Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7452
Gene name
LocationContig_8:164960..165830
Strand+
Gene length (bp)870
Transcript length (bp)813
Coding sequence length (bp)813
Protein length (aa) 271

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00018 SH3_1 SH3 domain 7.0E-14 131 177
PF14604 SH3_9 Variant SH3 domain 5.6E-11 132 181
PF07653 SH3_2 Variant SH3 domain 1.5E-10 129 183

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43125|CSH3_SCHPO Protein csh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csh3 PE=2 SV=1 13 270 3.0E-14
sp|Q06449|PIN3_YEAST [PSI+] inducibility protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIN3 PE=1 SV=1 121 270 5.0E-14
sp|Q1E878|HSE1_COCIM Class E vacuolar protein-sorting machinery protein HSE1 OS=Coccidioides immitis (strain RS) GN=HSE1 PE=3 SV=1 111 186 9.0E-10
sp|Q8K3E5|AHI1_MOUSE Jouberin OS=Mus musculus GN=Ahi1 PE=1 SV=2 132 220 1.0E-09
sp|P00528|SRC64_DROME Tyrosine-protein kinase Src64B OS=Drosophila melanogaster GN=Src64B PE=1 SV=3 113 184 3.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43125|CSH3_SCHPO Protein csh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csh3 PE=2 SV=1 13 270 3.0E-14
sp|Q06449|PIN3_YEAST [PSI+] inducibility protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIN3 PE=1 SV=1 121 270 5.0E-14
sp|Q1E878|HSE1_COCIM Class E vacuolar protein-sorting machinery protein HSE1 OS=Coccidioides immitis (strain RS) GN=HSE1 PE=3 SV=1 111 186 9.0E-10
sp|Q8K3E5|AHI1_MOUSE Jouberin OS=Mus musculus GN=Ahi1 PE=1 SV=2 132 220 1.0E-09
sp|P00528|SRC64_DROME Tyrosine-protein kinase Src64B OS=Drosophila melanogaster GN=Src64B PE=1 SV=3 113 184 3.0E-09
sp|Q5BBL4|HSE1_EMENI Class E vacuolar protein-sorting machinery protein hse1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hse1 PE=3 SV=1 93 181 7.0E-09
sp|Q7S6J4|HSE1_NEUCR Class E vacuolar protein-sorting machinery protein hse1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hse1 PE=3 SV=1 111 189 1.0E-08
sp|A1CEK6|HSE1_ASPCL Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hse1 PE=3 SV=1 115 181 2.0E-08
sp|Q5A895|HSE1_CANAL Class E vacuolar protein-sorting machinery protein HSE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSE1 PE=3 SV=1 89 181 2.0E-08
sp|P38479|ABP1_SACEX Actin-binding protein OS=Saccharomyces exiguus GN=ABP1 PE=3 SV=1 130 182 3.0E-08
sp|Q2GT05|HSE1_CHAGB Class E vacuolar protein-sorting machinery protein HSE1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HSE1 PE=3 SV=1 118 189 3.0E-08
sp|A2QW93|HSE1_ASPNC Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hse1 PE=3 SV=1 117 181 4.0E-08
sp|Q0CJU8|HSE1_ASPTN Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hse1 PE=3 SV=1 117 181 5.0E-08
sp|A3LXQ8|HSE1_PICST Class E vacuolar protein-sorting machinery protein HSE1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HSE1 PE=3 SV=2 96 181 1.0E-07
sp|A4RF61|HSE1_MAGO7 Class E vacuolar protein-sorting machinery protein HSE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HSE1 PE=3 SV=2 127 189 1.0E-07
sp|Q6C2N2|HSE1_YARLI Class E vacuolar protein-sorting machinery protein HSE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HSE1 PE=3 SV=1 126 182 1.0E-07
sp|Q4WHP5|HSE1_ASPFU Class E vacuolar protein-sorting machinery protein hse1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hse1 PE=3 SV=1 126 181 1.0E-07
sp|Q6CVA8|HSE1_KLULA Class E vacuolar protein-sorting machinery protein HSE1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HSE1 PE=3 SV=1 126 181 2.0E-07
sp|A1DFN5|HSE1_NEOFI Class E vacuolar protein-sorting machinery protein hse1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hse1 PE=3 SV=1 126 181 2.0E-07
sp|P15891|ABP1_YEAST Actin-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ABP1 PE=1 SV=4 130 181 2.0E-07
sp|Q6DTM3|AHI1_RAT Jouberin OS=Rattus norvegicus GN=Ahi1 PE=1 SV=1 132 206 3.0E-07
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 108 189 5.0E-07
sp|Q9WVE9|ITSN1_RAT Intersectin-1 OS=Rattus norvegicus GN=Itsn1 PE=1 SV=1 108 189 5.0E-07
sp|P38753|HSE1_YEAST Class E vacuolar protein-sorting machinery protein HSE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSE1 PE=1 SV=1 123 181 6.0E-07
sp|Q75DS3|HSE1_ASHGO Class E vacuolar protein-sorting machinery protein HSE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HSE1 PE=3 SV=1 117 181 6.0E-07
sp|Q0U6X7|HSE1_PHANO Class E vacuolar protein-sorting machinery protein HSE1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HSE1 PE=3 SV=1 126 186 9.0E-07
sp|Q6FN49|HSE1_CANGA Class E vacuolar protein-sorting machinery protein HSE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HSE1 PE=3 SV=1 127 181 1.0E-06
sp|O14259|SFP47_SCHPO Ubp4-interactor sfp47 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sfp47 PE=1 SV=2 125 187 1.0E-06
sp|Q6BNP6|HSE1_DEBHA Class E vacuolar protein-sorting machinery protein HSE1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HSE1 PE=3 SV=2 106 181 2.0E-06
sp|Q01621|LCK_RAT Proto-oncogene tyrosine-protein kinase LCK OS=Rattus norvegicus GN=Lck PE=1 SV=3 85 191 2.0E-06
sp|Q8N157|AHI1_HUMAN Jouberin OS=Homo sapiens GN=AHI1 PE=1 SV=1 132 206 2.0E-06
sp|P42522|MYOC_DICDI Myosin IC heavy chain OS=Dictyostelium discoideum GN=myoC PE=3 SV=2 132 181 2.0E-06
sp|Q91X43|SH319_MOUSE SH3 domain-containing protein 19 OS=Mus musculus GN=Sh3d19 PE=1 SV=2 116 181 3.0E-06
sp|O43639|NCK2_HUMAN Cytoplasmic protein NCK2 OS=Homo sapiens GN=NCK2 PE=1 SV=2 96 201 4.0E-06
sp|Q5PXS1|LCK_AOTNA Tyrosine-protein kinase Lck OS=Aotus nancymaae GN=LCK PE=2 SV=4 99 191 5.0E-06
sp|P00524|SRC_RSVSA Tyrosine-protein kinase transforming protein Src OS=Avian leukosis virus RSA GN=V-SRC PE=1 SV=5 132 181 7.0E-06
sp|P00525|SRC_AVISR Tyrosine-protein kinase transforming protein Src OS=Avian sarcoma virus (strain rASV1441) GN=V-SRC PE=1 SV=3 132 181 7.0E-06
sp|Q9WUD9|SRC_RAT Proto-oncogene tyrosine-protein kinase Src OS=Rattus norvegicus GN=Src PE=1 SV=4 132 181 8.0E-06
sp|P12931|SRC_HUMAN Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens GN=SRC PE=1 SV=3 132 181 8.0E-06
sp|P00523|SRC_CHICK Proto-oncogene tyrosine-protein kinase Src OS=Gallus gallus GN=SRC PE=1 SV=4 132 181 8.0E-06
sp|A1A5H8|YES_DANRE Tyrosine-protein kinase yes OS=Danio rerio GN=yes1 PE=1 SV=1 127 181 9.0E-06
sp|Q1JPZ3|SRC_DANRE Proto-oncogene tyrosine-protein kinase Src OS=Danio rerio GN=src PE=1 SV=2 132 181 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7452
MASADRHTIMETNRSLRNIKTELENLLEKGVIDEAVFDTIHSALPQESPLSGPLRTATASSKSTSSHIGAAASPE
PAHASPSNALPTQAMQNLNVRETGSKAASPAPPGYEETPPPGLPSRNAKPVIAHARALYRYGASDARDLSFERDD
KIAVYERMNQDWWMGQNLRTGQEGIFPRNYVLEEADYKPPPGPMYAQPQYGYNGPPPQQNPYNAPVPPMAVAEGG
QQPPPNDGGDNKVGQYGKKFGKKLGNAAIFGAGASIGSNIVNSIF*
Coding >OphauB2|7452
ATGGCATCGGCCGACCGTCACACAATCATGGAGACCAACCGGTCACTCCGCAACATCAAAACTGAACTCGAGAAC
CTACTTGAAAAGGGGGTCATTGACGAGGCAGTTTTCGACACGATTCATTCTGCCCTGCCACAAGAATCTCCGCTT
TCGGGTCCTCTTCGCACCGCGACAGCATCTAGCAAGTCGACAAGCAGCCACATTGGTGCTGCAGCATCGCCAGAG
CCTGCACATGCCAGCCCCTCGAATGCTCTGCCAACTCAGGCCATGCAGAATCTCAACGTTCGCGAGACGGGAAGC
AAGGCGGCATCTCCTGCTCCGCCTGGATACGAGGAGACGCCGCCGCCGGGCCTGCCAAGTCGCAATGCAAAGCCC
GTCATTGCCCACGCCCGCGCGCTTTATCGATATGGCGCCTCGGACGCTCGCGATCTTTCCTTTGAGCGCGACGAC
AAGATTGCCGTGTACGAGCGCATGAACCAGGACTGGTGGATGGGACAGAATCTGCGCACCGGACAAGAGGGCATC
TTTCCGCGCAACTACGTCCTTGAAGAGGCCGATTACAAGCCACCACCGGGGCCCATGTACGCGCAGCCACAGTAT
GGCTACAATGGTCCACCACCCCAGCAAAATCCTTACAACGCCCCCGTACCGCCCATGGCCGTGGCTGAAGGCGGC
CAGCAGCCACCACCAAACGATGGAGGAGACAACAAGGTTGGCCAATACGGCAAGAAATTTGGCAAGAAGTTGGGC
AACGCAGCCATTTTTGGTGCGGGTGCTTCTATCGGCAGCAATATTGTCAATAGCATCTTTTGA
Transcript >OphauB2|7452
ATGGCATCGGCCGACCGTCACACAATCATGGAGACCAACCGGTCACTCCGCAACATCAAAACTGAACTCGAGAAC
CTACTTGAAAAGGGGGTCATTGACGAGGCAGTTTTCGACACGATTCATTCTGCCCTGCCACAAGAATCTCCGCTT
TCGGGTCCTCTTCGCACCGCGACAGCATCTAGCAAGTCGACAAGCAGCCACATTGGTGCTGCAGCATCGCCAGAG
CCTGCACATGCCAGCCCCTCGAATGCTCTGCCAACTCAGGCCATGCAGAATCTCAACGTTCGCGAGACGGGAAGC
AAGGCGGCATCTCCTGCTCCGCCTGGATACGAGGAGACGCCGCCGCCGGGCCTGCCAAGTCGCAATGCAAAGCCC
GTCATTGCCCACGCCCGCGCGCTTTATCGATATGGCGCCTCGGACGCTCGCGATCTTTCCTTTGAGCGCGACGAC
AAGATTGCCGTGTACGAGCGCATGAACCAGGACTGGTGGATGGGACAGAATCTGCGCACCGGACAAGAGGGCATC
TTTCCGCGCAACTACGTCCTTGAAGAGGCCGATTACAAGCCACCACCGGGGCCCATGTACGCGCAGCCACAGTAT
GGCTACAATGGTCCACCACCCCAGCAAAATCCTTACAACGCCCCCGTACCGCCCATGGCCGTGGCTGAAGGCGGC
CAGCAGCCACCACCAAACGATGGAGGAGACAACAAGGTTGGCCAATACGGCAAGAAATTTGGCAAGAAGTTGGGC
AACGCAGCCATTTTTGGTGCGGGTGCTTCTATCGGCAGCAATATTGTCAATAGCATCTTTTGA
Gene >OphauB2|7452
ATGGCATCGGCCGACCGTCACACAATCATGGAGACCAACCGGTCACTCCGCAACATCAAAACTGTGAGAGTTTTT
TCTGAGGCGTCGAGGTAATAATGACTGACTGTCTCCATGTCGCAGGAACTCGAGAACCTACTTGAAAAGGGGGTC
ATTGACGAGGCAGTTTTCGACACGATTCATTCTGCCCTGCCACAAGAATCTCCGCTTTCGGGTCCTCTTCGCACC
GCGACAGCATCTAGCAAGTCGACAAGCAGCCACATTGGTGCTGCAGCATCGCCAGAGCCTGCACATGCCAGCCCC
TCGAATGCTCTGCCAACTCAGGCCATGCAGAATCTCAACGTTCGCGAGACGGGAAGCAAGGCGGCATCTCCTGCT
CCGCCTGGATACGAGGAGACGCCGCCGCCGGGCCTGCCAAGTCGCAATGCAAAGCCCGTCATTGCCCACGCCCGC
GCGCTTTATCGATATGGCGCCTCGGACGCTCGCGATCTTTCCTTTGAGCGCGACGACAAGATTGCCGTGTACGAG
CGCATGAACCAGGACTGGTGGATGGGACAGAATCTGCGCACCGGACAAGAGGGCATCTTTCCGCGCAACTACGTC
CTTGAAGAGGCCGATTACAAGCCACCACCGGGGCCCATGTACGCGCAGCCACAGTATGGCTACAATGGTCCACCA
CCCCAGCAAAATCCTTACAACGCCCCCGTACCGCCCATGGCCGTGGCTGAAGGCGGCCAGCAGCCACCACCAAAC
GATGGAGGAGACAACAAGGTTGGCCAATACGGCAAGAAATTTGGCAAGAAGTTGGGCAACGCAGCCATTTTTGGT
GCGGGTGCTTCTATCGGCAGCAATATTGTCAATAGCATCTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail