Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|747
Gene name
LocationContig_115:29196..30645
Strand-
Gene length (bp)1449
Transcript length (bp)1383
Coding sequence length (bp)1383
Protein length (aa) 461

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03388 Lectin_leg-like Legume-like lectin family 7.0E-23 44 252

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P43555|EMP47_YEAST Protein EMP47 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP47 PE=1 SV=1 6 325 7.0E-17
sp|Q2HJD1|LMA2L_BOVIN VIP36-like protein OS=Bos taurus GN=LMAN2L PE=2 SV=1 59 251 1.0E-10
sp|Q5RCF0|LMA2L_PONAB VIP36-like protein OS=Pongo abelii GN=LMAN2L PE=3 SV=1 59 251 4.0E-10
sp|Q9H0V9|LMA2L_HUMAN VIP36-like protein OS=Homo sapiens GN=LMAN2L PE=1 SV=1 59 251 4.0E-10
sp|P59481|LMA2L_MOUSE VIP36-like protein OS=Mus musculus GN=Lman2l PE=1 SV=1 59 251 5.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P43555|EMP47_YEAST Protein EMP47 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP47 PE=1 SV=1 6 325 7.0E-17
sp|Q2HJD1|LMA2L_BOVIN VIP36-like protein OS=Bos taurus GN=LMAN2L PE=2 SV=1 59 251 1.0E-10
sp|Q5RCF0|LMA2L_PONAB VIP36-like protein OS=Pongo abelii GN=LMAN2L PE=3 SV=1 59 251 4.0E-10
sp|Q9H0V9|LMA2L_HUMAN VIP36-like protein OS=Homo sapiens GN=LMAN2L PE=1 SV=1 59 251 4.0E-10
sp|P59481|LMA2L_MOUSE VIP36-like protein OS=Mus musculus GN=Lman2l PE=1 SV=1 59 251 5.0E-10
sp|Q5FB95|LMA1L_RAT Protein ERGIC-53-like OS=Rattus norvegicus GN=Lman1l PE=1 SV=1 45 249 3.0E-08
sp|Q8VCD3|LMA1L_MOUSE Protein ERGIC-53-like OS=Mus musculus GN=Lman1l PE=2 SV=2 73 237 3.0E-08
sp|Q9DBH5|LMAN2_MOUSE Vesicular integral-membrane protein VIP36 OS=Mus musculus GN=Lman2 PE=1 SV=2 59 251 3.0E-06
sp|Q12907|LMAN2_HUMAN Vesicular integral-membrane protein VIP36 OS=Homo sapiens GN=LMAN2 PE=1 SV=1 59 251 6.0E-06
sp|P49256|LMAN2_CANLF Vesicular integral-membrane protein VIP36 OS=Canis lupus familiaris GN=LMAN2 PE=1 SV=1 59 251 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 426 448 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|747
MRPWRVPAALAALLVAHDCHATPVMNEISFGHAGRLSPVESPGKIPHFSIYGHPQLPEVLSNKIILTPIAPGNQH
SAIWADVPLERTSWTTDVEFRTNGPERTGHEGGGSLALWLVRDGAPAVATNSIYTVGRFEGLALVIDAHGPSGGM
IRGFLNDGTQHYAALSQQQAQQQPGEGVDKLAFGHCPHAYRNLGRPSHLRLRQTHNSFRVDIDGQLCFETDKVSL
PAGYHFGMTAATPDSPDSFEVFELSVTSDSMVSGNTGGKIEYATLHDQPKQHQDQQGQTQHAPPKPAGMADESAD
KFTTSQTQFTDLHNRLQSATHQIQAIYDTVKQLEQSGAQRSTELRQAEEQRFADLRKTFDSLSNRILAVIEGETD
RLERVKRLEAEVRGMRSDINNKLSSHHDSLQSYLGHHHASLAEAVTSSMPSHGLLIAVVAGSQLILVVAYIVYKR
RRANSPKKFL*
Coding >OphauB2|747
ATGCGGCCGTGGAGAGTGCCTGCAGCATTGGCGGCTCTGCTCGTCGCCCATGACTGTCATGCAACTCCCGTGATG
AACGAGATTAGCTTTGGCCATGCCGGACGCCTCAGTCCCGTGGAATCGCCTGGCAAGATCCCCCACTTCTCCATC
TATGGCCATCCGCAGCTGCCAGAGGTGCTGTCCAACAAGATTATATTGACGCCCATTGCGCCCGGCAACCAACAC
TCGGCCATTTGGGCCGATGTGCCTCTTGAAAGAACATCGTGGACGACAGATGTCGAGTTTCGCACCAATGGCCCC
GAGCGCACTGGTCATGAAGGCGGCGGCAGCCTTGCGCTTTGGCTGGTTCGTGACGGCGCGCCCGCCGTGGCCACC
AATTCCATCTACACGGTTGGGCGCTTCGAGGGCCTTGCTCTCGTGATTGACGCCCATGGTCCCTCGGGTGGCATG
ATTCGCGGCTTCCTCAACGACGGCACCCAGCACTACGCTGCTCTCTCCCAGCAGCAAGCGCAGCAGCAGCCTGGC
GAGGGCGTCGACAAGCTTGCCTTTGGCCACTGCCCCCATGCCTACCGCAACCTCGGACGGCCGTCGCATCTCCGG
CTGCGGCAGACTCACAACTCGTTTCGCGTCGATATTGATGGCCAGCTCTGCTTCGAGACGGACAAGGTTAGCCTG
CCAGCCGGCTACCACTTTGGCATGACGGCCGCCACACCAGACAGCCCCGACTCGTTTGAAGTGTTTGAGCTATCC
GTCACGTCGGACTCGATGGTGTCTGGCAATACCGGCGGCAAGATTGAATACGCGACGCTGCACGACCAGCCCAAG
CAGCACCAAGACCAACAAGGGCAGACACAGCACGCACCTCCCAAGCCGGCGGGCATGGCTGACGAGTCTGCCGAC
AAGTTTACCACGTCTCAGACGCAGTTTACCGACCTGCACAACCGCCTACAGTCGGCAACGCACCAGATTCAAGCC
ATTTACGACACGGTCAAGCAGCTCGAGCAGTCTGGCGCCCAGCGCAGCACCGAGCTCCGCCAGGCCGAGGAGCAG
CGCTTTGCCGACTTGCGCAAGACGTTTGACTCGCTCAGCAATCGCATCCTGGCGGTTATCGAGGGCGAAACGGAC
CGCCTGGAGCGCGTCAAGAGACTCGAGGCCGAGGTGCGCGGCATGCGCAGCGACATCAACAATAAGCTCTCGTCG
CACCACGACTCGCTGCAGAGCTACCTCGGCCACCATCACGCGTCTCTTGCAGAGGCAGTGACGAGCAGCATGCCC
AGCCACGGGCTGCTCATTGCTGTGGTGGCTGGCTCGCAGCTTATTCTCGTTGTGGCATACATTGTATATAAGCGC
CGGCGGGCGAATAGTCCCAAAAAGTTTTTGTAG
Transcript >OphauB2|747
ATGCGGCCGTGGAGAGTGCCTGCAGCATTGGCGGCTCTGCTCGTCGCCCATGACTGTCATGCAACTCCCGTGATG
AACGAGATTAGCTTTGGCCATGCCGGACGCCTCAGTCCCGTGGAATCGCCTGGCAAGATCCCCCACTTCTCCATC
TATGGCCATCCGCAGCTGCCAGAGGTGCTGTCCAACAAGATTATATTGACGCCCATTGCGCCCGGCAACCAACAC
TCGGCCATTTGGGCCGATGTGCCTCTTGAAAGAACATCGTGGACGACAGATGTCGAGTTTCGCACCAATGGCCCC
GAGCGCACTGGTCATGAAGGCGGCGGCAGCCTTGCGCTTTGGCTGGTTCGTGACGGCGCGCCCGCCGTGGCCACC
AATTCCATCTACACGGTTGGGCGCTTCGAGGGCCTTGCTCTCGTGATTGACGCCCATGGTCCCTCGGGTGGCATG
ATTCGCGGCTTCCTCAACGACGGCACCCAGCACTACGCTGCTCTCTCCCAGCAGCAAGCGCAGCAGCAGCCTGGC
GAGGGCGTCGACAAGCTTGCCTTTGGCCACTGCCCCCATGCCTACCGCAACCTCGGACGGCCGTCGCATCTCCGG
CTGCGGCAGACTCACAACTCGTTTCGCGTCGATATTGATGGCCAGCTCTGCTTCGAGACGGACAAGGTTAGCCTG
CCAGCCGGCTACCACTTTGGCATGACGGCCGCCACACCAGACAGCCCCGACTCGTTTGAAGTGTTTGAGCTATCC
GTCACGTCGGACTCGATGGTGTCTGGCAATACCGGCGGCAAGATTGAATACGCGACGCTGCACGACCAGCCCAAG
CAGCACCAAGACCAACAAGGGCAGACACAGCACGCACCTCCCAAGCCGGCGGGCATGGCTGACGAGTCTGCCGAC
AAGTTTACCACGTCTCAGACGCAGTTTACCGACCTGCACAACCGCCTACAGTCGGCAACGCACCAGATTCAAGCC
ATTTACGACACGGTCAAGCAGCTCGAGCAGTCTGGCGCCCAGCGCAGCACCGAGCTCCGCCAGGCCGAGGAGCAG
CGCTTTGCCGACTTGCGCAAGACGTTTGACTCGCTCAGCAATCGCATCCTGGCGGTTATCGAGGGCGAAACGGAC
CGCCTGGAGCGCGTCAAGAGACTCGAGGCCGAGGTGCGCGGCATGCGCAGCGACATCAACAATAAGCTCTCGTCG
CACCACGACTCGCTGCAGAGCTACCTCGGCCACCATCACGCGTCTCTTGCAGAGGCAGTGACGAGCAGCATGCCC
AGCCACGGGCTGCTCATTGCTGTGGTGGCTGGCTCGCAGCTTATTCTCGTTGTGGCATACATTGTATATAAGCGC
CGGCGGGCGAATAGTCCCAAAAAGTTTTTGTAG
Gene >OphauB2|747
ATGCGGCCGTGGAGAGTGCCTGCAGCATTGGCGGCTCTGCTCGTCGCCCATGACTGTCATGCAACTCCCGTGATG
AACGAGATTAGCTTTGGCCATGCCGGACGGTACAGCATGCTCCAGCTTTGCTTCGTCGGCACAGACAGCTAACGA
GGTTTGATGTGCTTGTGCAGCCTCAGTCCCGTGGAATCGCCTGGCAAGATCCCCCACTTCTCCATCTATGGCCAT
CCGCAGCTGCCAGAGGTGCTGTCCAACAAGATTATATTGACGCCCATTGCGCCCGGCAACCAACACTCGGCCATT
TGGGCCGATGTGCCTCTTGAAAGAACATCGTGGACGACAGATGTCGAGTTTCGCACCAATGGCCCCGAGCGCACT
GGTCATGAAGGCGGCGGCAGCCTTGCGCTTTGGCTGGTTCGTGACGGCGCGCCCGCCGTGGCCACCAATTCCATC
TACACGGTTGGGCGCTTCGAGGGCCTTGCTCTCGTGATTGACGCCCATGGTCCCTCGGGTGGCATGATTCGCGGC
TTCCTCAACGACGGCACCCAGCACTACGCTGCTCTCTCCCAGCAGCAAGCGCAGCAGCAGCCTGGCGAGGGCGTC
GACAAGCTTGCCTTTGGCCACTGCCCCCATGCCTACCGCAACCTCGGACGGCCGTCGCATCTCCGGCTGCGGCAG
ACTCACAACTCGTTTCGCGTCGATATTGATGGCCAGCTCTGCTTCGAGACGGACAAGGTTAGCCTGCCAGCCGGC
TACCACTTTGGCATGACGGCCGCCACACCAGACAGCCCCGACTCGTTTGAAGTGTTTGAGCTATCCGTCACGTCG
GACTCGATGGTGTCTGGCAATACCGGCGGCAAGATTGAATACGCGACGCTGCACGACCAGCCCAAGCAGCACCAA
GACCAACAAGGGCAGACACAGCACGCACCTCCCAAGCCGGCGGGCATGGCTGACGAGTCTGCCGACAAGTTTACC
ACGTCTCAGACGCAGTTTACCGACCTGCACAACCGCCTACAGTCGGCAACGCACCAGATTCAAGCCATTTACGAC
ACGGTCAAGCAGCTCGAGCAGTCTGGCGCCCAGCGCAGCACCGAGCTCCGCCAGGCCGAGGAGCAGCGCTTTGCC
GACTTGCGCAAGACGTTTGACTCGCTCAGCAATCGCATCCTGGCGGTTATCGAGGGCGAAACGGACCGCCTGGAG
CGCGTCAAGAGACTCGAGGCCGAGGTGCGCGGCATGCGCAGCGACATCAACAATAAGCTCTCGTCGCACCACGAC
TCGCTGCAGAGCTACCTCGGCCACCATCACGCGTCTCTTGCAGAGGCAGTGACGAGCAGCATGCCCAGCCACGGG
CTGCTCATTGCTGTGGTGGCTGGCTCGCAGCTTATTCTCGTTGTGGCATACATTGTATATAAGCGCCGGCGGGCG
AATAGTCCCAAAAAGTTTTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail