Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7464
Gene name
LocationContig_8:187014..188526
Strand-
Gene length (bp)1512
Transcript length (bp)1401
Coding sequence length (bp)1401
Protein length (aa) 467

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 8.7E-10 165 371

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 158 380 1.0E-09
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 53 375 1.0E-08
sp|Q40412|ABA2_NICPL Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1 143 412 1.0E-08
sp|O81360|ABA2_PRUAR Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1 156 399 3.0E-08

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4536
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4000
Ophiocordyceps australis map64 (Brazil) OphauB2|7464 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06248
Ophiocordyceps camponoti-rufipedis Ophun1|5935
Ophiocordyceps kimflemingae Ophio5|3266
Ophiocordyceps subramaniannii Hirsu2|9479

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7464
MKIAIVGAGISGCATYLLLKKHLPRPLCDESHCITIYEAHDTAAAQEDRGPDESTPSVGGGLGVGANGLGVLKRL
EEKLLCDVVASGYVVPSTVIKTKNATVLIRAQHQGNGKDARMHMVASSRHNVWSCLRSRIPESDIVFKHVTRVVA
DPIRRNIISFADGSPSVEADLVIGADGVKSPTRHALFPDGDHDDLSPHYEGLIGVGGFVPSVHVQKHVERGSMNF
VFGGNGFFGYFFADSATWAPQRASPFDVSEPGDRLAWWSTFAAHEYHGPDMLDKQAMARQLRHRLRHWKDPVVQE
VLASLHVVNIYPTWTLPPLPTWERHGVVLVGDAAHALPPTSGQGTSQALEDAEALTLLVCYYLREAYRERITDVQ
GQKQAIRMAAKSYEKLRLPRVTKILRDAQSMQRTKRSKGFIAEKLMYLVLWIIGWFPSLMMKRMSTVVDYNVAQE
VKKLVEREEEKKKKED*
Coding >OphauB2|7464
ATGAAGATTGCTATTGTTGGCGCGGGCATCTCGGGCTGTGCCACGTACCTGCTGCTCAAAAAGCATCTGCCCCGG
CCTCTCTGTGACGAGAGTCATTGCATCACCATCTACGAGGCGCACGACACGGCCGCGGCGCAAGAGGACAGGGGC
CCAGACGAGTCGACGCCTAGTGTAGGCGGTGGTCTCGGCGTCGGTGCAAATGGCCTTGGTGTGCTCAAGCGCCTG
GAGGAGAAGCTGCTCTGCGATGTTGTTGCTAGTGGATATGTGGTGCCAAGCACGGTAATCAAGACCAAGAACGCG
ACAGTCTTGATTCGCGCCCAACACCAGGGCAATGGCAAGGACGCTCGGATGCACATGGTTGCCAGCAGCCGCCAC
AATGTCTGGAGCTGTCTTCGCTCCCGCATTCCTGAAAGCGACATTGTTTTCAAACACGTCACTCGAGTCGTGGCC
GACCCCATCCGCCGCAACATCATCAGCTTTGCCGACGGCAGTCCCTCGGTTGAGGCAGACCTGGTTATAGGGGCT
GATGGCGTCAAAAGCCCGACTCGACACGCCCTCTTTCCCGACGGTGACCACGACGACTTGTCGCCTCACTACGAG
GGTCTGATTGGAGTCGGCGGGTTTGTTCCGTCTGTCCATGTGCAAAAGCACGTTGAAAGGGGCTCCATGAATTTC
GTCTTTGGCGGCAACGGCTTCTTTGGCTACTTCTTTGCCGATAGCGCGACATGGGCACCCCAACGCGCATCGCCC
TTTGATGTGTCGGAGCCGGGAGATCGATTGGCCTGGTGGTCGACTTTTGCCGCCCATGAGTATCACGGCCCAGAC
ATGCTAGACAAGCAAGCCATGGCGCGCCAGCTCCGGCACCGCTTGCGCCACTGGAAAGACCCCGTGGTCCAAGAG
GTGCTGGCCTCGTTGCATGTGGTTAACATATATCCTACCTGGACTCTTCCCCCGCTGCCGACCTGGGAGCGTCAT
GGAGTCGTCCTGGTTGGCGACGCGGCTCACGCATTGCCGCCCACATCAGGTCAAGGAACCTCGCAAGCCCTCGAA
GATGCTGAGGCTCTAACTCTGCTTGTCTGCTACTACCTACGCGAGGCATACCGCGAGCGAATTACAGACGTCCAA
GGACAGAAGCAAGCAATCAGAATGGCGGCCAAGAGCTACGAAAAACTGCGTCTACCTCGAGTGACCAAGATACTA
CGAGATGCCCAGAGCATGCAGAGGACCAAGCGCAGCAAGGGCTTCATCGCCGAGAAGCTCATGTACTTGGTGCTG
TGGATCATTGGGTGGTTTCCAAGCCTCATGATGAAACGAATGAGCACCGTTGTTGACTACAATGTAGCCCAAGAG
GTCAAGAAACTCGTTGAAAGGGAAGAGGAAAAGAAGAAGAAGGAGGATTGA
Transcript >OphauB2|7464
ATGAAGATTGCTATTGTTGGCGCGGGCATCTCGGGCTGTGCCACGTACCTGCTGCTCAAAAAGCATCTGCCCCGG
CCTCTCTGTGACGAGAGTCATTGCATCACCATCTACGAGGCGCACGACACGGCCGCGGCGCAAGAGGACAGGGGC
CCAGACGAGTCGACGCCTAGTGTAGGCGGTGGTCTCGGCGTCGGTGCAAATGGCCTTGGTGTGCTCAAGCGCCTG
GAGGAGAAGCTGCTCTGCGATGTTGTTGCTAGTGGATATGTGGTGCCAAGCACGGTAATCAAGACCAAGAACGCG
ACAGTCTTGATTCGCGCCCAACACCAGGGCAATGGCAAGGACGCTCGGATGCACATGGTTGCCAGCAGCCGCCAC
AATGTCTGGAGCTGTCTTCGCTCCCGCATTCCTGAAAGCGACATTGTTTTCAAACACGTCACTCGAGTCGTGGCC
GACCCCATCCGCCGCAACATCATCAGCTTTGCCGACGGCAGTCCCTCGGTTGAGGCAGACCTGGTTATAGGGGCT
GATGGCGTCAAAAGCCCGACTCGACACGCCCTCTTTCCCGACGGTGACCACGACGACTTGTCGCCTCACTACGAG
GGTCTGATTGGAGTCGGCGGGTTTGTTCCGTCTGTCCATGTGCAAAAGCACGTTGAAAGGGGCTCCATGAATTTC
GTCTTTGGCGGCAACGGCTTCTTTGGCTACTTCTTTGCCGATAGCGCGACATGGGCACCCCAACGCGCATCGCCC
TTTGATGTGTCGGAGCCGGGAGATCGATTGGCCTGGTGGTCGACTTTTGCCGCCCATGAGTATCACGGCCCAGAC
ATGCTAGACAAGCAAGCCATGGCGCGCCAGCTCCGGCACCGCTTGCGCCACTGGAAAGACCCCGTGGTCCAAGAG
GTGCTGGCCTCGTTGCATGTGGTTAACATATATCCTACCTGGACTCTTCCCCCGCTGCCGACCTGGGAGCGTCAT
GGAGTCGTCCTGGTTGGCGACGCGGCTCACGCATTGCCGCCCACATCAGGTCAAGGAACCTCGCAAGCCCTCGAA
GATGCTGAGGCTCTAACTCTGCTTGTCTGCTACTACCTACGCGAGGCATACCGCGAGCGAATTACAGACGTCCAA
GGACAGAAGCAAGCAATCAGAATGGCGGCCAAGAGCTACGAAAAACTGCGTCTACCTCGAGTGACCAAGATACTA
CGAGATGCCCAGAGCATGCAGAGGACCAAGCGCAGCAAGGGCTTCATCGCCGAGAAGCTCATGTACTTGGTGCTG
TGGATCATTGGGTGGTTTCCAAGCCTCATGATGAAACGAATGAGCACCGTTGTTGACTACAATGTAGCCCAAGAG
GTCAAGAAACTCGTTGAAAGGGAAGAGGAAAAGAAGAAGAAGGAGGATTGA
Gene >OphauB2|7464
ATGAAGATTGCTATTGTTGGCGCGGGCATCTCGGGCTGTGCCACGTACCTGCTGCTCAAAAAGCATCTGCCCCGG
CCTCTCTGTGACGAGAGTCATTGCATCACCATCTACGAGGCGCACGACACGGCCGCGGCGCAAGAGGACAGGGGC
CCAGACGAGTCGACGCCTAGTGTAGGCGGTGGTCTCGGCGTCGGTGCAAATGGCCTTGGTGTGCTCAAGCGCCTG
GAGGAGAAGCTGCTCTGCGATGTTGTTGCTAGTGGATATGTGGTGCCAAGCACGGTAATCAAGACCAAGAACGCG
ACAGTCTTGATTCGCGCCCAACACCAGGGCAATGGCAAGGACGCTCGGATGCACATGGTTGCCAGCAGCCGCCAC
AATGTCTGGAGCTGTCTTCGCTCCCGCATTCCTGAAAGCGACATTGTTTTCAAACACGTCACTCGAGTCGTGGCC
GACCCCATCCGCCGCAACATCATCAGCTTTGCCGACGGCAGTCCCTCGGTTGAGGCAGACCTGGTTATAGGGGCT
GATGGCGTCAAAAGCCCGACTCGACACGCCCTCTTTCCCGACGGTGACCACGACGACTTGTCGCCTCACTACGAG
TAAGTGGCTTGCCCCCCTCGTCATGGCACCAACGGCTGCTGACGGGCAACAGGGGTCTGATTGGAGTCGGCGGGT
TTGTTCCGTCTGTCCATGTGCAAAAGCACGTTGAAAGGGGCTCCATGAATTTCGTCTTTGGCGGCAACGGCTTCT
TTGGCTACTTCTTTGCCGATAGCGCGACATGGGCACCCCAACGCGCATCGCCCTTTGATGTGTCGGAGCCGGGAG
ATCGATTGGCCTGGTGGTCGACTTTTGCCGCCCATGAGTATCACGGCCCAGACATGCTAGACAAGCAAGCCATGG
CGCGCCAGCTCCGGCACCGCTTGCGCCACTGGAAAGACCCCGTGGTCCAAGAGGTGCTGGCCTCGTTGCATGTGG
TTAACATATATCCTACCTGGACTCTTCCCCCGCTGCCGACCTGGGAGCGTCATGGAGTCGTCCTGGTTGGCGACG
CGGCTCACGCATTGCCGCCCACATCAGGTCAAGGAACCTCGCAAGCCCTCGAAGATGCTGAGGCTCTAACTCTGC
TTGTCTGCTACTACCTACGCGAGGCATACCGCGAGCGAATTACAGACGTCCAAGGACAGAAGCAAGCAATCAGAA
TGGCGGCCAAGAGCTACGAAAAACTGCGTCTACCTCGAGTGACCAAGATACTACGAGATGCCCAGAGCATGCAGA
GGACCAAGCGCAGCAAGGGCTTCATCGCCGAGAAGCTCATGTACTTGGTGCTGTGGATCATTGGTAAGTTGATCA
TGTTTTGGTGATTTCCAAAGCGAAGCAGACTGATTGCCTTGCACAGGGTGGTTTCCAAGCCTCATGATGAAACGA
ATGAGCACCGTTGTTGACTACAATGTAGCCCAAGAGGTCAAGAAACTCGTTGAAAGGGAAGAGGAAAAGAAGAAG
AAGGAGGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail