Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7452
Gene name
LocationContig_8:164960..165830
Strand+
Gene length (bp)870
Transcript length (bp)813
Coding sequence length (bp)813
Protein length (aa) 271

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00018 SH3_1 SH3 domain 7.0E-14 131 177
PF14604 SH3_9 Variant SH3 domain 5.6E-11 132 181
PF07653 SH3_2 Variant SH3 domain 1.5E-10 129 183

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43125|CSH3_SCHPO Protein csh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csh3 PE=2 SV=1 13 270 3.0E-14
sp|Q06449|PIN3_YEAST [PSI+] inducibility protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIN3 PE=1 SV=1 121 270 5.0E-14
sp|Q1E878|HSE1_COCIM Class E vacuolar protein-sorting machinery protein HSE1 OS=Coccidioides immitis (strain RS) GN=HSE1 PE=3 SV=1 111 186 9.0E-10
sp|Q8K3E5|AHI1_MOUSE Jouberin OS=Mus musculus GN=Ahi1 PE=1 SV=2 132 220 1.0E-09
sp|P00528|SRC64_DROME Tyrosine-protein kinase Src64B OS=Drosophila melanogaster GN=Src64B PE=1 SV=3 113 184 3.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43125|CSH3_SCHPO Protein csh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csh3 PE=2 SV=1 13 270 3.0E-14
sp|Q06449|PIN3_YEAST [PSI+] inducibility protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIN3 PE=1 SV=1 121 270 5.0E-14
sp|Q1E878|HSE1_COCIM Class E vacuolar protein-sorting machinery protein HSE1 OS=Coccidioides immitis (strain RS) GN=HSE1 PE=3 SV=1 111 186 9.0E-10
sp|Q8K3E5|AHI1_MOUSE Jouberin OS=Mus musculus GN=Ahi1 PE=1 SV=2 132 220 1.0E-09
sp|P00528|SRC64_DROME Tyrosine-protein kinase Src64B OS=Drosophila melanogaster GN=Src64B PE=1 SV=3 113 184 3.0E-09
sp|Q5BBL4|HSE1_EMENI Class E vacuolar protein-sorting machinery protein hse1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hse1 PE=3 SV=1 93 181 7.0E-09
sp|Q7S6J4|HSE1_NEUCR Class E vacuolar protein-sorting machinery protein hse1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hse1 PE=3 SV=1 111 189 1.0E-08
sp|A1CEK6|HSE1_ASPCL Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hse1 PE=3 SV=1 115 181 2.0E-08
sp|Q5A895|HSE1_CANAL Class E vacuolar protein-sorting machinery protein HSE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSE1 PE=3 SV=1 89 181 2.0E-08
sp|P38479|ABP1_SACEX Actin-binding protein OS=Saccharomyces exiguus GN=ABP1 PE=3 SV=1 130 182 3.0E-08
sp|Q2GT05|HSE1_CHAGB Class E vacuolar protein-sorting machinery protein HSE1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HSE1 PE=3 SV=1 118 189 3.0E-08
sp|A2QW93|HSE1_ASPNC Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hse1 PE=3 SV=1 117 181 4.0E-08
sp|Q0CJU8|HSE1_ASPTN Class E vacuolar protein-sorting machinery protein hse1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hse1 PE=3 SV=1 117 181 5.0E-08
sp|A3LXQ8|HSE1_PICST Class E vacuolar protein-sorting machinery protein HSE1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HSE1 PE=3 SV=2 96 181 1.0E-07
sp|A4RF61|HSE1_MAGO7 Class E vacuolar protein-sorting machinery protein HSE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HSE1 PE=3 SV=2 127 189 1.0E-07
sp|Q6C2N2|HSE1_YARLI Class E vacuolar protein-sorting machinery protein HSE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HSE1 PE=3 SV=1 126 182 1.0E-07
sp|Q4WHP5|HSE1_ASPFU Class E vacuolar protein-sorting machinery protein hse1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hse1 PE=3 SV=1 126 181 1.0E-07
sp|Q6CVA8|HSE1_KLULA Class E vacuolar protein-sorting machinery protein HSE1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HSE1 PE=3 SV=1 126 181 2.0E-07
sp|A1DFN5|HSE1_NEOFI Class E vacuolar protein-sorting machinery protein hse1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hse1 PE=3 SV=1 126 181 2.0E-07
sp|P15891|ABP1_YEAST Actin-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ABP1 PE=1 SV=4 130 181 2.0E-07
sp|Q6DTM3|AHI1_RAT Jouberin OS=Rattus norvegicus GN=Ahi1 PE=1 SV=1 132 206 3.0E-07
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 108 189 5.0E-07
sp|Q9WVE9|ITSN1_RAT Intersectin-1 OS=Rattus norvegicus GN=Itsn1 PE=1 SV=1 108 189 5.0E-07
sp|P38753|HSE1_YEAST Class E vacuolar protein-sorting machinery protein HSE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSE1 PE=1 SV=1 123 181 6.0E-07
sp|Q75DS3|HSE1_ASHGO Class E vacuolar protein-sorting machinery protein HSE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HSE1 PE=3 SV=1 117 181 6.0E-07
sp|Q0U6X7|HSE1_PHANO Class E vacuolar protein-sorting machinery protein HSE1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HSE1 PE=3 SV=1 126 186 9.0E-07
sp|Q6FN49|HSE1_CANGA Class E vacuolar protein-sorting machinery protein HSE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HSE1 PE=3 SV=1 127 181 1.0E-06
sp|O14259|SFP47_SCHPO Ubp4-interactor sfp47 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sfp47 PE=1 SV=2 125 187 1.0E-06
sp|Q6BNP6|HSE1_DEBHA Class E vacuolar protein-sorting machinery protein HSE1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HSE1 PE=3 SV=2 106 181 2.0E-06
sp|Q01621|LCK_RAT Proto-oncogene tyrosine-protein kinase LCK OS=Rattus norvegicus GN=Lck PE=1 SV=3 85 191 2.0E-06
sp|Q8N157|AHI1_HUMAN Jouberin OS=Homo sapiens GN=AHI1 PE=1 SV=1 132 206 2.0E-06
sp|P42522|MYOC_DICDI Myosin IC heavy chain OS=Dictyostelium discoideum GN=myoC PE=3 SV=2 132 181 2.0E-06
sp|Q91X43|SH319_MOUSE SH3 domain-containing protein 19 OS=Mus musculus GN=Sh3d19 PE=1 SV=2 116 181 3.0E-06
sp|O43639|NCK2_HUMAN Cytoplasmic protein NCK2 OS=Homo sapiens GN=NCK2 PE=1 SV=2 96 201 4.0E-06
sp|Q5PXS1|LCK_AOTNA Tyrosine-protein kinase Lck OS=Aotus nancymaae GN=LCK PE=2 SV=4 99 191 5.0E-06
sp|P00524|SRC_RSVSA Tyrosine-protein kinase transforming protein Src OS=Avian leukosis virus RSA GN=V-SRC PE=1 SV=5 132 181 7.0E-06
sp|P00525|SRC_AVISR Tyrosine-protein kinase transforming protein Src OS=Avian sarcoma virus (strain rASV1441) GN=V-SRC PE=1 SV=3 132 181 7.0E-06
sp|Q9WUD9|SRC_RAT Proto-oncogene tyrosine-protein kinase Src OS=Rattus norvegicus GN=Src PE=1 SV=4 132 181 8.0E-06
sp|P12931|SRC_HUMAN Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens GN=SRC PE=1 SV=3 132 181 8.0E-06
sp|P00523|SRC_CHICK Proto-oncogene tyrosine-protein kinase Src OS=Gallus gallus GN=SRC PE=1 SV=4 132 181 8.0E-06
sp|A1A5H8|YES_DANRE Tyrosine-protein kinase yes OS=Danio rerio GN=yes1 PE=1 SV=1 127 181 9.0E-06
sp|Q1JPZ3|SRC_DANRE Proto-oncogene tyrosine-protein kinase Src OS=Danio rerio GN=src PE=1 SV=2 132 181 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3707
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5054
Ophiocordyceps australis map64 (Brazil) OphauB2|7452 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06235
Ophiocordyceps camponoti-rufipedis Ophun1|5423
Ophiocordyceps kimflemingae Ophio5|2109
Ophiocordyceps subramaniannii Hirsu2|7215

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7452
MASADRHTIMETNRSLRNIKTELENLLEKGVIDEAVFDTIHSALPQESPLSGPLRTATASSKSTSSHIGAAASPE
PAHASPSNALPTQAMQNLNVRETGSKAASPAPPGYEETPPPGLPSRNAKPVIAHARALYRYGASDARDLSFERDD
KIAVYERMNQDWWMGQNLRTGQEGIFPRNYVLEEADYKPPPGPMYAQPQYGYNGPPPQQNPYNAPVPPMAVAEGG
QQPPPNDGGDNKVGQYGKKFGKKLGNAAIFGAGASIGSNIVNSIF*
Coding >OphauB2|7452
ATGGCATCGGCCGACCGTCACACAATCATGGAGACCAACCGGTCACTCCGCAACATCAAAACTGAACTCGAGAAC
CTACTTGAAAAGGGGGTCATTGACGAGGCAGTTTTCGACACGATTCATTCTGCCCTGCCACAAGAATCTCCGCTT
TCGGGTCCTCTTCGCACCGCGACAGCATCTAGCAAGTCGACAAGCAGCCACATTGGTGCTGCAGCATCGCCAGAG
CCTGCACATGCCAGCCCCTCGAATGCTCTGCCAACTCAGGCCATGCAGAATCTCAACGTTCGCGAGACGGGAAGC
AAGGCGGCATCTCCTGCTCCGCCTGGATACGAGGAGACGCCGCCGCCGGGCCTGCCAAGTCGCAATGCAAAGCCC
GTCATTGCCCACGCCCGCGCGCTTTATCGATATGGCGCCTCGGACGCTCGCGATCTTTCCTTTGAGCGCGACGAC
AAGATTGCCGTGTACGAGCGCATGAACCAGGACTGGTGGATGGGACAGAATCTGCGCACCGGACAAGAGGGCATC
TTTCCGCGCAACTACGTCCTTGAAGAGGCCGATTACAAGCCACCACCGGGGCCCATGTACGCGCAGCCACAGTAT
GGCTACAATGGTCCACCACCCCAGCAAAATCCTTACAACGCCCCCGTACCGCCCATGGCCGTGGCTGAAGGCGGC
CAGCAGCCACCACCAAACGATGGAGGAGACAACAAGGTTGGCCAATACGGCAAGAAATTTGGCAAGAAGTTGGGC
AACGCAGCCATTTTTGGTGCGGGTGCTTCTATCGGCAGCAATATTGTCAATAGCATCTTTTGA
Transcript >OphauB2|7452
ATGGCATCGGCCGACCGTCACACAATCATGGAGACCAACCGGTCACTCCGCAACATCAAAACTGAACTCGAGAAC
CTACTTGAAAAGGGGGTCATTGACGAGGCAGTTTTCGACACGATTCATTCTGCCCTGCCACAAGAATCTCCGCTT
TCGGGTCCTCTTCGCACCGCGACAGCATCTAGCAAGTCGACAAGCAGCCACATTGGTGCTGCAGCATCGCCAGAG
CCTGCACATGCCAGCCCCTCGAATGCTCTGCCAACTCAGGCCATGCAGAATCTCAACGTTCGCGAGACGGGAAGC
AAGGCGGCATCTCCTGCTCCGCCTGGATACGAGGAGACGCCGCCGCCGGGCCTGCCAAGTCGCAATGCAAAGCCC
GTCATTGCCCACGCCCGCGCGCTTTATCGATATGGCGCCTCGGACGCTCGCGATCTTTCCTTTGAGCGCGACGAC
AAGATTGCCGTGTACGAGCGCATGAACCAGGACTGGTGGATGGGACAGAATCTGCGCACCGGACAAGAGGGCATC
TTTCCGCGCAACTACGTCCTTGAAGAGGCCGATTACAAGCCACCACCGGGGCCCATGTACGCGCAGCCACAGTAT
GGCTACAATGGTCCACCACCCCAGCAAAATCCTTACAACGCCCCCGTACCGCCCATGGCCGTGGCTGAAGGCGGC
CAGCAGCCACCACCAAACGATGGAGGAGACAACAAGGTTGGCCAATACGGCAAGAAATTTGGCAAGAAGTTGGGC
AACGCAGCCATTTTTGGTGCGGGTGCTTCTATCGGCAGCAATATTGTCAATAGCATCTTTTGA
Gene >OphauB2|7452
ATGGCATCGGCCGACCGTCACACAATCATGGAGACCAACCGGTCACTCCGCAACATCAAAACTGTGAGAGTTTTT
TCTGAGGCGTCGAGGTAATAATGACTGACTGTCTCCATGTCGCAGGAACTCGAGAACCTACTTGAAAAGGGGGTC
ATTGACGAGGCAGTTTTCGACACGATTCATTCTGCCCTGCCACAAGAATCTCCGCTTTCGGGTCCTCTTCGCACC
GCGACAGCATCTAGCAAGTCGACAAGCAGCCACATTGGTGCTGCAGCATCGCCAGAGCCTGCACATGCCAGCCCC
TCGAATGCTCTGCCAACTCAGGCCATGCAGAATCTCAACGTTCGCGAGACGGGAAGCAAGGCGGCATCTCCTGCT
CCGCCTGGATACGAGGAGACGCCGCCGCCGGGCCTGCCAAGTCGCAATGCAAAGCCCGTCATTGCCCACGCCCGC
GCGCTTTATCGATATGGCGCCTCGGACGCTCGCGATCTTTCCTTTGAGCGCGACGACAAGATTGCCGTGTACGAG
CGCATGAACCAGGACTGGTGGATGGGACAGAATCTGCGCACCGGACAAGAGGGCATCTTTCCGCGCAACTACGTC
CTTGAAGAGGCCGATTACAAGCCACCACCGGGGCCCATGTACGCGCAGCCACAGTATGGCTACAATGGTCCACCA
CCCCAGCAAAATCCTTACAACGCCCCCGTACCGCCCATGGCCGTGGCTGAAGGCGGCCAGCAGCCACCACCAAAC
GATGGAGGAGACAACAAGGTTGGCCAATACGGCAAGAAATTTGGCAAGAAGTTGGGCAACGCAGCCATTTTTGGT
GCGGGTGCTTCTATCGGCAGCAATATTGTCAATAGCATCTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail