV=1 472 869 3.0E-69
sp|Q10496|GYP51_SCHPO GTPase activating protein Gyp51 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp51 PE=3 SV=1 505 865 3.0E-47
sp|Q96CN4|EVI5L_HUMAN EVI5-like protein OS=Homo sapiens GN=EVI5L PE=1 SV=1 480 850 4.0E-43
sp|O60447|EVI5_HUMAN Ecotropic viral integration site 5 protein homolog OS=Homo sapiens GN=EVI5 PE=1 SV=3 480 850 4.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q755I4|GYP5_ASHGO GTPase-activating protein GYP5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GYP5 PE=3 SV=2 480 855 1.0E-72
sp|Q12344|GYP5_YEAST GTPase-activating protein GYP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYP5 PE=1 SV=1 472 869 3.0E-69
sp|Q10496|GYP51_SCHPO GTPase activating protein Gyp51 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp51 PE=3 SV=1 505 865 3.0E-47
sp|Q96CN4|EVI5L_HUMAN EVI5-like protein OS=Homo sapiens GN=EVI5L PE=1 SV=1 480 850 4.0E-43
sp|O60447|EVI5_HUMAN Ecotropic viral integration site 5 protein homolog OS=Homo sapiens GN=EVI5 PE=1 SV=3 480 850 4.0E-42
sp|A2AWA9|RBGP1_MOUSE Rab GTPase-activating protein 1 OS=Mus musculus GN=Rabgap1 PE=1 SV=1 493 775 8.0E-39
sp|Q5ZJ17|RBG1L_CHICK Rab GTPase-activating protein 1-like OS=Gallus gallus GN=RABGAP1L PE=2 SV=1 472 736 8.0E-38
sp|Q5RCW6|RBG1L_PONAB Rab GTPase-activating protein 1-like OS=Pongo abelii GN=RABGAP1L PE=2 SV=1 471 663 3.0E-37
sp|Q5R372|RBG1L_HUMAN Rab GTPase-activating protein 1-like OS=Homo sapiens GN=RABGAP1L PE=1 SV=1 471 663 3.0E-37
sp|Q5RAN1|RBGP1_PONAB Rab GTPase-activating protein 1 OS=Pongo abelii GN=RABGAP1 PE=2 SV=1 493 663 4.0E-37
sp|Q9Y3P9|RBGP1_HUMAN Rab GTPase-activating protein 1 OS=Homo sapiens GN=RABGAP1 PE=1 SV=3 493 663 4.0E-37
sp|Q9VYY9|EVI5_DROME Ecotropic viral integration site 5 ortholog OS=Drosophila melanogaster GN=Evi5 PE=1 SV=3 466 795 2.0E-36
sp|A6H6A9|RBG1L_MOUSE Rab GTPase-activating protein 1-like OS=Mus musculus GN=Rabgap1l PE=1 SV=1 471 663 3.0E-36
sp|Q04322|GYL1_YEAST Probable GTPase-activating protein GYL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYL1 PE=1 SV=1 508 869 1.0E-35
sp|P97366|EVI5_MOUSE Ecotropic viral integration site 5 protein OS=Mus musculus GN=Evi5 PE=1 SV=2 480 850 2.0E-34
sp|Q8BYJ6|TBCD4_MOUSE TBC1 domain family member 4 OS=Mus musculus GN=Tbc1d4 PE=1 SV=2 470 666 2.0E-32
sp|Q60949|TBCD1_MOUSE TBC1 domain family member 1 OS=Mus musculus GN=Tbc1d1 PE=1 SV=3 470 663 9.0E-31
sp|Q86TI0|TBCD1_HUMAN TBC1 domain family member 1 OS=Homo sapiens GN=TBC1D1 PE=1 SV=2 470 663 1.0E-30
sp|O97790|TBCD1_BOVIN TBC1 domain family member 1 OS=Bos taurus GN=TBC1D1 PE=2 SV=2 470 663 1.0E-30
sp|O60343|TBCD4_HUMAN TBC1 domain family member 4 OS=Homo sapiens GN=TBC1D4 PE=1 SV=2 470 666 3.0E-30
sp|Q8BHL3|TB10B_MOUSE TBC1 domain family member 10B OS=Mus musculus GN=Tbc1d10b PE=1 SV=2 471 655 1.0E-20
sp|P58802|TB10A_MOUSE TBC1 domain family member 10A OS=Mus musculus GN=Tbc1d10a PE=1 SV=1 482 640 2.0E-20
sp|Q9BXI6|TB10A_HUMAN TBC1 domain family member 10A OS=Homo sapiens GN=TBC1D10A PE=1 SV=1 482 640 3.0E-20
sp|Q4KMP7|TB10B_HUMAN TBC1 domain family member 10B OS=Homo sapiens GN=TBC1D10B PE=1 SV=3 464 655 4.0E-20
sp|O94419|YQG2_SCHPO Putative GTPase-activating protein C1620.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1620.12c PE=3 SV=2 504 869 1.0E-19
sp|Q80XC3|US6NL_MOUSE USP6 N-terminal-like protein OS=Mus musculus GN=Usp6nl PE=1 SV=2 503 671 5.0E-18
sp|C8VDQ4|GYP2_EMENI Putative GTPase-activating protein AN11010 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN11010 PE=3 SV=1 471 660 1.0E-17
sp|Q92738|US6NL_HUMAN USP6 N-terminal-like protein OS=Homo sapiens GN=USP6NL PE=1 SV=3 503 671 1.0E-17
sp|Q8C9V1|TB10C_MOUSE Carabin OS=Mus musculus GN=Tbc1d10c PE=1 SV=1 503 646 4.0E-17
sp|Q8IV04|TB10C_HUMAN Carabin OS=Homo sapiens GN=TBC1D10C PE=1 SV=1 481 645 5.0E-17
sp|Q9P2M4|TBC14_HUMAN TBC1 domain family member 14 OS=Homo sapiens GN=TBC1D14 PE=1 SV=3 506 663 5.0E-17
sp|O96904|TBC12_DICDI Drainin OS=Dictyostelium discoideum GN=phgA PE=1 SV=1 496 690 4.0E-16
sp|A6H7I8|TBC14_BOVIN TBC1 domain family member 14 OS=Bos taurus GN=TBC1D14 PE=2 SV=2 474 663 4.0E-16
sp|Q0IHY4|TBC12_XENTR TBC1 domain family member 12 OS=Xenopus tropicalis GN=tbc1d12 PE=2 SV=1 483 664 6.0E-16
sp|P53258|GYP2_YEAST GTPase-activating protein GYP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDR1 PE=1 SV=1 475 660 1.0E-15
sp|A3KGB4|TBC8B_MOUSE TBC1 domain family member 8B OS=Mus musculus GN=Tbc1d8b PE=1 SV=1 475 680 1.0E-15
sp|O60347|TBC12_HUMAN TBC1 domain family member 12 OS=Homo sapiens GN=TBC1D12 PE=1 SV=3 483 659 2.0E-15
sp|Q6A039|TBC12_MOUSE TBC1 domain family member 12 OS=Mus musculus GN=Tbc1d12 PE=1 SV=2 483 659 4.0E-15
sp|Q5CD77|TBC14_RAT TBC1 domain family member 14 OS=Rattus norvegicus GN=Tbc1d14 PE=2 SV=2 506 663 4.0E-15
sp|Q6PBU5|GRT1A_DANRE Growth hormone-regulated TBC protein 1-A OS=Danio rerio GN=grtp1a PE=2 SV=1 472 655 5.0E-15
sp|Q8CGA2|TBC14_MOUSE TBC1 domain family member 14 OS=Mus musculus GN=Tbc1d14 PE=1 SV=2 506 663 6.0E-15
sp|Q0IIM8|TBC8B_HUMAN TBC1 domain family member 8B OS=Homo sapiens GN=TBC1D8B PE=1 SV=2 475 681 3.0E-14
sp|Q5TC63|GRTP1_HUMAN Growth hormone-regulated TBC protein 1 OS=Homo sapiens GN=GRTP1 PE=1 SV=4 502 647 1.0E-13
sp|B0R0W9|TBC8B_DANRE TBC1 domain family member 8B OS=Danio rerio GN=tbc1d8b PE=3 SV=1 475 748 3.0E-13
sp|Q66K14|TBC9B_HUMAN TBC1 domain family member 9B OS=Homo sapiens GN=TBC1D9B PE=1 SV=3 466 659 5.0E-13
sp|Q9Y2I9|TBC30_HUMAN TBC1 domain family member 30 OS=Homo sapiens GN=TBC1D30 PE=1 SV=2 483 641 1.0E-12
sp|Q3UYK3|TBCD9_MOUSE TBC1 domain family member 9 OS=Mus musculus GN=Tbc1d9 PE=2 SV=2 475 659 1.0E-12
sp|Q4QQU7|GRTP1_RAT Growth hormone-regulated TBC protein 1 OS=Rattus norvegicus GN=Grtp1 PE=2 SV=1 502 647 2.0E-12
sp|Q6ZT07|TBCD9_HUMAN TBC1 domain family member 9 OS=Homo sapiens GN=TBC1D9 PE=2 SV=2 475 659 2.0E-12
sp|Q5SVR0|TBC9B_MOUSE TBC1 domain family member 9B OS=Mus musculus GN=Tbc1d9b PE=1 SV=1 475 666 2.0E-12
sp|O43048|YH51_SCHPO TBC domain-containing protein C215.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC215.01 PE=3 SV=4 466 663 3.0E-12
sp|O95759|TBCD8_HUMAN TBC1 domain family member 8 OS=Homo sapiens GN=TBC1D8 PE=2 SV=3 477 706 3.0E-12
sp|Q9Z1A9|TBCD8_MOUSE TBC1 domain family member 8 OS=Mus musculus GN=Tbc1d8 PE=1 SV=2 477 706 3.0E-12
sp|Q6GL87|GRTP1_XENTR Growth hormone-regulated TBC protein 1 OS=Xenopus tropicalis GN=grtp1 PE=2 SV=1 502 647 3.0E-12
sp|Q69ZT9|TBC30_MOUSE TBC1 domain family member 30 OS=Mus musculus GN=Tbc1d30 PE=1 SV=2 483 641 9.0E-12
sp|Q09830|YAD4_SCHPO TBC domain-containing protein C4G8.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.04 PE=1 SV=1 472 661 3.0E-11
sp|Q9URY3|YLOH_SCHPO TBC domain-containing protein C1952.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1952.17c PE=3 SV=4 509 635 3.0E-11
sp|Q6GLZ0|GRTP1_XENLA Growth hormone-regulated TBC protein 1 OS=Xenopus laevis GN=grtp1 PE=2 SV=1 502 647 6.0E-11
sp|Q09445|GRTP6_CAEEL Growth hormone-regulated TBC protein 6 OS=Caenorhabditis elegans GN=tbc-6 PE=3 SV=3 481 657 8.0E-11
sp|Q9Y7J5|YOI9_SCHPO TBC domain-containing protein C1778.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1778.09 PE=3 SV=1 501 627 1.0E-10
sp|B5DFA1|TBD2A_RAT TBC1 domain family member 2A OS=Rattus norvegicus GN=Tbc1d2 PE=2 SV=1 509 660 2.0E-10
sp|Q28C33|TBC30_XENTR TBC1 domain family member 30 OS=Xenopus tropicalis GN=tbc1d30 PE=2 SV=1 483 641 2.0E-10
sp|Q3U0J8|TBD2B_MOUSE TBC1 domain family member 2B OS=Mus musculus GN=Tbc1d2b PE=1 SV=2 466 660 2.0E-10
sp|O94711|GYP2_SCHPO GTPase-activating protein gyp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp2 PE=3 SV=1 477 651 5.0E-10
sp|Q9UPU7|TBD2B_HUMAN TBC1 domain family member 2B OS=Homo sapiens GN=TBC1D2B PE=1 SV=2 466 660 8.0E-10
sp|B1AVH7|TBD2A_MOUSE TBC1 domain family member 2A OS=Mus musculus GN=Tbc1d2 PE=2 SV=1 509 660 1.0E-09
sp|Q9D3N8|GRTP1_MOUSE Growth hormone-regulated TBC protein 1 OS=Mus musculus GN=Grtp1 PE=1 SV=1 479 652 3.0E-09
sp|A6QP29|TBD2A_BOVIN TBC1 domain family member 2A OS=Bos taurus GN=TBC1D2 PE=2 SV=1 509 659 3.0E-09
sp|Q9BYX2|TBD2A_HUMAN TBC1 domain family member 2A OS=Homo sapiens GN=TBC1D2 PE=1 SV=3 509 660 3.0E-09
sp|Q28CB1|TBD2B_XENTR TBC1 domain family member 2B OS=Xenopus tropicalis GN=tbc1d2b PE=2 SV=1 475 660 4.0E-09
sp|Q9CXF4|TBC15_MOUSE TBC1 domain family member 15 OS=Mus musculus GN=Tbc1d15 PE=1 SV=1 506 626 6.0E-09
sp|Q8TC07|TBC15_HUMAN TBC1 domain family member 15 OS=Homo sapiens GN=TBC1D15 PE=1 SV=2 506 626 1.0E-08
sp|Q12317|MSB4_YEAST GTPase-activating protein MSB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB4 PE=1 SV=1 509 647 1.0E-08
sp|Q5F361|TBCK_CHICK TBC domain-containing protein kinase-like protein OS=Gallus gallus GN=TBCK PE=2 SV=2 509 648 2.0E-08
sp|Q8BM85|TBCK_MOUSE TBC domain-containing protein kinase-like protein OS=Mus musculus GN=Tbck PE=1 SV=1 509 648 4.0E-08
sp|Q7T2D0|SGSM3_DANRE Small G protein signaling modulator 3 OS=Danio rerio GN=sgsm3 PE=2 SV=1 466 648 4.0E-08
sp|Q9UUH7|GYP7_SCHPO GTPase-activating protein gyp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp7 PE=3 SV=1 509 629 5.0E-08
sp|Q8TEA7|TBCK_HUMAN TBC domain-containing protein kinase-like protein OS=Homo sapiens GN=TBCK PE=1 SV=4 509 648 7.0E-08
sp|Q755I4|GYP5_ASHGO GTPase-activating protein GYP5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GYP5 PE=3 SV=2 337 406 1.0E-07
sp|Q2KI13|SGSM3_BOVIN Small G protein signaling modulator 3 OS=Bos taurus GN=SGSM3 PE=2 SV=1 466 646 2.0E-07
sp|Q8R3D1|TBC13_MOUSE TBC1 domain family member 13 OS=Mus musculus GN=Tbc1d13 PE=1 SV=1 513 647 2.0E-07
sp|Q6P6R7|SGSM3_RAT Small G protein signaling modulator 3 OS=Rattus norvegicus GN=Sgsm3 PE=1 SV=1 466 646 2.0E-07
sp|Q8VCZ6|SGSM3_MOUSE Small G protein signaling modulator 3 OS=Mus musculus GN=Sgsm3 PE=1 SV=1 466 646 2.0E-07
sp|Q12344|GYP5_YEAST GTPase-activating protein GYP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYP5 PE=1 SV=1 337 398 5.0E-07
sp|A6H8I2|SGSM3_XENLA Small G protein signaling modulator 3 homolog OS=Xenopus laevis GN=sgsm3 PE=2 SV=1 466 646 5.0E-07
sp|P36618|CDC16_SCHPO Cell division control protein 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc16 PE=1 SV=1 477 628 7.0E-07
sp|Q96HU1|SGSM3_HUMAN Small G protein signaling modulator 3 OS=Homo sapiens GN=SGSM3 PE=1 SV=1 466 640 8.0E-07
sp|Q9NVG8|TBC13_HUMAN TBC1 domain family member 13 OS=Homo sapiens GN=TBC1D13 PE=1 SV=3 513 647 1.0E-06
sp|Q55EP9|BUB2_DICDI Putative mitotic check point protein BUB2 OS=Dictyostelium discoideum GN=bub2 PE=3 SV=1 481 643 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7486
MTQPRDDVVSPPPPQPDDSAKAKASSLADSDLETVAAEHDTFEDALDNASVRSLTKRTVSASKSTSPVADSDDIA
ERASTPSGKDDVAESVDLGAKRKSRRTSSPLSARISNSSNLDNVNLDDDSSTKPREPQNSVDRDQATKTLSLNSI
TSALPSMPWSPPTDSSAKSLGQSTNATAPQPSVTTSHPPPPSRKLTSPFSWLSRNATSKEKETSPPARSPRRDTT
SSVATLTSNPEMMLSKLEEEKEAGGSASSGTNRESLKDRFKALRLREESGLVAQNGDSDKTSVSALGADNQGDDV
AAMDKPPLSPVPAPNNQLAPGTVSGINAGPSAMPDTQVDWDLWQSVVYEGPAAVARTSAEELNKAIATGIPNAIR
GVIWQVLAQSKNESLEVVYKDLVARGTDKDKDRNSNSTTASITSNGNLSAHSIDGTLSSASSTHSGQSSPKVDKS
TEPTAKAHSTSTAERKKKTKEDTAALQKLEKTIRRDLGARTSYSKYAAAAGLQEGLFGVCKAYALYDEGVGYAQG
MNFLIMPLLFNMAEQEAFCLLVRLMNQYHLRELFVQDMPGLHLHLYQFERLLEDIEPALYCHLHRRGISPHLYAT
QWFLTLFAYRFPLQLVLRIYDLIFSEGLSAVLRFGIVLMQKNAATLLSIADMQQLTTYLKDKLFDVYIDKDPSQG
SILENGFFGSSSSSIDKEVYRADQLIRDACEVKLTPEALKMYTVEWEEKTKTERDRETELQDLRTTNQSYAIKIR
KLEERVEVCDHEQTAMATEMVHTKVENEELRDENESLKGQVRELRVVIEKQPLEIEQNWQLERDDLMKRNEKVHE
ENQKLEKELGELEEELVQTKMRYAEINSLHEALSRKWSDLKRQFA*
Coding >OphauB2|7486
ATGACGCAGCCACGCGACGACGTGGTTTCGCCGCCGCCGCCCCAGCCTGATGACAGCGCCAAGGCCAAGGCGTCA
TCTTTAGCCGACTCTGACCTGGAGACTGTGGCTGCCGAGCACGACACTTTCGAAGATGCCCTTGACAACGCCTCG
GTGCGATCGTTGACGAAGCGAACTGTTTCTGCCTCCAAGAGCACATCTCCTGTCGCGGACAGCGATGACATTGCC
GAGAGAGCGTCAACTCCTAGTGGCAAAGACGATGTTGCCGAATCTGTCGACTTGGGAGCAAAGCGCAAATCGCGC
CGCACATCATCCCCCCTTTCTGCACGCATCTCTAATTCATCCAATCTCGATAATGTCAACCTAGACGACGACTCA
TCTACAAAACCTCGAGAGCCCCAGAACTCCGTGGATAGGGACCAAGCCACCAAGACCCTATCTCTAAACAGCATA
ACCAGCGCGCTGCCCTCAATGCCTTGGTCTCCACCGACAGATTCGTCGGCAAAGAGTTTGGGCCAGTCAACCAAC
GCCACTGCTCCTCAACCTTCTGTGACTACATCGCACCCACCACCACCCTCTCGAAAGCTTACCAGTCCATTTTCC
TGGCTCTCGCGGAATGCTACAAGCAAGGAAAAAGAAACTTCGCCTCCCGCAAGGTCTCCGAGAAGAGATACTACT
AGCTCTGTCGCAACCTTGACGAGCAATCCTGAGATGATGCTCAGCAAACTCGAGGAGGAGAAGGAGGCTGGTGGC
AGTGCTAGCAGTGGCACTAACCGTGAAAGCCTCAAGGATAGATTCAAGGCATTAAGACTGCGCGAAGAGAGTGGT
CTTGTGGCACAGAATGGCGATAGCGACAAGACGAGTGTCAGCGCTCTCGGCGCCGATAATCAAGGCGATGATGTA
GCAGCCATGGACAAGCCGCCTTTGTCTCCTGTTCCTGCTCCCAATAATCAGCTTGCGCCGGGCACTGTGTCTGGA
ATCAACGCAGGACCTTCGGCCATGCCAGACACCCAAGTTGATTGGGATCTGTGGCAATCTGTTGTCTACGAGGGT
CCTGCCGCAGTCGCGCGGACCAGTGCTGAAGAGCTCAACAAGGCCATTGCCACTGGAATCCCAAACGCCATTCGC
GGAGTCATCTGGCAGGTCCTGGCTCAAAGTAAGAATGAGAGCCTAGAAGTTGTTTACAAGGATTTAGTGGCCCGG
GGCACCGACAAGGACAAGGATCGGAACAGTAATAGCACGACGGCGAGCATCACTAGCAACGGCAACCTCAGTGCT
CACAGCATCGATGGCACACTATCGTCAGCATCGTCGACACATTCGGGGCAGTCATCTCCCAAGGTAGATAAGAGC
ACCGAGCCAACTGCCAAGGCCCACAGTACGTCGACCGCCGAGCGAAAGAAGAAGACCAAGGAAGATACTGCGGCT
TTGCAGAAGCTCGAAAAGACGATACGTCGTGACCTGGGAGCTCGCACGAGTTATTCAAAGTACGCAGCAGCGGCT
GGGCTTCAAGAGGGCCTGTTCGGCGTTTGTAAAGCTTATGCTTTGTATGATGAGGGAGTAGGTTATGCACAAGGC
ATGAACTTCCTCATCATGCCGCTCCTATTCAATATGGCAGAGCAAGAGGCATTTTGTCTTCTCGTCCGTCTTATG
AACCAATACCACTTGCGGGAGCTCTTTGTCCAGGACATGCCGGGCCTACATCTGCATCTGTATCAATTTGAGCGC
CTTCTCGAGGACATTGAACCCGCGCTATACTGTCATTTGCATCGTCGCGGCATCTCACCCCATCTATATGCCACG
CAGTGGTTTCTGACACTTTTCGCCTACCGCTTTCCCCTTCAGTTGGTTCTTCGCATCTACGATCTGATATTTTCC
GAAGGCCTATCTGCTGTTCTCCGATTCGGTATCGTCTTGATGCAGAAAAATGCTGCAACTCTGCTAAGCATCGCC
GACATGCAACAGCTTACTACTTACCTCAAGGACAAGCTGTTCGACGTGTACATTGACAAGGACCCGAGCCAGGGA
AGCATACTGGAAAACGGCTTCTTTGGAAGTTCCAGTTCGAGTATTGACAAGGAGGTATACAGAGCTGATCAGCTC
ATTCGAGACGCTTGTGAGGTCAAGCTTACGCCTGAAGCTCTCAAGATGTACACAGTTGAATGGGAAGAAAAGACA
AAGACGGAGCGCGATCGCGAGACGGAGCTGCAGGACCTTCGCACTACCAACCAGAGCTATGCGATCAAGATTCGA
AAACTGGAGGAGAGGGTCGAGGTTTGCGACCACGAGCAAACCGCCATGGCCACAGAAATGGTTCATACCAAGGTC
GAGAATGAGGAACTTCGAGATGAAAACGAGAGCCTCAAGGGTCAGGTGCGAGAGCTCAGGGTGGTGATTGAGAAG
CAGCCCCTAGAGATTGAACAGAACTGGCAGCTTGAGCGGGACGACTTGATGAAGCGCAATGAAAAGGTCCACGAG
GAGAACCAGAAGCTCGAGAAGGAGCTGGGGGAGCTCGAGGAGGAACTTGTCCAGACCAAGATGCGGTATGCCGAG
ATCAACTCTTTGCATGAGGCGCTCTCTCGAAAGTGGTCCGATCTGAAGCGTCAATTTGCCTAA
Transcript >OphauB2|7486
ATGACGCAGCCACGCGACGACGTGGTTTCGCCGCCGCCGCCCCAGCCTGATGACAGCGCCAAGGCCAAGGCGTCA
TCTTTAGCCGACTCTGACCTGGAGACTGTGGCTGCCGAGCACGACACTTTCGAAGATGCCCTTGACAACGCCTCG
GTGCGATCGTTGACGAAGCGAACTGTTTCTGCCTCCAAGAGCACATCTCCTGTCGCGGACAGCGATGACATTGCC
GAGAGAGCGTCAACTCCTAGTGGCAAAGACGATGTTGCCGAATCTGTCGACTTGGGAGCAAAGCGCAAATCGCGC
CGCACATCATCCCCCCTTTCTGCACGCATCTCTAATTCATCCAATCTCGATAATGTCAACCTAGACGACGACTCA
TCTACAAAACCTCGAGAGCCCCAGAACTCCGTGGATAGGGACCAAGCCACCAAGACCCTATCTCTAAACAGCATA
ACCAGCGCGCTGCCCTCAATGCCTTGGTCTCCACCGACAGATTCGTCGGCAAAGAGTTTGGGCCAGTCAACCAAC
GCCACTGCTCCTCAACCTTCTGTGACTACATCGCACCCACCACCACCCTCTCGAAAGCTTACCAGTCCATTTTCC
TGGCTCTCGCGGAATGCTACAAGCAAGGAAAAAGAAACTTCGCCTCCCGCAAGGTCTCCGAGAAGAGATACTACT
AGCTCTGTCGCAACCTTGACGAGCAATCCTGAGATGATGCTCAGCAAACTCGAGGAGGAGAAGGAGGCTGGTGGC
AGTGCTAGCAGTGGCACTAACCGTGAAAGCCTCAAGGATAGATTCAAGGCATTAAGACTGCGCGAAGAGAGTGGT
CTTGTGGCACAGAATGGCGATAGCGACAAGACGAGTGTCAGCGCTCTCGGCGCCGATAATCAAGGCGATGATGTA
GCAGCCATGGACAAGCCGCCTTTGTCTCCTGTTCCTGCTCCCAATAATCAGCTTGCGCCGGGCACTGTGTCTGGA
ATCAACGCAGGACCTTCGGCCATGCCAGACACCCAAGTTGATTGGGATCTGTGGCAATCTGTTGTCTACGAGGGT
CCTGCCGCAGTCGCGCGGACCAGTGCTGAAGAGCTCAACAAGGCCATTGCCACTGGAATCCCAAACGCCATTCGC
GGAGTCATCTGGCAGGTCCTGGCTCAAAGTAAGAATGAGAGCCTAGAAGTTGTTTACAAGGATTTAGTGGCCCGG
GGCACCGACAAGGACAAGGATCGGAACAGTAATAGCACGACGGCGAGCATCACTAGCAACGGCAACCTCAGTGCT
CACAGCATCGATGGCACACTATCGTCAGCATCGTCGACACATTCGGGGCAGTCATCTCCCAAGGTAGATAAGAGC
ACCGAGCCAACTGCCAAGGCCCACAGTACGTCGACCGCCGAGCGAAAGAAGAAGACCAAGGAAGATACTGCGGCT
TTGCAGAAGCTCGAAAAGACGATACGTCGTGACCTGGGAGCTCGCACGAGTTATTCAAAGTACGCAGCAGCGGCT
GGGCTTCAAGAGGGCCTGTTCGGCGTTTGTAAAGCTTATGCTTTGTATGATGAGGGAGTAGGTTATGCACAAGGC
ATGAACTTCCTCATCATGCCGCTCCTATTCAATATGGCAGAGCAAGAGGCATTTTGTCTTCTCGTCCGTCTTATG
AACCAATACCACTTGCGGGAGCTCTTTGTCCAGGACATGCCGGGCCTACATCTGCATCTGTATCAATTTGAGCGC
CTTCTCGAGGACATTGAACCCGCGCTATACTGTCATTTGCATCGTCGCGGCATCTCACCCCATCTATATGCCACG
CAGTGGTTTCTGACACTTTTCGCCTACCGCTTTCCCCTTCAGTTGGTTCTTCGCATCTACGATCTGATATTTTCC
GAAGGCCTATCTGCTGTTCTCCGATTCGGTATCGTCTTGATGCAGAAAAATGCTGCAACTCTGCTAAGCATCGCC
GACATGCAACAGCTTACTACTTACCTCAAGGACAAGCTGTTCGACGTGTACATTGACAAGGACCCGAGCCAGGGA
AGCATACTGGAAAACGGCTTCTTTGGAAGTTCCAGTTCGAGTATTGACAAGGAGGTATACAGAGCTGATCAGCTC
ATTCGAGACGCTTGTGAGGTCAAGCTTACGCCTGAAGCTCTCAAGATGTACACAGTTGAATGGGAAGAAAAGACA
AAGACGGAGCGCGATCGCGAGACGGAGCTGCAGGACCTTCGCACTACCAACCAGAGCTATGCGATCAAGATTCGA
AAACTGGAGGAGAGGGTCGAGGTTTGCGACCACGAGCAAACCGCCATGGCCACAGAAATGGTTCATACCAAGGTC
GAGAATGAGGAACTTCGAGATGAAAACGAGAGCCTCAAGGGTCAGGTGCGAGAGCTCAGGGTGGTGATTGAGAAG
CAGCCCCTAGAGATTGAACAGAACTGGCAGCTTGAGCGGGACGACTTGATGAAGCGCAATGAAAAGGTCCACGAG
GAGAACCAGAAGCTCGAGAAGGAGCTGGGGGAGCTCGAGGAGGAACTTGTCCAGACCAAGATGCGGTATGCCGAG
ATCAACTCTTTGCATGAGGCGCTCTCTCGAAAGTGGTCCGATCTGAAGCGTCAATTTGCCTAA
Gene >OphauB2|7486
ATGACGCAGCCACGCGACGACGTGGTTTCGCCGCCGCCGCCCCAGCCTGATGACAGCGCCAAGGCCAAGGCGTCA
TCTTTAGCCGACTCTGACCTGGAGACTGTGGTACGTCGGTGGCAACGCGCAGCCATGACTCTCGCTTGACAGTTG
TTTGAATCCTTTGCTGACTTATACCCTGTTACACCCTCATTTCAGGCTGCCGAGCACGACACTTTCGAAGATGCC
CTTGACAACGCCTCGGTGCGATCGTTGACGAAGCGAACTGTTTCTGCCTCCAAGAGCACATCTCCTGTCGCGGAC
AGCGATGACATTGCCGAGAGAGCGTCAACTCCTAGTGGCAAAGACGATGTTGCCGAATCTGTCGACTTGGGAGCA
AAGCGCAAATCGCGCCGCACATCATCCCCCCTTTCTGCACGCATCTCTAATTCATCCAATCTCGATAATGTCAAC
CTAGACGACGACTCATCTACAAAACCTCGAGGTGAGAGCGTGCCTCTCTCCCTGAGCTATTGGCACATGCTTCAA
GTTTGGATGAGCTGACATGCGCCCAGAGCCCCAGAACTCCGTGGATAGGGACCAAGCCACCAAGACCCTATCTCT
AAACAGCATAACCAGCGCGCTGCCCTCAATGCCTTGGTCTCCACCGACAGATTCGTCGGCAAAGAGTTTGGGCCA
GTCAACCAACGCCACTGCTCCTCAACCTTCTGTGACTACATCGCACCCACCACCACCCTCTCGAAAGCTTACCAG
TCCATTTTCCTGGCTCTCGCGGAATGCTACAAGCAAGGAAAAAGAAACTTCGCCTCCCGCAAGGTCTCCGAGAAG
AGATACTACTAGCTCTGTCGCAACCTTGACGAGCAATCCTGAGATGATGCTCAGCAAACTCGAGGAGGAGAAGGA
GGCTGGTGGCAGTGCTAGCAGTGGCACTAACCGTGAAAGCCTCAAGGATAGATTCAAGGCATTAAGACTGCGCGA
AGAGAGTGGTCTTGTGGCACAGAATGGCGATAGCGACAAGACGAGTGTCAGCGCTCTCGGCGCCGATAATCAAGG
CGATGATGTAGCAGCCATGGACAAGCCGCCTTTGTCTCCTGTTCCTGCTCCCAATAATCAGCTTGCGCCGGGCAC
TGTGTCTGGAATCAACGCAGGACCTTCGGCCATGCCAGACACCCAAGTTGATTGGGATCTGTGGCAATCTGTTGT
CTACGAGGGTCCTGCCGCAGTCGCGCGGACCAGTGCTGAAGAGCTCAACAAGGCCATTGCCACTGGAATCCCAAA
CGCCATTCGCGGAGTCATCTGGCAGGTCCTGGCTCAAAGTAAGAATGAGAGCCTAGAAGTTGTTTACAAGGATTT
AGTGGCCCGGGGCACCGACAAGGACAAGGATCGGAACAGTAATAGCACGACGGCGAGCATCACTAGCAACGGCAA
CCTCAGTGCTCACAGCATCGATGGCACACTATCGTCAGCATCGTCGACACATTCGGGGCAGTCATCTCCCAAGGT
AGATAAGAGCACCGAGCCAACTGCCAAGGCCCACAGTACGTCGACCGCCGAGCGAAAGAAGAAGACCAAGGAAGA
TACTGCGGCTTTGCAGAAGCTCGAAAAGACGATACGTCGTGACCTGGGAGCTCGCACGAGTTATTCAAAGTACGC
AGCAGCGGCTGGGCTTCAAGAGGGCCTGTTCGGCGTTTGTAAAGCTTATGCTTTGTATGATGAGGGAGTAGGTTA
TGCACAAGGCATGAACTTCCTCATCATGCCGCTCCTATTCAATGTGAGTATTCCCTGTTGCGCGGGTAGTGACTA
CCAGGTATCCAGCAATAATGGTGCTGACTTATCCGAAAAAAAGATGGCAGAGCAAGAGGCATTTTGTCTTCTCGT
CCGTCTTATGAACCAATACCACTTGCGGGAGCTCTTTGTCCAGGACATGCCGGGCCTACATCTGCATCTGTATCA
ATTTGAGCGCCTTCTCGAGGACATTGAACCCGCGCTATACTGTCATTTGCATCGTCGCGGCATCTCACCCCATCT
ATATGCCACGCAGTGGTTTCTGACACTTTTCGCCTACCGCTTTCCCCTTCAGTTGGTTCTTCGCATCTACGATCT
GATATTTTCCGAAGGCCTATCTGCTGTTCTCCGATTCGGTATCGTCTTGATGCAGAAAAATGCTGCAACTCTGCT
AAGCATCGCCGACATGCAACAGCTTACTACTTACCTCAAGGACAAGCTGTTCGACGTGTACATTGACAAGGACCC
GAGCCAGGGAAGCATACTGGAAAACGGCTTCTTTGGAAGTTCCAGTTCGAGTATTGACAAGGAGGTATACAGAGC
TGATCAGCTCATTCGAGACGCTTGTGAGGTCAAGCTTACGCCTGAAGCTCTCAAGATGTACACAGTTGAATGGGA
AGAAAAGACAAAGACGGAGCGCGATCGCGAGACGGAGCTGCAGGACCTTCGCACTACCAACCAGAGCTATGCGAT
CAAGATTCGAAAACTGGAGGAGAGGGTCGAGGTTTGCGACCACGAGCAAACCGCCATGGCCACAGAAATGGTTCA
TACCAAGGTCGAGAATGAGGAACTTCGAGATGAAAACGAGAGCCTCAAGGGTCAGGTGCGAGAGCTCAGGGTGGT
GATTGAGAAGCAGCCCCTAGAGATTGAACAGAACTGGCAGCTTGAGCGGGACGACTTGATGAAGCGCAATGAAAA
GGTCCACGAGGAGAACCAGAAGCTCGAGAAGGAGCTGGGGGAGCTCGAGGAGGAACTTGTCCAGACCAAGATGCG
GTATGCCGAGGTAAGAAGACGTAACCGCTATAGCCGGCTTCAAGATGAAGCGAATGCTAATTTTTGGCCCCTTGC
CTTATAGATCAACTCTTTGCATGAGGCGCTCTCTCGAAAGTGGTCCGATCTGAAGCGTCAATTTGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail