Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7462
Gene name
LocationContig_8:183931..184741
Strand-
Gene length (bp)810
Transcript length (bp)570
Coding sequence length (bp)570
Protein length (aa) 190

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04000 Sas10_Utp3 Sas10/Utp3/C1D family 1.3E-12 12 88

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74469|YQC7_SCHPO Exosome complex protein C1739.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1739.07 PE=1 SV=1 13 104 8.0E-11
sp|Q5XJ97|C1D_DANRE Nuclear nucleic acid-binding protein C1D OS=Danio rerio GN=c1d PE=2 SV=1 6 113 2.0E-09
sp|O35473|C1D_MOUSE Nuclear nucleic acid-binding protein C1D OS=Mus musculus GN=C1d PE=1 SV=1 6 129 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7462
MADVKDITRNINKLDAQLDSLEDAIEPLLGDVGAMASQLPLLDKAKLFSLTAYALESLLFSSLRLQGVHAQNHAV
YTELKRVQQYFAKIQALEQPETQRTTTVNKEGAARVLKADLSDNKALSSKLAEKIAVERAKALLKSVESKKRPAN
SEVHVPTPAAGPGTGEQLGGVKRPKHKHKHDKKKSAARR*
Coding >OphauB2|7462
ATGGCTGACGTCAAGGACATCACCCGCAACATCAACAAGTTGGATGCGCAGCTCGATAGCCTGGAAGATGCAATC
GAGCCTTTGCTGGGCGATGTCGGCGCCATGGCCTCGCAGTTGCCACTACTGGACAAGGCTAAACTATTTTCCCTG
ACTGCGTATGCGCTCGAGTCGCTCCTTTTCTCATCTCTCCGTCTACAAGGTGTCCATGCCCAAAATCATGCCGTA
TACACAGAGCTCAAGCGCGTGCAACAATACTTTGCAAAGATTCAGGCCCTGGAGCAACCTGAGACGCAACGAACG
ACAACGGTCAATAAGGAGGGCGCCGCACGAGTCTTGAAAGCCGACTTGTCAGATAACAAGGCTCTCAGTAGCAAG
CTGGCGGAAAAGATTGCTGTGGAGCGAGCAAAAGCGTTGCTCAAGTCGGTAGAAAGCAAGAAGAGGCCCGCCAAC
TCTGAAGTACATGTACCTACGCCAGCTGCTGGCCCAGGCACTGGTGAGCAGCTTGGAGGTGTCAAGAGGCCCAAG
CATAAGCACAAGCACGACAAGAAAAAGAGTGCTGCAAGGCGATAG
Transcript >OphauB2|7462
ATGGCTGACGTCAAGGACATCACCCGCAACATCAACAAGTTGGATGCGCAGCTCGATAGCCTGGAAGATGCAATC
GAGCCTTTGCTGGGCGATGTCGGCGCCATGGCCTCGCAGTTGCCACTACTGGACAAGGCTAAACTATTTTCCCTG
ACTGCGTATGCGCTCGAGTCGCTCCTTTTCTCATCTCTCCGTCTACAAGGTGTCCATGCCCAAAATCATGCCGTA
TACACAGAGCTCAAGCGCGTGCAACAATACTTTGCAAAGATTCAGGCCCTGGAGCAACCTGAGACGCAACGAACG
ACAACGGTCAATAAGGAGGGCGCCGCACGAGTCTTGAAAGCCGACTTGTCAGATAACAAGGCTCTCAGTAGCAAG
CTGGCGGAAAAGATTGCTGTGGAGCGAGCAAAAGCGTTGCTCAAGTCGGTAGAAAGCAAGAAGAGGCCCGCCAAC
TCTGAAGTACATGTACCTACGCCAGCTGCTGGCCCAGGCACTGGTGAGCAGCTTGGAGGTGTCAAGAGGCCCAAG
CATAAGCACAAGCACGACAAGAAAAAGAGTGCTGCAAGGCGATAG
Gene >OphauB2|7462
ATGGCTGACGTCAAGGACATCACCCGCAACATCAACAAGTTGGATGCGCAGCTCGATAGCCTGGAAGATGCAATC
GAGCCTTTGCTGGGCGATGTCGGCGCCATGGCCTCGCAGTTGCCACTACTGGACAAGGCTAAACTATTTTCCCTG
ACTGCGTATGCGCTCGAGTCGCTCCTTTTCTGTGAGCCTCGCCGTCAGCTACATTCAACACGTGGAAACGAGCAC
TTGCTTTCCACCAGAAGAGTCAAATTTTGAGACAGCCAATGGCTTGCTGACCTACTTGTCCTTTGCACAGCATCT
CTCCGTCTACAAGGTGTCCATGCCCAAAATCATGCCGTATACACAGAGCTCAAGCGCGTGCAACAATACTTTGCA
AAGATTCAGGCCCTGGAGCAACCTGAGACGCAACGAACGACAACGGTCAATAAGGAGGGCGCCGCACGAGTCTTG
AAAGCCGACTTGGTAATCTCAGTTCCTTTCTTCTCTTTGCTGTCCCATTGGCGATACGAGTTTCACTTGTCAAGC
CCTGTTCTGTTTGCGTCTGTACGACCCATCCCGCGGCCTTACTAATACGTTCTCATGGCGCAGTCAGATAACAAG
GCTCTCAGTAGCAAGCTGGCGGAAAAGATTGCTGTGGAGCGAGCAAAAGCGTTGCTCAAGTCGGTAGAAAGCAAG
AAGAGGCCCGCCAACTCTGAAGTACATGTACCTACGCCAGCTGCTGGCCCAGGCACTGGTGAGCAGCTTGGAGGT
GTCAAGAGGCCCAAGCATAAGCACAAGCACGACAAGAAAAAGAGTGCTGCAAGGCGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail