Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7459
Gene name
LocationContig_8:179494..180612
Strand-
Gene length (bp)1118
Transcript length (bp)936
Coding sequence length (bp)936
Protein length (aa) 312

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02104 SURF1 SURF1 family 1.1E-52 76 284

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y810|SHY1_SCHPO Cytochrome oxidase assembly protein shy1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shy1 PE=3 SV=1 70 296 3.0E-58
sp|P09925|SURF1_MOUSE Surfeit locus protein 1 OS=Mus musculus GN=Surf1 PE=1 SV=3 72 291 2.0E-44
sp|Q15526|SURF1_HUMAN Surfeit locus protein 1 OS=Homo sapiens GN=SURF1 PE=1 SV=1 72 301 3.0E-44
sp|Q9QXU2|SURF1_RAT Surfeit locus protein 1 OS=Rattus norvegicus GN=Surf1 PE=2 SV=1 72 301 1.0E-43
sp|Q800L1|SURF1_CHICK Surfeit locus protein 1 OS=Gallus gallus GN=SURF1 PE=3 SV=1 73 291 6.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y810|SHY1_SCHPO Cytochrome oxidase assembly protein shy1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shy1 PE=3 SV=1 70 296 3.0E-58
sp|P09925|SURF1_MOUSE Surfeit locus protein 1 OS=Mus musculus GN=Surf1 PE=1 SV=3 72 291 2.0E-44
sp|Q15526|SURF1_HUMAN Surfeit locus protein 1 OS=Homo sapiens GN=SURF1 PE=1 SV=1 72 301 3.0E-44
sp|Q9QXU2|SURF1_RAT Surfeit locus protein 1 OS=Rattus norvegicus GN=Surf1 PE=2 SV=1 72 301 1.0E-43
sp|Q800L1|SURF1_CHICK Surfeit locus protein 1 OS=Gallus gallus GN=SURF1 PE=3 SV=1 73 291 6.0E-41
sp|A4IHH4|SURF1_XENTR Surfeit locus protein 1 OS=Xenopus tropicalis GN=surf1 PE=2 SV=1 72 302 5.0E-39
sp|O57593|SURF1_TAKRU Surfeit locus protein 1 (Fragment) OS=Takifugu rubripes GN=surf1 PE=3 SV=1 72 299 2.0E-38
sp|Q9U4F3|SURF1_DROME SURF1-like protein OS=Drosophila melanogaster GN=Surf1 PE=2 SV=1 61 298 2.0E-36
sp|A8Y2C9|SURF1_CAEBR SURF1-like protein OS=Caenorhabditis briggsae GN=sft-1 PE=3 SV=1 22 296 7.0E-35
sp|A9UWF0|SURF1_MONBE SURF1-like protein OS=Monosiga brevicollis GN=18583 PE=3 SV=1 64 296 1.0E-34
sp|Q9N5N8|SURF1_CAEEL SURF1-like protein OS=Caenorhabditis elegans GN=sft-1 PE=3 SV=1 69 296 2.0E-34
sp|P53266|SHY1_YEAST Cytochrome oxidase assembly protein SHY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHY1 PE=1 SV=1 56 237 3.0E-30
sp|Q556J9|SURF1_DICDI SURF1-like protein OS=Dictyostelium discoideum GN=surf1-1 PE=3 SV=2 65 296 2.0E-28
sp|Q9SE51|SURF1_ARATH Surfeit locus protein 1 OS=Arabidopsis thaliana GN=SURF1 PE=2 SV=1 71 298 3.0E-18
sp|Q1RJM4|SURF1_RICBR SURF1-like protein OS=Rickettsia bellii (strain RML369-C) GN=RBE_0359 PE=3 SV=1 72 311 1.0E-17
sp|Q4UN32|SURF1_RICFE SURF1-like protein OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0175 PE=3 SV=1 72 301 6.0E-16
sp|Q92GL0|SURF1_RICCN SURF1-like protein OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1113 PE=3 SV=1 72 296 1.0E-13
sp|Q9ZCJ8|SURF1_RICPR SURF1-like protein OS=Rickettsia prowazekii (strain Madrid E) GN=RP733 PE=3 SV=1 70 293 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 66 88 22
2 275 294 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7459
MNNCTRHMLRCCAFQSGRLSRFGVTPSAPFSTSSRRRADSKQPADDGGFVSVLDASPRLVSSRRRHGPGIMLLVL
IPLTAFALGTWQVQRLGWKTDLIAKLEDRLVRPPLPLPPHVDPAAIHDFDYRRVVAVGCFRHDQEMLIGPRMRDG
KDGYMVITPLERQDASTVLVNRGWISKLHRDQASRPDSLPRGQVVVQGLLREPWKKNMFTPENRPQTSQFFFPDV
NQMAALTGSQPVWIEVTMEPEFMRLMDYEARGIPYGRPAEVNLRNNHAQYIFTWYGLCAATSVMLYMVLKKPVSG
VAKRVQNSASF*
Coding >OphauB2|7459
ATGAACAACTGCACCCGACACATGCTGCGGTGCTGTGCATTTCAAAGTGGCAGGCTCTCGAGATTTGGCGTTACA
CCGTCAGCTCCATTTTCCACCTCATCTAGACGTCGAGCCGATTCCAAGCAGCCTGCAGACGACGGCGGCTTTGTA
TCAGTCCTCGATGCGTCTCCTCGCCTCGTCAGCAGCCGTCGTCGACATGGCCCCGGCATCATGCTCCTTGTCCTG
ATTCCACTCACCGCCTTTGCCCTGGGCACCTGGCAGGTCCAACGCCTCGGCTGGAAGACGGACCTCATCGCCAAG
CTGGAGGATCGCCTTGTCCGCCCGCCCCTCCCCCTCCCGCCGCATGTTGATCCCGCCGCCATTCATGACTTTGAC
TACCGCCGCGTCGTCGCTGTCGGCTGCTTCCGCCACGATCAAGAAATGCTAATTGGCCCCCGCATGCGAGATGGC
AAGGACGGATACATGGTCATCACTCCACTTGAGCGCCAGGATGCCAGCACGGTTCTTGTCAATCGTGGATGGATC
AGCAAGCTTCATAGGGACCAAGCAAGTCGACCCGACTCGCTACCCCGAGGCCAAGTTGTCGTTCAAGGTCTGCTA
CGTGAGCCGTGGAAGAAGAACATGTTTACACCCGAGAATAGGCCCCAGACGAGCCAATTCTTTTTCCCAGATGTC
AATCAAATGGCTGCTCTAACCGGGAGCCAGCCCGTGTGGATTGAAGTTACCATGGAGCCCGAATTTATGAGACTC
ATGGACTATGAGGCTCGTGGTATTCCATATGGACGGCCAGCAGAAGTCAATCTGCGAAACAATCACGCCCAGTAC
ATTTTTACTTGGTACGGCCTCTGTGCTGCCACGTCAGTCATGCTGTACATGGTCCTCAAGAAGCCAGTCTCTGGT
GTTGCCAAACGCGTTCAGAACAGTGCATCGTTCTAG
Transcript >OphauB2|7459
ATGAACAACTGCACCCGACACATGCTGCGGTGCTGTGCATTTCAAAGTGGCAGGCTCTCGAGATTTGGCGTTACA
CCGTCAGCTCCATTTTCCACCTCATCTAGACGTCGAGCCGATTCCAAGCAGCCTGCAGACGACGGCGGCTTTGTA
TCAGTCCTCGATGCGTCTCCTCGCCTCGTCAGCAGCCGTCGTCGACATGGCCCCGGCATCATGCTCCTTGTCCTG
ATTCCACTCACCGCCTTTGCCCTGGGCACCTGGCAGGTCCAACGCCTCGGCTGGAAGACGGACCTCATCGCCAAG
CTGGAGGATCGCCTTGTCCGCCCGCCCCTCCCCCTCCCGCCGCATGTTGATCCCGCCGCCATTCATGACTTTGAC
TACCGCCGCGTCGTCGCTGTCGGCTGCTTCCGCCACGATCAAGAAATGCTAATTGGCCCCCGCATGCGAGATGGC
AAGGACGGATACATGGTCATCACTCCACTTGAGCGCCAGGATGCCAGCACGGTTCTTGTCAATCGTGGATGGATC
AGCAAGCTTCATAGGGACCAAGCAAGTCGACCCGACTCGCTACCCCGAGGCCAAGTTGTCGTTCAAGGTCTGCTA
CGTGAGCCGTGGAAGAAGAACATGTTTACACCCGAGAATAGGCCCCAGACGAGCCAATTCTTTTTCCCAGATGTC
AATCAAATGGCTGCTCTAACCGGGAGCCAGCCCGTGTGGATTGAAGTTACCATGGAGCCCGAATTTATGAGACTC
ATGGACTATGAGGCTCGTGGTATTCCATATGGACGGCCAGCAGAAGTCAATCTGCGAAACAATCACGCCCAGTAC
ATTTTTACTTGGTACGGCCTCTGTGCTGCCACGTCAGTCATGCTGTACATGGTCCTCAAGAAGCCAGTCTCTGGT
GTTGCCAAACGCGTTCAGAACAGTGCATCGTTCTAG
Gene >OphauB2|7459
ATGAACAACTGCACCCGACACATGCTGCGGTGCTGTGCATTTCAAAGTGGCAGGCTCTCGAGATTTGGCGTTACA
CCGTCAGCTCCATTTTCCACCTCATCTAGACGTCGAGCCGATTCCAAGCAGCCTGCAGACGACGGCGGCTTTGTA
TCAGTCCTCGATGCGTCTCCTCGCCTCGTCAGCAGCCGTCGTCGACATGGCCCCGGCATCATGCTCCTTGGTGTG
TCTTGAACTCTTGCCTTGGTGCTCTCAGGTCCTGGGCTAAGACTGCCTGCCGTTGCACAGTCCTGATTCCACTCA
CCGCCTTTGCCCTGGGCACCTGGCAGGTCCAACGCCTCGGCTGGAAGACGGACCTCATCGCCAAGCTGGAGGATC
GCCTTGTCCGCCCGCCCCTCCCCCTCCCGCCGCATGTTGATCCCGCCGCCATTCATGACTTTGACTACCGCCGCG
TCGTCGCTGTCGGCTGCTTCCGCCACGATCAAGAAATGCTAATTGGCCCCCGCATGCGAGATGGCAAGGACGGAT
ACATGGTCATCACTCCACTTGAGCGCCAGGATGCCAGCACGGTTCTTGTCAATCGTGGATGGATCAGCAAGCTTC
ATAGGGACCAAGCAAGTCGACCCGACTCGCTACCCCGAGGCCAAGTTGTCGTTCAAGGTCTGCTACGTGAGCCGT
GGAAGAAGAACATGTTTACACCCGAGAATAGGCCCCAGACGAGCCAATTCTTTTTCCCAGATGTCAATCAAATGG
CTGCTCTAACCGGGAGCCAGCCCGTGTGGATTGAAGTTACCATGGGTATTTATTCTCGTTACTTTGGTGGTCGTG
GCTTTTACACTTACACCACGACAGAGCCCGAATTTATGAGACTCATGGACTATGAGGCTCGTGGTATTCCATATG
GACGGCCAGCAGAAGTCAATCTGCGAAACAATCACGCCCAGTACATTTTTACTTGGTATGTCTGGGTCCATTCTG
CTTTTGCGGGTGCCGCCAATTTGGTTGACGCTTGGCCTGCTAGGTACGGCCTCTGTGCTGCCACGTCAGTCATGC
TGTACATGGTCCTCAAGAAGCCAGTCTCTGGTGTTGCCAAACGCGTTCAGAACAGTGCATCGTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail