Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7483
Gene name
LocationContig_8:226033..226999
Strand-
Gene length (bp)966
Transcript length (bp)903
Coding sequence length (bp)903
Protein length (aa) 301

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02544 Steroid_dh 3-oxo-5-alpha-steroid 4-dehydrogenase 6.7E-30 149 299
PF06966 DUF1295 Protein of unknown function (DUF1295) 1.1E-04 171 274

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94511|YN67_SCHPO Putative enoyl reductase C646.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC646.07c PE=3 SV=1 1 300 6.0E-64
sp|Q55C17|TECR_DICDI Very-long-chain enoyl-CoA reductase OS=Dictyostelium discoideum GN=gpsn2 PE=3 SV=1 29 300 6.0E-62
sp|Q9N5Y2|TECR_CAEEL Probable very-long-chain enoyl-CoA reductase art-1 OS=Caenorhabditis elegans GN=art-1 PE=3 SV=1 1 300 7.0E-50
sp|Q64232|TECR_RAT Very-long-chain enoyl-CoA reductase OS=Rattus norvegicus GN=Tecr PE=1 SV=1 57 300 1.0E-46
sp|Q9NZ01|TECR_HUMAN Very-long-chain enoyl-CoA reductase OS=Homo sapiens GN=TECR PE=1 SV=1 57 300 2.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94511|YN67_SCHPO Putative enoyl reductase C646.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC646.07c PE=3 SV=1 1 300 6.0E-64
sp|Q55C17|TECR_DICDI Very-long-chain enoyl-CoA reductase OS=Dictyostelium discoideum GN=gpsn2 PE=3 SV=1 29 300 6.0E-62
sp|Q9N5Y2|TECR_CAEEL Probable very-long-chain enoyl-CoA reductase art-1 OS=Caenorhabditis elegans GN=art-1 PE=3 SV=1 1 300 7.0E-50
sp|Q64232|TECR_RAT Very-long-chain enoyl-CoA reductase OS=Rattus norvegicus GN=Tecr PE=1 SV=1 57 300 1.0E-46
sp|Q9NZ01|TECR_HUMAN Very-long-chain enoyl-CoA reductase OS=Homo sapiens GN=TECR PE=1 SV=1 57 300 2.0E-46
sp|Q9CY27|TECR_MOUSE Very-long-chain enoyl-CoA reductase OS=Mus musculus GN=Tecr PE=1 SV=1 57 300 2.0E-46
sp|Q3ZCD7|TECR_BOVIN Very-long-chain enoyl-CoA reductase OS=Bos taurus GN=TECR PE=2 SV=1 57 300 4.0E-46
sp|Q9M2U2|TECR_ARATH Very-long-chain enoyl-CoA reductase OS=Arabidopsis thaliana GN=ECR PE=1 SV=1 75 300 3.0E-35
sp|Q99190|TECR_YEAST Very-long-chain enoyl-CoA reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSC13 PE=1 SV=1 25 297 9.0E-34
sp|Q8BFZ1|TECRL_MOUSE Trans-2,3-enoyl-CoA reductase-like OS=Mus musculus GN=Tecrl PE=1 SV=1 46 300 4.0E-31
sp|Q3SZ89|TECRL_BOVIN Trans-2,3-enoyl-CoA reductase-like OS=Bos taurus GN=TECRL PE=2 SV=1 46 300 1.0E-27
sp|Q5HYJ1|TECRL_HUMAN Trans-2,3-enoyl-CoA reductase-like OS=Homo sapiens GN=TECRL PE=2 SV=1 3 300 1.0E-27
sp|Q2QDF6|DET2_GOSHI Steroid 5-alpha-reductase DET2 OS=Gossypium hirsutum GN=DET2 PE=1 SV=1 194 297 1.0E-08
sp|A5PJS2|S5A1_BOVIN 3-oxo-5-alpha-steroid 4-dehydrogenase 1 OS=Bos taurus GN=SRD5A1 PE=2 SV=1 113 300 2.0E-07
sp|Q5K2N1|DET2_SOLLC Steroid 5-alpha-reductase DET2 OS=Solanum lycopersicum GN=DET2 PE=1 SV=1 193 299 2.0E-07
sp|P24008|S5A1_RAT 3-oxo-5-alpha-steroid 4-dehydrogenase 1 OS=Rattus norvegicus GN=Srd5a1 PE=1 SV=2 164 300 3.0E-07
sp|Q68FF9|S5A1_MOUSE 3-oxo-5-alpha-steroid 4-dehydrogenase 1 OS=Mus musculus GN=Srd5a1 PE=2 SV=2 130 300 4.0E-07
sp|Q38944|DET2_ARATH Steroid 5-alpha-reductase DET2 OS=Arabidopsis thaliana GN=DET2 PE=1 SV=2 193 297 1.0E-06
sp|Q9CAH5|POED1_ARATH Polyprenol reductase 1 OS=Arabidopsis thaliana GN=At1g72590 PE=3 SV=1 132 297 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0006629 lipid metabolic process Yes
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

Domain # Start End Length
1 84 106 22
2 111 133 22
3 161 183 22
4 193 215 22
5 228 250 22
6 255 274 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7483
MAITLSDYNAKRPIKGLPKALEPPKGTTVQGLKKLIAAQTQLSDFNRIGLYDSSTSKPLKDRNLRIDDVAIDDKL
LVKDLGPQVAWRTVFVVEYLGPIVIHMMFVAARRHLWANAGAMSTTQWLAFGMIVGHFVKREMETLFVHKFSANT
MPVRNIYKNSIFYWALSGVLCAWNIYNPRSLAATADLPAMDYMGLALFLFGETGNALVHLHLSSLRAPGSTERKI
PTGYGFALVTCPNYMYEVLSWVGIIVTSRSWAVAVFIAVGGAQMLQWALGKERAYRKEFGDKYKKKRYVMLPGLL
*
Coding >OphauB2|7483
ATGGCCATTACTCTCTCTGATTATAACGCCAAACGGCCCATCAAGGGCCTTCCCAAGGCCCTGGAGCCGCCCAAG
GGCACCACGGTTCAAGGCCTCAAGAAGCTCATTGCCGCGCAGACGCAGCTGTCCGACTTCAACCGTATCGGCCTG
TACGACTCGTCGACAAGCAAGCCTCTCAAGGACCGCAATCTGCGCATCGACGACGTGGCCATTGACGACAAGCTG
CTTGTCAAGGATCTCGGGCCCCAGGTCGCTTGGCGCACCGTCTTTGTCGTCGAGTACCTGGGCCCCATTGTGATC
CACATGATGTTTGTGGCGGCAAGGAGGCATCTCTGGGCCAATGCGGGCGCCATGTCGACGACACAGTGGCTCGCC
TTTGGCATGATTGTGGGACATTTTGTCAAGCGCGAGATGGAGACGCTCTTTGTGCACAAGTTCTCGGCAAACACG
ATGCCGGTGCGCAACATTTACAAGAACAGCATCTTTTACTGGGCTCTTTCGGGTGTGCTCTGCGCTTGGAATATC
TACAACCCACGCTCGCTGGCTGCCACGGCCGACTTGCCCGCCATGGACTACATGGGCCTGGCTCTTTTCCTCTTT
GGCGAGACTGGCAACGCCCTCGTGCATTTACACCTGTCGTCGCTGCGTGCTCCGGGCAGCACCGAGCGCAAGATC
CCCACGGGCTATGGCTTTGCCTTGGTCACCTGTCCCAACTACATGTACGAGGTGCTTTCGTGGGTGGGCATCATT
GTCACCAGTCGGAGCTGGGCTGTGGCTGTTTTTATTGCCGTGGGTGGCGCGCAGATGTTGCAGTGGGCCCTGGGC
AAGGAGCGTGCCTACCGCAAGGAGTTTGGCGACAAGTACAAGAAGAAGCGATATGTCATGCTGCCTGGCCTGCTA
TAG
Transcript >OphauB2|7483
ATGGCCATTACTCTCTCTGATTATAACGCCAAACGGCCCATCAAGGGCCTTCCCAAGGCCCTGGAGCCGCCCAAG
GGCACCACGGTTCAAGGCCTCAAGAAGCTCATTGCCGCGCAGACGCAGCTGTCCGACTTCAACCGTATCGGCCTG
TACGACTCGTCGACAAGCAAGCCTCTCAAGGACCGCAATCTGCGCATCGACGACGTGGCCATTGACGACAAGCTG
CTTGTCAAGGATCTCGGGCCCCAGGTCGCTTGGCGCACCGTCTTTGTCGTCGAGTACCTGGGCCCCATTGTGATC
CACATGATGTTTGTGGCGGCAAGGAGGCATCTCTGGGCCAATGCGGGCGCCATGTCGACGACACAGTGGCTCGCC
TTTGGCATGATTGTGGGACATTTTGTCAAGCGCGAGATGGAGACGCTCTTTGTGCACAAGTTCTCGGCAAACACG
ATGCCGGTGCGCAACATTTACAAGAACAGCATCTTTTACTGGGCTCTTTCGGGTGTGCTCTGCGCTTGGAATATC
TACAACCCACGCTCGCTGGCTGCCACGGCCGACTTGCCCGCCATGGACTACATGGGCCTGGCTCTTTTCCTCTTT
GGCGAGACTGGCAACGCCCTCGTGCATTTACACCTGTCGTCGCTGCGTGCTCCGGGCAGCACCGAGCGCAAGATC
CCCACGGGCTATGGCTTTGCCTTGGTCACCTGTCCCAACTACATGTACGAGGTGCTTTCGTGGGTGGGCATCATT
GTCACCAGTCGGAGCTGGGCTGTGGCTGTTTTTATTGCCGTGGGTGGCGCGCAGATGTTGCAGTGGGCCCTGGGC
AAGGAGCGTGCCTACCGCAAGGAGTTTGGCGACAAGTACAAGAAGAAGCGATATGTCATGCTGCCTGGCCTGCTA
TAG
Gene >OphauB2|7483
ATGGCCATTACTCTCTCTGATTATAGTCAGAACCATGCTCCCTCTTGCCGCATCAGTTGCAATAGAAGAAGCTAA
CATGCGTACAAAGACGCCAAACGGCCCATCAAGGGCCTTCCCAAGGCCCTGGAGCCGCCCAAGGGCACCACGGTT
CAAGGCCTCAAGAAGCTCATTGCCGCGCAGACGCAGCTGTCCGACTTCAACCGTATCGGCCTGTACGACTCGTCG
ACAAGCAAGCCTCTCAAGGACCGCAATCTGCGCATCGACGACGTGGCCATTGACGACAAGCTGCTTGTCAAGGAT
CTCGGGCCCCAGGTCGCTTGGCGCACCGTCTTTGTCGTCGAGTACCTGGGCCCCATTGTGATCCACATGATGTTT
GTGGCGGCAAGGAGGCATCTCTGGGCCAATGCGGGCGCCATGTCGACGACACAGTGGCTCGCCTTTGGCATGATT
GTGGGACATTTTGTCAAGCGCGAGATGGAGACGCTCTTTGTGCACAAGTTCTCGGCAAACACGATGCCGGTGCGC
AACATTTACAAGAACAGCATCTTTTACTGGGCTCTTTCGGGTGTGCTCTGCGCTTGGAATATCTACAACCCACGC
TCGCTGGCTGCCACGGCCGACTTGCCCGCCATGGACTACATGGGCCTGGCTCTTTTCCTCTTTGGCGAGACTGGC
AACGCCCTCGTGCATTTACACCTGTCGTCGCTGCGTGCTCCGGGCAGCACCGAGCGCAAGATCCCCACGGGCTAT
GGCTTTGCCTTGGTCACCTGTCCCAACTACATGTACGAGGTGCTTTCGTGGGTGGGCATCATTGTCACCAGTCGG
AGCTGGGCTGTGGCTGTTTTTATTGCCGTGGGTGGCGCGCAGATGTTGCAGTGGGCCCTGGGCAAGGAGCGTGCC
TACCGCAAGGAGTTTGGCGACAAGTACAAGAAGAAGCGATATGTCATGCTGCCTGGCCTGCTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail