Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7455
Gene name
LocationContig_8:170854..172085
Strand+
Gene length (bp)1231
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.3E-06 225 291

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7Y3|YGR4_SCHPO Uncharacterized RNA-binding protein C365.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC365.04c PE=3 SV=1 224 368 6.0E-15
sp|Q07623|NOP6_YEAST Nucleolar protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP6 PE=1 SV=1 223 333 9.0E-13

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7455
MKSKRARDTVTVPAEGTNTTEEPPAKKRKSDSEGPDEVKQKKIKKDKKKEKKERKEKKDKKENRREKKDKRKNLQ
DLPEEELQSELRSASEKENEPTIEVGAEKEPSKNGKKEQSNGKDVNGIGKHDKVSPDDFPAEMVSKREKKSKREK
SEAKNGVNGDAKKHKAKEDKKHKEAQKKKKKKETQGTQESQESQDEAKDPKDPEAMVTTNTTTASDKPKADRHIV
FVGNLPYTATTASIKAHFAPVQPVAVRCLTQRKDVSLCRGVAFVDLPSAKAQRTCLDRFHHSTFDDGQSPSRKIN
VELTAGGGGKTKHRTEKILQRNKKLDENRSKRIEQEKVSKENAQRQDDTTHVDQQEQNMGDSIHPSRLARNPRLG
K*
Coding >OphauB2|7455
ATGAAGAGCAAGCGTGCACGCGACACTGTCACAGTTCCGGCTGAAGGCACAAACACGACGGAAGAGCCCCCGGCC
AAGAAGCGCAAGAGCGATTCTGAAGGGCCCGACGAAGTGAAACAAAAGAAGATCAAAAAAGACAAGAAGAAGGAG
AAGAAGGAAAGAAAGGAGAAGAAAGACAAGAAGGAAAACAGAAGAGAGAAAAAGGATAAGCGCAAGAATTTACAG
GATCTCCCTGAAGAGGAACTTCAGTCTGAGCTTCGAAGCGCCTCCGAGAAGGAAAACGAGCCAACCATCGAGGTG
GGAGCAGAAAAGGAGCCGAGCAAGAATGGGAAGAAGGAGCAAAGCAATGGCAAAGATGTCAATGGCATTGGAAAG
CATGACAAGGTTTCACCAGATGATTTCCCGGCAGAGATGGTGTCGAAGAGGGAGAAGAAGTCTAAACGGGAGAAA
TCAGAAGCCAAAAATGGTGTAAATGGTGACGCTAAAAAGCACAAAGCAAAAGAGGACAAGAAGCACAAGGAGGCG
CAAAAGAAGAAGAAAAAGAAGGAGACCCAGGGGACCCAGGAATCCCAGGAATCCCAGGACGAGGCTAAAGACCCA
AAGGACCCAGAAGCAATGGTGACGACGAATACCACGACAGCAAGCGACAAGCCAAAGGCTGATCGACACATTGTA
TTTGTCGGCAACCTGCCCTACACAGCCACGACGGCGTCCATCAAGGCGCACTTTGCGCCTGTGCAACCCGTCGCG
GTCCGCTGTCTGACCCAGCGCAAAGACGTCAGTCTGTGTCGCGGGGTTGCCTTTGTGGATTTACCTTCGGCCAAG
GCGCAGCGCACCTGTCTCGATCGCTTTCACCACTCAACCTTTGACGATGGCCAGTCGCCATCGCGCAAGATTAAT
GTCGAGTTGACCGCTGGTGGTGGTGGCAAGACCAAGCACCGCACCGAAAAGATTTTACAACGAAACAAGAAACTA
GACGAGAATCGCAGCAAGCGCATCGAGCAGGAAAAAGTGTCCAAGGAAAACGCCCAACGCCAAGACGACACCACG
CACGTGGACCAGCAGGAGCAGAACATGGGTGATAGTATCCATCCCAGCCGCCTGGCAAGAAATCCACGCCTGGGG
AAATAA
Transcript >OphauB2|7455
ATGAAGAGCAAGCGTGCACGCGACACTGTCACAGTTCCGGCTGAAGGCACAAACACGACGGAAGAGCCCCCGGCC
AAGAAGCGCAAGAGCGATTCTGAAGGGCCCGACGAAGTGAAACAAAAGAAGATCAAAAAAGACAAGAAGAAGGAG
AAGAAGGAAAGAAAGGAGAAGAAAGACAAGAAGGAAAACAGAAGAGAGAAAAAGGATAAGCGCAAGAATTTACAG
GATCTCCCTGAAGAGGAACTTCAGTCTGAGCTTCGAAGCGCCTCCGAGAAGGAAAACGAGCCAACCATCGAGGTG
GGAGCAGAAAAGGAGCCGAGCAAGAATGGGAAGAAGGAGCAAAGCAATGGCAAAGATGTCAATGGCATTGGAAAG
CATGACAAGGTTTCACCAGATGATTTCCCGGCAGAGATGGTGTCGAAGAGGGAGAAGAAGTCTAAACGGGAGAAA
TCAGAAGCCAAAAATGGTGTAAATGGTGACGCTAAAAAGCACAAAGCAAAAGAGGACAAGAAGCACAAGGAGGCG
CAAAAGAAGAAGAAAAAGAAGGAGACCCAGGGGACCCAGGAATCCCAGGAATCCCAGGACGAGGCTAAAGACCCA
AAGGACCCAGAAGCAATGGTGACGACGAATACCACGACAGCAAGCGACAAGCCAAAGGCTGATCGACACATTGTA
TTTGTCGGCAACCTGCCCTACACAGCCACGACGGCGTCCATCAAGGCGCACTTTGCGCCTGTGCAACCCGTCGCG
GTCCGCTGTCTGACCCAGCGCAAAGACGTCAGTCTGTGTCGCGGGGTTGCCTTTGTGGATTTACCTTCGGCCAAG
GCGCAGCGCACCTGTCTCGATCGCTTTCACCACTCAACCTTTGACGATGGCCAGTCGCCATCGCGCAAGATTAAT
GTCGAGTTGACCGCTGGTGGTGGTGGCAAGACCAAGCACCGCACCGAAAAGATTTTACAACGAAACAAGAAACTA
GACGAGAATCGCAGCAAGCGCATCGAGCAGGAAAAAGTGTCCAAGGAAAACGCCCAACGCCAAGACGACACCACG
CACGTGGACCAGCAGGAGCAGAACATGGGTGATAGTATCCATCCCAGCCGCCTGGCAAGAAATCCACGCCTGGGG
AAATAA
Gene >OphauB2|7455
ATGAAGAGCAAGCGTGCACGCGACACTGTCACAGTTCCGGCTGAAGGCACAAACACGACGGAAGAGCCCCCGGCC
AAGAAGCGCAAGAGCGATTCTGAAGGGCCCGACGAAGTGAAACAAAAGAAGATCAAAAAAGACAAGAAGAAGGAG
AAGAAGGAAAGAAAGGAGAAGAAAGACAAGAAGGAAAACAGAAGAGAGAAAAAGGATAAGCGCAAGAATTTACAG
GATCTCCCTGAAGAGGAACTTCAGTCTGAGCTTCGAAGCGCCTCCGAGAAGGAAAACGAGCCAACCATCGAGGTG
GGAGCAGAAAAGGAGCCGAGCAAGAATGGGAAGAAGGAGCAAAGCAATGGCAAAGATGTCAATGGCATTGGAAAG
CATGACAAGGTTTCACCAGATGATTTCCCGGCAGAGATGGTGTCGAAGAGGGAGAAGAAGTCTAAACGGGAGAAA
TCAGAAGCCAAAAATGGTGTAAATGGTGACGCTAAAAAGCACAAAGCAAAAGAGGACAAGAAGCACAAGGAGGCG
CAAAAGAAGAAGAAAAAGAAGGAGACCCAGGGGACCCAGGAATCCCAGGAATCCCAGGACGAGGCTAAAGACCCA
AAGGACCCAGAAGCAATGGTGACGACGAATACCACGACAGCAAGCGACAAGCCAAAGGCTGATCGACACATTGTA
TTTGTCGGCAACCTGCCCTACACAGCCACGACGGCGTCCATCAAGGCGCACTTTGCGCCTGTGCAACCCGTCGCG
GTCCGCTGTCTGACCCAGCGCAAAGACGTCAGTCTGTGTCGCGGGGTTGCCTTTGTGGATTTACCTTCGGCCAAG
GCGCAGCGCACCTGTCTCGATCGCTTTCACCACTCAACCTTTGACGATGGCCAGTCGCCATCGCGCAAGATTAAT
GTCGAGTTGACGTACGTCCCACTAGTTTTCTCACTACCCTTTTCCTTTTCTTCTCTTCTTCTCAAGTCTCTTTCT
TGCTTCTGGAATCATGCCGTGGCTGACAAGCAGCAGCGCTGGTGGTGGTGGCAAGACCAAGCACCGCACCGAAAA
GATTTTACAACGAAACAAGAAACTAGACGAGAATCGCAGCAAGCGCATCGAGCAGGAAAAAGTGTCCAAGGAAAA
CGCCCAACGCCAAGACGACACCACGCACGTGGACCAGCAGGAGCAGAACATGGGTGATAGTATCCATCCCAGCCG
CCTGGCAAGAAATCCACGCCTGGGGAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail