Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7479
Gene name
LocationContig_8:217829..218516
Strand+
Gene length (bp)687
Transcript length (bp)687
Coding sequence length (bp)687
Protein length (aa) 229

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10615 DUF2470 Domain of unknown function (DUF2470) 6.3E-20 15 88

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 112 134 22
2 154 176 22
3 188 210 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2041
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2089
Ophiocordyceps australis map64 (Brazil) OphauB2|7479 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04958
Ophiocordyceps camponoti-rufipedis Ophun1|5591
Ophiocordyceps kimflemingae Ophio5|6110
Ophiocordyceps subramaniannii Hirsu2|233

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7479
MMPCSAQDDDSLRRARIITHMNQSHSRELSHYLQHYARVSPRAASGPLLRDLCLDHMLIRTRAGTDHSIPFSPPL
SSWADAKNRIIQMDTVARAGLGISDIYISHFEKPRGIGLAFFIAVGLFFVASFSLPWIVPTTRAWSVLDAYFPGG
PAVFCQLVGLLVVPVIAIHITECFFFDRKLRRHGIERWSGLWCLWISSCFMEGVGAFWRLDSIIASKKAQQEAKN
SAS*
Coding >OphauB2|7479
ATGATGCCTTGTTCGGCCCAAGACGACGACAGCCTTCGCCGCGCCCGCATCATCACCCACATGAACCAGTCGCAC
TCGCGCGAGCTCTCTCATTATCTGCAACACTATGCCCGCGTCTCCCCGCGCGCCGCTTCCGGCCCCCTGTTGCGC
GACTTGTGCCTCGACCACATGCTCATCCGCACCCGTGCCGGCACTGACCACTCCATTCCCTTCTCTCCACCTCTG
AGCTCGTGGGCCGACGCAAAAAACCGCATTATTCAAATGGATACCGTTGCTCGCGCCGGCCTGGGTATCAGCGAC
ATCTATATCTCTCATTTCGAGAAACCCCGTGGCATCGGCCTCGCATTCTTCATAGCCGTCGGCCTTTTTTTTGTC
GCCTCGTTTAGCTTGCCTTGGATCGTGCCCACCACACGCGCCTGGTCTGTTCTTGACGCCTACTTTCCCGGTGGA
CCCGCCGTCTTCTGCCAGCTTGTTGGTCTACTTGTTGTTCCCGTCATTGCCATCCACATCACCGAGTGTTTCTTT
TTTGACCGCAAGCTTCGCAGACATGGAATTGAGCGCTGGTCTGGCCTTTGGTGCCTCTGGATTTCGAGCTGCTTT
ATGGAAGGCGTGGGCGCTTTTTGGCGACTAGACAGCATTATTGCAAGCAAAAAGGCGCAGCAAGAGGCAAAAAAT
TCCGCCTCATAG
Transcript >OphauB2|7479
ATGATGCCTTGTTCGGCCCAAGACGACGACAGCCTTCGCCGCGCCCGCATCATCACCCACATGAACCAGTCGCAC
TCGCGCGAGCTCTCTCATTATCTGCAACACTATGCCCGCGTCTCCCCGCGCGCCGCTTCCGGCCCCCTGTTGCGC
GACTTGTGCCTCGACCACATGCTCATCCGCACCCGTGCCGGCACTGACCACTCCATTCCCTTCTCTCCACCTCTG
AGCTCGTGGGCCGACGCAAAAAACCGCATTATTCAAATGGATACCGTTGCTCGCGCCGGCCTGGGTATCAGCGAC
ATCTATATCTCTCATTTCGAGAAACCCCGTGGCATCGGCCTCGCATTCTTCATAGCCGTCGGCCTTTTTTTTGTC
GCCTCGTTTAGCTTGCCTTGGATCGTGCCCACCACACGCGCCTGGTCTGTTCTTGACGCCTACTTTCCCGGTGGA
CCCGCCGTCTTCTGCCAGCTTGTTGGTCTACTTGTTGTTCCCGTCATTGCCATCCACATCACCGAGTGTTTCTTT
TTTGACCGCAAGCTTCGCAGACATGGAATTGAGCGCTGGTCTGGCCTTTGGTGCCTCTGGATTTCGAGCTGCTTT
ATGGAAGGCGTGGGCGCTTTTTGGCGACTAGACAGCATTATTGCAAGCAAAAAGGCGCAGCAAGAGGCAAAAAAT
TCCGCCTCATAG
Gene >OphauB2|7479
ATGATGCCTTGTTCGGCCCAAGACGACGACAGCCTTCGCCGCGCCCGCATCATCACCCACATGAACCAGTCGCAC
TCGCGCGAGCTCTCTCATTATCTGCAACACTATGCCCGCGTCTCCCCGCGCGCCGCTTCCGGCCCCCTGTTGCGC
GACTTGTGCCTCGACCACATGCTCATCCGCACCCGTGCCGGCACTGACCACTCCATTCCCTTCTCTCCACCTCTG
AGCTCGTGGGCCGACGCAAAAAACCGCATTATTCAAATGGATACCGTTGCTCGCGCCGGCCTGGGTATCAGCGAC
ATCTATATCTCTCATTTCGAGAAACCCCGTGGCATCGGCCTCGCATTCTTCATAGCCGTCGGCCTTTTTTTTGTC
GCCTCGTTTAGCTTGCCTTGGATCGTGCCCACCACACGCGCCTGGTCTGTTCTTGACGCCTACTTTCCCGGTGGA
CCCGCCGTCTTCTGCCAGCTTGTTGGTCTACTTGTTGTTCCCGTCATTGCCATCCACATCACCGAGTGTTTCTTT
TTTGACCGCAAGCTTCGCAGACATGGAATTGAGCGCTGGTCTGGCCTTTGGTGCCTCTGGATTTCGAGCTGCTTT
ATGGAAGGCGTGGGCGCTTTTTGGCGACTAGACAGCATTATTGCAAGCAAAAAGGCGCAGCAAGAGGCAAAAAAT
TCCGCCTCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail