Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7460
Gene name
LocationContig_8:181108..182678
Strand+
Gene length (bp)1570
Transcript length (bp)1395
Coding sequence length (bp)1395
Protein length (aa) 465

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00789 UBX UBX domain 1.4E-15 282 361

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38349|UBX7_YEAST UBX domain-containing protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBX7 PE=1 SV=1 216 378 5.0E-15
sp|P34631|UBXN4_CAEEL UBX domain-containing protein 4 OS=Caenorhabditis elegans GN=ubxn-4 PE=3 SV=1 2 454 6.0E-12
sp|Q3ZBU9|UBXN4_BOVIN UBX domain-containing protein 4 OS=Bos taurus GN=UBXN4 PE=2 SV=2 1 451 5.0E-11
sp|Q92575|UBXN4_HUMAN UBX domain-containing protein 4 OS=Homo sapiens GN=UBXN4 PE=1 SV=2 1 451 7.0E-11
sp|Q5R4I3|UBXN4_PONAB UBX domain-containing protein 4 OS=Pongo abelii GN=UBXN4 PE=2 SV=1 1 451 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38349|UBX7_YEAST UBX domain-containing protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBX7 PE=1 SV=1 216 378 5.0E-15
sp|P34631|UBXN4_CAEEL UBX domain-containing protein 4 OS=Caenorhabditis elegans GN=ubxn-4 PE=3 SV=1 2 454 6.0E-12
sp|Q3ZBU9|UBXN4_BOVIN UBX domain-containing protein 4 OS=Bos taurus GN=UBXN4 PE=2 SV=2 1 451 5.0E-11
sp|Q92575|UBXN4_HUMAN UBX domain-containing protein 4 OS=Homo sapiens GN=UBXN4 PE=1 SV=2 1 451 7.0E-11
sp|Q5R4I3|UBXN4_PONAB UBX domain-containing protein 4 OS=Pongo abelii GN=UBXN4 PE=2 SV=1 1 451 2.0E-10
sp|Q922Y1|UBXN1_MOUSE UBX domain-containing protein 1 OS=Mus musculus GN=Ubxn1 PE=1 SV=1 226 361 1.0E-08
sp|Q8VCH8|UBXN4_MOUSE UBX domain-containing protein 4 OS=Mus musculus GN=Ubxn4 PE=1 SV=1 1 451 2.0E-08
sp|Q5HZY0|UBXN4_RAT UBX domain-containing protein 4 OS=Rattus norvegicus GN=Ubxn4 PE=1 SV=1 1 451 2.0E-08
sp|Q499N6|UBXN1_RAT UBX domain-containing protein 1 OS=Rattus norvegicus GN=Ubxn1 PE=3 SV=2 226 361 2.0E-08
sp|Q6NXA9|UBXN1_DANRE UBX domain-containing protein 1 OS=Danio rerio GN=ubxn1 PE=2 SV=1 221 361 2.0E-08
sp|Q32KW2|UBXN1_BOVIN UBX domain-containing protein 1 OS=Bos taurus GN=UBXN1 PE=2 SV=1 229 361 5.0E-08
sp|Q6GL77|UBXN1_XENTR UBX domain-containing protein 1 OS=Xenopus tropicalis GN=ubxn1 PE=2 SV=1 203 361 2.0E-07
sp|Q04323|UBXN1_HUMAN UBX domain-containing protein 1 OS=Homo sapiens GN=UBXN1 PE=1 SV=2 226 361 1.0E-06
sp|Q6IP50|UBX1A_XENLA UBX domain-containing protein 1-A OS=Xenopus laevis GN=ubxn1-a PE=2 SV=1 215 361 2.0E-06
sp|P47049|UBX6_YEAST UBX domain-containing protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBX6 PE=1 SV=1 212 390 2.0E-06
sp|Q6GLV4|UBX1B_XENLA UBX domain-containing protein 1-B OS=Xenopus laevis GN=ubxn1-b PE=2 SV=1 215 361 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 377 399 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7460
MFYQGPLQEGISMAVGQQKMVLCFVTNENEVSQTWENDFLQDSSLRDLISQQAVALRMMVDSEEAKYLAQIFPLP
QTPTIVIMKHGELKEYIAPNETRENFIRRMLTAFDALPPPGPQHEAENGPPATQPTSNPPGPRQPLESENSSPPA
HTSARADPPTDIVRRILAERAARLHAEKEEAERRAKQQSAESQAKAQAEADSGVDTQAARNTIYAQQLRRRRQQE
LDERKRILKRIEDDKEERRQRAAERDRMRIDNQRPGDVAASLVKAPQSKIPSTSRIGDTASIQVRLSDGTAIRSR
FKSVVPFSDVRQWVDQSRTDDHMPYTFRQVLTPLPNQAINDTEENKTLSELGLAPSATLILIPVPNFSSAYEEGP
QTLLTQILGVIISLFTSLMGLFGFRGNQTVQPKRSEAPVGSTDVQSTSSQEKTRGVRGFRNPDDGSRDHQLYNGN
SLNFEPRPEEKDDQ*
Coding >OphauB2|7460
ATGTTCTATCAAGGACCCCTGCAAGAGGGCATCTCCATGGCTGTCGGACAGCAGAAAATGGTGCTCTGCTTTGTA
ACAAACGAAAACGAAGTGAGCCAAACATGGGAGAATGACTTCCTTCAAGATAGCTCTCTGAGAGACTTGATATCA
CAACAAGCTGTTGCCTTGCGCATGATGGTCGACTCCGAAGAAGCCAAGTATCTGGCGCAAATCTTTCCTCTACCT
CAGACGCCCACCATTGTCATCATGAAGCACGGCGAGCTCAAGGAGTACATTGCGCCCAATGAGACAAGAGAAAAT
TTCATTAGGCGAATGCTCACTGCCTTTGATGCCTTGCCTCCACCAGGGCCCCAGCATGAAGCCGAAAATGGCCCC
CCGGCTACCCAGCCAACCTCCAACCCTCCTGGACCAAGGCAGCCATTGGAATCTGAGAATTCATCTCCACCCGCT
CATACCTCAGCTCGAGCCGACCCACCAACAGACATCGTCCGCCGCATCCTCGCTGAGCGCGCCGCGCGCCTTCAC
GCTGAAAAGGAAGAAGCCGAACGACGAGCCAAGCAACAGAGCGCCGAGTCACAGGCAAAAGCACAAGCCGAGGCC
GACTCTGGAGTCGATACGCAAGCTGCGAGAAACACTATTTACGCTCAACAGCTCCGTCGGAGGCGGCAGCAGGAG
CTCGATGAGCGCAAGCGCATCCTCAAGCGCATTGAAGACGACAAGGAAGAAAGACGTCAGCGTGCTGCCGAGCGA
GACCGAATGCGCATTGATAACCAGCGTCCTGGCGACGTTGCTGCGTCGCTCGTCAAGGCTCCACAGTCAAAAATT
CCCTCCACCTCAAGAATCGGCGACACAGCGTCCATTCAGGTTAGGCTATCAGACGGCACCGCAATACGGTCTCGC
TTCAAAAGCGTCGTCCCATTTAGTGACGTACGACAATGGGTCGACCAAAGCAGGACCGATGATCATATGCCATAT
ACTTTTCGGCAGGTCCTGACCCCGCTGCCCAACCAGGCTATCAATGATACCGAGGAAAACAAGACTCTGAGTGAA
CTTGGCCTCGCCCCTTCGGCAACTCTGATATTGATTCCCGTTCCCAACTTTTCGTCAGCATACGAAGAAGGGCCC
CAGACTCTTCTGACGCAAATTTTGGGAGTCATTATTAGCCTTTTCACATCGCTCATGGGGCTTTTTGGTTTCCGT
GGAAACCAGACGGTTCAACCAAAACGTTCCGAAGCTCCAGTTGGCAGTACAGACGTGCAGTCGACTTCAAGTCAG
GAGAAAACCCGAGGTGTCCGTGGATTTAGGAACCCGGATGATGGATCGAGAGACCACCAACTTTATAATGGCAAT
TCACTCAATTTTGAACCACGGCCAGAGGAAAAAGATGACCAATAA
Transcript >OphauB2|7460
ATGTTCTATCAAGGACCCCTGCAAGAGGGCATCTCCATGGCTGTCGGACAGCAGAAAATGGTGCTCTGCTTTGTA
ACAAACGAAAACGAAGTGAGCCAAACATGGGAGAATGACTTCCTTCAAGATAGCTCTCTGAGAGACTTGATATCA
CAACAAGCTGTTGCCTTGCGCATGATGGTCGACTCCGAAGAAGCCAAGTATCTGGCGCAAATCTTTCCTCTACCT
CAGACGCCCACCATTGTCATCATGAAGCACGGCGAGCTCAAGGAGTACATTGCGCCCAATGAGACAAGAGAAAAT
TTCATTAGGCGAATGCTCACTGCCTTTGATGCCTTGCCTCCACCAGGGCCCCAGCATGAAGCCGAAAATGGCCCC
CCGGCTACCCAGCCAACCTCCAACCCTCCTGGACCAAGGCAGCCATTGGAATCTGAGAATTCATCTCCACCCGCT
CATACCTCAGCTCGAGCCGACCCACCAACAGACATCGTCCGCCGCATCCTCGCTGAGCGCGCCGCGCGCCTTCAC
GCTGAAAAGGAAGAAGCCGAACGACGAGCCAAGCAACAGAGCGCCGAGTCACAGGCAAAAGCACAAGCCGAGGCC
GACTCTGGAGTCGATACGCAAGCTGCGAGAAACACTATTTACGCTCAACAGCTCCGTCGGAGGCGGCAGCAGGAG
CTCGATGAGCGCAAGCGCATCCTCAAGCGCATTGAAGACGACAAGGAAGAAAGACGTCAGCGTGCTGCCGAGCGA
GACCGAATGCGCATTGATAACCAGCGTCCTGGCGACGTTGCTGCGTCGCTCGTCAAGGCTCCACAGTCAAAAATT
CCCTCCACCTCAAGAATCGGCGACACAGCGTCCATTCAGGTTAGGCTATCAGACGGCACCGCAATACGGTCTCGC
TTCAAAAGCGTCGTCCCATTTAGTGACGTACGACAATGGGTCGACCAAAGCAGGACCGATGATCATATGCCATAT
ACTTTTCGGCAGGTCCTGACCCCGCTGCCCAACCAGGCTATCAATGATACCGAGGAAAACAAGACTCTGAGTGAA
CTTGGCCTCGCCCCTTCGGCAACTCTGATATTGATTCCCGTTCCCAACTTTTCGTCAGCATACGAAGAAGGGCCC
CAGACTCTTCTGACGCAAATTTTGGGAGTCATTATTAGCCTTTTCACATCGCTCATGGGGCTTTTTGGTTTCCGT
GGAAACCAGACGGTTCAACCAAAACGTTCCGAAGCTCCAGTTGGCAGTACAGACGTGCAGTCGACTTCAAGTCAG
GAGAAAACCCGAGGTGTCCGTGGATTTAGGAACCCGGATGATGGATCGAGAGACCACCAACTTTATAATGGCAAT
TCACTCAATTTTGAACCACGGCCAGAGGAAAAAGATGACCAATAA
Gene >OphauB2|7460
ATGTTCTATCAAGGACCCCTGCAAGAGGGCATCTCCATGGCTGTCGGACAGCAGAAAATGGTGCTCTGCTTTGTA
ACAAGTATGTCACACTGGTCAACTAAGCCGTGTATATCTTTGGCTGATATTGCACATTCAAGACGAAAACGAAGT
GAGCCAAACATGGGAGAATGACTTCCTTCAAGATAGCTCTGTATGCGCCCTCATGCACTTGCTCACTGATGGCTT
TGCACTGACAATGCGCAGCTGAGAGACTTGATATCACAACAAGCTGTTGCCTTGCGCATGATGGTCGACTCCGAA
GAAGCCAAGTATCTGGCGCAAATCTTTCCTCTACCTCAGACGCCCACCATTGTCATCATGAAGCACGGCGAGCTC
AAGGAGTACATTGCGCCCAATGAGACAAGAGAAAATTTCATTAGGCGAATGCTCACTGCCTTTGATGCCTTGCCT
CCACCAGGGCCCCAGCATGAAGCCGAAAATGGCCCCCCGGCTACCCAGCCAACCTCCAACCCTCCTGGACCAAGG
CAGCCATTGGAATCTGAGAATTCATCTCCACCCGCTCATACCTCAGCTCGAGCCGACCCACCAACAGACATCGTC
CGCCGCATCCTCGCTGAGCGCGCCGCGCGCCTTCACGCTGAAAAGGAAGAAGCCGAACGACGAGCCAAGCAACAG
AGCGCCGAGTCACAGGCAAAAGCACAAGCCGAGGCCGACTCTGGAGTCGATACGCAAGCTGCGAGAAACACTATT
TACGCTCAACAGCTCCGTCGGAGGCGGCAGCAGGAGCTCGATGAGCGCAAGCGCATCCTCAAGCGCATTGAAGAC
GACAAGGAAGAAAGACGTCAGCGTGCTGCCGAGCGAGACCGAATGCGCATTGATAACCAGCGTCCTGGCGACGTT
GCTGCGTCGCTCGTCAAGGCTCCACAGTCAAAAATTCCCTCCACCTCAAGAATCGGCGACACAGCGTCCATTCAG
GTTAGGCTATCAGACGGCACCGCAATACGGTCTCGCTTCAAAAGCGTCGTCCCATTTAGTGACGTACGACAATGG
GTCGACCAAAGCAGGACCGATGATCATATGCCATATACTTTTCGGCAGGTCCTGACCCCGCTGCCCAACCAGGCT
ATCAATGATACCGAGGAAAACAAGACTCTGAGTGAACTTGGCCTCGCCCCTTCGGCAACTCTGATATTGATTCCC
GTTCCCAACTTTTCGTCAGCATACGAAGAAGGGCCCCAGACTCTTCTGACGCAAATTTTGGGAGTCATTATTAGC
CTTTTCACATCGCTCATGGGGCTTTTTGGTTTCCGTGGAAACCAGACGGTTCAACCAAAACGTTCCGAAGCTCCA
GTTGGCAGTACAGACGTGCAGTCGACTTCAAGTCAGGAGAAAACCCGAGGTGTCCGTGGATTTAGGAACCCGGAT
GATGGATCGAGAGACCACCAACTTTATAATGGCAATTCAGTGAGTAACGTGATCACAGCTGGCCTGTCAAAAACT
CGGTGCTGTAGACTAACACATACTGCAGCTCAATTTTGAACCACGGCCAGAGGAAAAAGATGACCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail