Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7458
Gene name
LocationContig_8:177882..179462
Strand+
Gene length (bp)1580
Transcript length (bp)1458
Coding sequence length (bp)1458
Protein length (aa) 486

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold 1.5E-42 358 465
PF15630 CENP-S CENP-S protein 3.2E-08 386 437

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9HGK9|YHLD_SCHPO Uncharacterized protein C800.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC800.13 PE=3 SV=1 349 456 2.0E-14
sp|F1NPG5|CENPT_CHICK Centromere protein T OS=Gallus gallus GN=CENPT PE=1 SV=2 336 455 6.0E-09

GO

GO Term Description Terminal node
GO:0071821 FANCM-MHF complex Yes
GO:0032991 protein-containing complex No
GO:0005575 cellular_component No
GO:0140513 nuclear protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7458
MASTPRGSVAGGNRDAHATPPSRQAAPSSRPSIHTPLNRAASRDLVASVRRGASASGGRRPNNAPTPHAKAARLA
LHQRRHAIFTPAKNRRRSLMEQRETPRDLLRDLSRALASKSKPIVSSPRDASPNRLAHREPDQDDDDDLPIDRPR
LSVALDDDDDDDDDDDLKPPRLSAIHDDNHTAQSIELPRRALSEQPRPSLPRGSFGNVRDSDFFGNEDRLLAQDG
ARQSDFFPGLLEELQAGPDTDNVTFDRIDGDHTRRNTASRVSEFGFQLPAGMEDQTTFVLSDPPRETDAEPWSLE
QYQATLDANDELLDMSAVHDNVGKTVLDLSPANHGRADDGPREAKARARKPRKRMSRHGIEYPPLPPSLIKKTAL
RALQSTGLSNHRLSPDTLCALTQASEWFFEQLGDDLGAYANHAGRKTVEESDVIALMRRQRQIGSNATIFSLAQK
NLPRELLQELRMPAPQTSRKRRLKRPGSTQDDVAD*
Coding >OphauB2|7458
ATGGCTTCGACTCCAAGGGGCTCTGTCGCTGGCGGCAACAGAGATGCCCATGCAACTCCACCAAGCCGCCAGGCC
GCCCCCTCGTCGCGCCCGTCTATCCATACGCCTCTGAACCGCGCCGCTTCCCGCGATCTTGTCGCCTCAGTGCGT
CGCGGGGCATCCGCCTCGGGCGGTCGTCGACCCAACAACGCACCAACTCCTCATGCCAAAGCTGCTCGCTTGGCC
CTGCACCAGCGACGCCATGCAATCTTCACTCCCGCCAAGAACCGCCGTCGGAGCTTGATGGAGCAACGAGAAACA
CCCAGAGACCTGCTTCGCGACCTCAGCAGAGCTCTAGCCTCCAAAAGCAAGCCTATTGTCTCGTCTCCGCGAGAC
GCTTCTCCAAACAGACTGGCGCACCGGGAGCCGGACCAAGACGACGATGACGACCTACCAATCGACAGACCGCGC
TTATCCGTGGCTCTTGATGACGACGACGACGACGACGACGATGACGACCTGAAACCTCCCCGTTTGTCGGCCATC
CACGATGACAATCATACAGCCCAGTCGATTGAGTTGCCCCGCCGTGCTTTGAGCGAGCAACCACGTCCCAGTCTG
CCTCGAGGCAGCTTCGGCAACGTTCGCGACAGCGATTTTTTCGGCAACGAGGACCGTCTTTTAGCTCAAGATGGC
GCCCGCCAGTCTGACTTCTTTCCTGGCCTGCTGGAAGAACTCCAGGCTGGACCCGACACGGACAATGTGACATTT
GATCGAATAGACGGAGACCATACACGGCGCAACACTGCCAGCCGCGTCAGCGAATTTGGATTCCAGCTGCCAGCC
GGCATGGAAGACCAGACCACCTTTGTTCTCTCTGATCCGCCTCGCGAGACGGATGCAGAGCCTTGGAGCTTGGAA
CAATATCAAGCTACTCTCGATGCCAATGATGAGCTACTGGACATGTCAGCGGTCCATGACAACGTCGGCAAGACA
GTCTTGGACCTTTCTCCCGCAAACCATGGCCGAGCCGACGACGGCCCTCGAGAAGCAAAAGCCCGGGCGCGGAAG
CCACGCAAGCGCATGTCCAGGCATGGCATTGAGTATCCACCACTGCCACCCTCTTTGATCAAGAAGACGGCCCTA
AGGGCTCTACAGTCGACGGGTCTCAGCAACCACCGTCTCTCACCCGATACTCTGTGCGCCTTAACACAGGCCTCT
GAATGGTTTTTTGAACAGCTCGGTGACGACCTTGGTGCCTACGCCAACCACGCGGGTCGCAAGACGGTTGAAGAA
AGCGATGTCATCGCTTTAATGCGCAGGCAACGCCAAATCGGCTCCAATGCCACAATCTTCTCCCTTGCACAAAAG
AACCTACCACGAGAACTCCTTCAAGAATTGAGAATGCCAGCCCCGCAAACATCGCGCAAACGACGTCTAAAGCGT
CCCGGCAGCACCCAGGACGACGTGGCGGATTGA
Transcript >OphauB2|7458
ATGGCTTCGACTCCAAGGGGCTCTGTCGCTGGCGGCAACAGAGATGCCCATGCAACTCCACCAAGCCGCCAGGCC
GCCCCCTCGTCGCGCCCGTCTATCCATACGCCTCTGAACCGCGCCGCTTCCCGCGATCTTGTCGCCTCAGTGCGT
CGCGGGGCATCCGCCTCGGGCGGTCGTCGACCCAACAACGCACCAACTCCTCATGCCAAAGCTGCTCGCTTGGCC
CTGCACCAGCGACGCCATGCAATCTTCACTCCCGCCAAGAACCGCCGTCGGAGCTTGATGGAGCAACGAGAAACA
CCCAGAGACCTGCTTCGCGACCTCAGCAGAGCTCTAGCCTCCAAAAGCAAGCCTATTGTCTCGTCTCCGCGAGAC
GCTTCTCCAAACAGACTGGCGCACCGGGAGCCGGACCAAGACGACGATGACGACCTACCAATCGACAGACCGCGC
TTATCCGTGGCTCTTGATGACGACGACGACGACGACGACGATGACGACCTGAAACCTCCCCGTTTGTCGGCCATC
CACGATGACAATCATACAGCCCAGTCGATTGAGTTGCCCCGCCGTGCTTTGAGCGAGCAACCACGTCCCAGTCTG
CCTCGAGGCAGCTTCGGCAACGTTCGCGACAGCGATTTTTTCGGCAACGAGGACCGTCTTTTAGCTCAAGATGGC
GCCCGCCAGTCTGACTTCTTTCCTGGCCTGCTGGAAGAACTCCAGGCTGGACCCGACACGGACAATGTGACATTT
GATCGAATAGACGGAGACCATACACGGCGCAACACTGCCAGCCGCGTCAGCGAATTTGGATTCCAGCTGCCAGCC
GGCATGGAAGACCAGACCACCTTTGTTCTCTCTGATCCGCCTCGCGAGACGGATGCAGAGCCTTGGAGCTTGGAA
CAATATCAAGCTACTCTCGATGCCAATGATGAGCTACTGGACATGTCAGCGGTCCATGACAACGTCGGCAAGACA
GTCTTGGACCTTTCTCCCGCAAACCATGGCCGAGCCGACGACGGCCCTCGAGAAGCAAAAGCCCGGGCGCGGAAG
CCACGCAAGCGCATGTCCAGGCATGGCATTGAGTATCCACCACTGCCACCCTCTTTGATCAAGAAGACGGCCCTA
AGGGCTCTACAGTCGACGGGTCTCAGCAACCACCGTCTCTCACCCGATACTCTGTGCGCCTTAACACAGGCCTCT
GAATGGTTTTTTGAACAGCTCGGTGACGACCTTGGTGCCTACGCCAACCACGCGGGTCGCAAGACGGTTGAAGAA
AGCGATGTCATCGCTTTAATGCGCAGGCAACGCCAAATCGGCTCCAATGCCACAATCTTCTCCCTTGCACAAAAG
AACCTACCACGAGAACTCCTTCAAGAATTGAGAATGCCAGCCCCGCAAACATCGCGCAAACGACGTCTAAAGCGT
CCCGGCAGCACCCAGGACGACGTGGCGGATTGA
Gene >OphauB2|7458
ATGGCTTCGACTCCAAGGGGCTCTGTCGCTGGCGGCAACAGAGATGCCCATGCAACTCCACCAAGCCGCCAGGCC
GCCCCCTCGTCGCGCCCGTCTATCCATACGCCTCTGAACCGCGCCGCTTCCCGCGATCTTGTCGCCTCAGTGCGT
CGCGGGGCATCCGCCTCGGGCGGTCGTCGACCCAACAACGCACCAACTCCTCATGCCAAAGCTGCTCGCTTGGCC
CTGCACCAGCGACGCCATGCAATCTTCACTCCCGCCAAGAACCGCCGTCGGAGCTTGATGGAGCAACGAGAAACA
CCCAGAGACCTGCTTCGCGACCTCAGCAGAGCTCTAGCCTCCAAAAGCAAGCCTATTGTCTCGTCTCCGCGAGAC
GCTTCTCCAAACAGACTGGCGCACCGGGAGCCGGACCAAGACGACGATGACGACCTACCAATCGACAGACCGCGC
TTATCCGTGGCTCTTGATGACGACGACGACGACGACGACGATGACGACCTGAAACCTCCCCGTTTGTCGGCCATC
CACGATGACAATCATACAGCCCAGTCGATTGAGTTGCCCCGCCGTGCTTTGAGCGAGCAACCACGTCCCAGTCTG
CCTCGAGGCAGCTTCGGCAACGTTCGCGACAGCGATTTTTTCGGCAACGAGGACCGTCTTTTAGCTCAAGATGGC
GCCCGCCAGTCTGACTTCTTTCCTGGCCTGCTGGAAGAACTCCAGGCTGGACCCGACACGGACAATGTGACATTT
GATCGGTAGGCAAAGCATCCCCTCAAGGCACTACGTCTTGCCGTCTGGCTCTGACCATGAATACAGAATAGACGG
AGACCATACACGGCGCAACACTGCCAGCCGCGTCAGCGAATTTGGATTCCAGCTGCCAGCCGGCATGGAAGACCA
GACCACCTTTGTTCTCTCTGATCCGCCTCGCGAGACGGATGCAGAGCCTTGGAGCTTGGAACAATATCAAGCTAC
TCTCGATGCCAATGATGAGCTACTGGACATGTCAGCGGTCCATGACAACGTCGGCAAGACAGTCTTGGACCTTTC
TCCCGCAAACCATGGCCGAGCCGACGACGGCCCTCGAGAAGCAAAAGCCCGGGCGCGGAAGCCACGCAAGCGCAT
GTCCAGGCATGGCATTGAGTATCCACCACTGCCACCCTCTTTGATCAAGAAGACGGCCCTAAGGGCTCTACAGTC
GACGGGTCTCAGCAACCACCGTCTCTCACCCGATACTCTGTGCGCCTTAACACAGGCCTCTGAATGGTTTTTTGA
ACAGCTCGGTGACGACCTTGGTGCCTACGCCAACCACGCGGGTCGCAAGACGGTTGAAGAAAGCGATGTCATCGC
TTTAATGCGCAGGTGAGCTTTGGTGCATGTAGTCGTCATTGTGGCTTCTTTGGCTCTAATATCAATCATATAGGC
AACGCCAAATCGGCTCCAATGCCACAATCTTCTCCCTTGCACAAAAGAACCTACCACGAGAACTCCTTCAAGAAT
TGAGAATGCCAGCCCCGCAAACATCGCGCAAACGACGTCTAAAGCGTCCCGGCAGCACCCAGGACGACGTGGCGG
ATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail