Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7450
Gene name
LocationContig_8:159514..161290
Strand+
Gene length (bp)1776
Transcript length (bp)1650
Coding sequence length (bp)1650
Protein length (aa) 550

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03972 MmgE_PrpD MmgE/PrpD N-terminal domain 5.9E-86 71 327
PF19305 MmgE_PrpD_C MmgE/PrpD C-terminal domain 1.5E-46 344 521

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C354|PRPD_YARLI 2-methylcitrate dehydratase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PDH1 PE=1 SV=1 66 544 0.0E+00
sp|P77243|PRPD_ECOLI 2-methylcitrate dehydratase OS=Escherichia coli (strain K12) GN=prpD PE=1 SV=3 64 543 0.0E+00
sp|Q8X693|PRPD_ECO57 2-methylcitrate dehydratase OS=Escherichia coli O157:H7 GN=prpD PE=3 SV=3 64 543 0.0E+00
sp|P74840|PRPD_SALTY 2-methylcitrate dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prpD PE=1 SV=2 65 543 0.0E+00
sp|Q937N6|PRPD_CUPNE 2-methylcitrate dehydratase OS=Cupriavidus necator GN=prpD PE=3 SV=1 57 543 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C354|PRPD_YARLI 2-methylcitrate dehydratase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PDH1 PE=1 SV=1 66 544 0.0E+00
sp|P77243|PRPD_ECOLI 2-methylcitrate dehydratase OS=Escherichia coli (strain K12) GN=prpD PE=1 SV=3 64 543 0.0E+00
sp|Q8X693|PRPD_ECO57 2-methylcitrate dehydratase OS=Escherichia coli O157:H7 GN=prpD PE=3 SV=3 64 543 0.0E+00
sp|P74840|PRPD_SALTY 2-methylcitrate dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prpD PE=1 SV=2 65 543 0.0E+00
sp|Q937N6|PRPD_CUPNE 2-methylcitrate dehydratase OS=Cupriavidus necator GN=prpD PE=3 SV=1 57 543 0.0E+00
sp|Q8Z903|PRPD_SALTI 2-methylcitrate dehydratase OS=Salmonella typhi GN=prpD PE=3 SV=1 65 543 0.0E+00
sp|Q12428|PRPD_YEAST Probable 2-methylcitrate dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDH1 PE=1 SV=1 53 541 0.0E+00
sp|P45859|PRPD_BACSU 2-methylcitrate dehydratase OS=Bacillus subtilis (strain 168) GN=prpD PE=2 SV=3 66 543 0.0E+00
sp|Q54IJ0|PRPD_DICDI Probable 2-methylcitrate dehydratase OS=Dictyostelium discoideum GN=prpD PE=2 SV=1 64 543 2.0E-149
sp|Q8NSH9|PRPD1_CORGL 2-methylcitrate dehydratase 1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=prpD1 PE=3 SV=1 125 489 3.0E-23
sp|Q8NSL3|PRPD2_CORGL 2-methylcitrate dehydratase 2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=prpD2 PE=2 SV=1 126 489 3.0E-19
sp|H8F0D6|PRPD_MYCTE 2-methylcitrate dehydratase OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=ERDMAN_1266 PE=1 SV=1 123 489 7.0E-17
sp|O06582|PRPD_MYCTU 2-methylcitrate dehydratase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=prpD PE=1 SV=1 123 489 7.0E-17
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7450
MSAARQSLRAASKHLRLASPIAFARCVPLTAAPRPNSHPSAGSPFSTLAPRRSGASTMARQAAQYDAEISDIASY
VANYKIDSQLAFDTARWVFLDTLGCGLEGLRFKECSKLLGPIVPGTIVPNGTKVPGTPFVLDPVNGAFNIGAMIR
WLDFNDCWLAAEWGHPSDNLGAILAVADWVNRTNKAGGTLAGGRLFTIRDVLEAMIKAHEIQGCLALLNSFNRVG
LDHVVLVKVASTAVVAKMLNLGQTQIADAVTQAWADGQSLRTYRHSPNTMSRKSWAAGDACQRAVNLALKVMKGE
QGIPTVLSAPVWGFYDVLFKGKKFEFQRPYGSYVMENVLFKVSYPAEFHSQTAVEASEKIHHQLKSMGKTAADIK
AITCRTHEACMRIIDKQFKPMDNFADRDHCIQYMCSVMLVFGRLEATDYVDGSEAATSELVDSLRKKIKCVEDAQ
YTKDYHDPKLRTISNALTVELNDGTKLDEVAVEAPLGHRLRREEAKPIILAKYKRHLGPHFSDAKVKELVELGVD
SKRLESMAVDDYVDMYAVKQSRFL*
Coding >OphauB2|7450
ATGTCTGCTGCCCGCCAAAGCCTGCGCGCCGCCTCGAAGCATCTGCGTTTGGCCTCGCCCATTGCCTTTGCTCGC
TGTGTCCCGCTGACAGCTGCTCCGCGGCCCAATTCGCATCCCTCGGCCGGCTCGCCCTTTTCAACACTTGCCCCC
CGCCGGTCAGGAGCTTCCACCATGGCTCGGCAAGCTGCCCAGTACGATGCCGAGATCAGCGACATTGCTAGCTAC
GTGGCCAATTACAAAATCGACTCTCAATTGGCCTTCGACACTGCCCGATGGGTCTTTCTCGATACCCTCGGCTGC
GGCCTCGAGGGCCTGCGCTTCAAGGAGTGCTCCAAGCTGCTTGGCCCAATAGTCCCTGGCACCATAGTTCCCAAC
GGGACCAAGGTTCCCGGCACCCCCTTTGTCCTCGATCCTGTCAACGGCGCCTTCAACATTGGCGCCATGATCCGC
TGGCTCGACTTCAACGACTGCTGGCTCGCAGCTGAATGGGGCCACCCCTCGGACAACTTGGGCGCCATCCTAGCC
GTTGCCGACTGGGTCAATCGCACCAACAAGGCCGGCGGAACCCTTGCTGGTGGGCGCCTCTTTACCATTCGTGAC
GTGCTCGAGGCCATGATCAAGGCACATGAGATTCAGGGCTGTCTTGCCTTGCTCAATTCCTTCAATCGCGTTGGC
CTCGATCATGTGGTGCTCGTCAAGGTGGCCAGTACTGCCGTAGTCGCAAAAATGCTCAACCTCGGCCAGACCCAG
ATAGCCGACGCTGTCACCCAGGCTTGGGCTGATGGCCAGAGCCTGCGCACCTATCGCCACTCTCCCAACACCATG
TCTCGGAAATCATGGGCTGCTGGCGATGCCTGCCAGCGCGCCGTCAATCTAGCCCTCAAGGTGATGAAGGGCGAG
CAGGGCATCCCCACCGTCCTCTCCGCTCCCGTTTGGGGCTTTTACGACGTGCTCTTCAAGGGCAAGAAATTTGAG
TTTCAACGCCCCTACGGCAGTTATGTCATGGAAAATGTTCTCTTCAAAGTTTCCTACCCAGCCGAATTTCATTCC
CAGACTGCTGTGGAAGCTTCTGAGAAGATTCATCACCAGCTCAAGTCCATGGGCAAGACTGCTGCTGACATCAAG
GCCATCACCTGCCGTACTCACGAGGCCTGCATGCGCATCATTGATAAGCAATTCAAGCCAATGGACAACTTTGCT
GACCGCGACCATTGCATCCAATACATGTGCTCTGTCATGCTAGTCTTTGGGCGCCTCGAGGCCACGGATTATGTC
GATGGCAGTGAAGCGGCTACGTCGGAGCTTGTCGACTCGCTACGAAAGAAGATCAAGTGCGTTGAAGATGCTCAG
TACACCAAGGATTATCATGACCCCAAGCTGCGAACCATTTCCAATGCCTTGACGGTTGAGCTCAATGACGGTACT
AAGCTTGACGAGGTGGCTGTCGAGGCGCCTTTGGGCCATCGCCTACGGCGCGAGGAAGCAAAGCCCATCATCCTC
GCCAAGTATAAGCGTCACCTGGGGCCACACTTCTCCGACGCCAAGGTTAAGGAGCTTGTTGAGCTGGGCGTTGAT
AGCAAGCGTCTCGAGTCCATGGCGGTAGACGACTATGTCGACATGTATGCTGTCAAGCAAAGTCGCTTCTTGTAA
Transcript >OphauB2|7450
ATGTCTGCTGCCCGCCAAAGCCTGCGCGCCGCCTCGAAGCATCTGCGTTTGGCCTCGCCCATTGCCTTTGCTCGC
TGTGTCCCGCTGACAGCTGCTCCGCGGCCCAATTCGCATCCCTCGGCCGGCTCGCCCTTTTCAACACTTGCCCCC
CGCCGGTCAGGAGCTTCCACCATGGCTCGGCAAGCTGCCCAGTACGATGCCGAGATCAGCGACATTGCTAGCTAC
GTGGCCAATTACAAAATCGACTCTCAATTGGCCTTCGACACTGCCCGATGGGTCTTTCTCGATACCCTCGGCTGC
GGCCTCGAGGGCCTGCGCTTCAAGGAGTGCTCCAAGCTGCTTGGCCCAATAGTCCCTGGCACCATAGTTCCCAAC
GGGACCAAGGTTCCCGGCACCCCCTTTGTCCTCGATCCTGTCAACGGCGCCTTCAACATTGGCGCCATGATCCGC
TGGCTCGACTTCAACGACTGCTGGCTCGCAGCTGAATGGGGCCACCCCTCGGACAACTTGGGCGCCATCCTAGCC
GTTGCCGACTGGGTCAATCGCACCAACAAGGCCGGCGGAACCCTTGCTGGTGGGCGCCTCTTTACCATTCGTGAC
GTGCTCGAGGCCATGATCAAGGCACATGAGATTCAGGGCTGTCTTGCCTTGCTCAATTCCTTCAATCGCGTTGGC
CTCGATCATGTGGTGCTCGTCAAGGTGGCCAGTACTGCCGTAGTCGCAAAAATGCTCAACCTCGGCCAGACCCAG
ATAGCCGACGCTGTCACCCAGGCTTGGGCTGATGGCCAGAGCCTGCGCACCTATCGCCACTCTCCCAACACCATG
TCTCGGAAATCATGGGCTGCTGGCGATGCCTGCCAGCGCGCCGTCAATCTAGCCCTCAAGGTGATGAAGGGCGAG
CAGGGCATCCCCACCGTCCTCTCCGCTCCCGTTTGGGGCTTTTACGACGTGCTCTTCAAGGGCAAGAAATTTGAG
TTTCAACGCCCCTACGGCAGTTATGTCATGGAAAATGTTCTCTTCAAAGTTTCCTACCCAGCCGAATTTCATTCC
CAGACTGCTGTGGAAGCTTCTGAGAAGATTCATCACCAGCTCAAGTCCATGGGCAAGACTGCTGCTGACATCAAG
GCCATCACCTGCCGTACTCACGAGGCCTGCATGCGCATCATTGATAAGCAATTCAAGCCAATGGACAACTTTGCT
GACCGCGACCATTGCATCCAATACATGTGCTCTGTCATGCTAGTCTTTGGGCGCCTCGAGGCCACGGATTATGTC
GATGGCAGTGAAGCGGCTACGTCGGAGCTTGTCGACTCGCTACGAAAGAAGATCAAGTGCGTTGAAGATGCTCAG
TACACCAAGGATTATCATGACCCCAAGCTGCGAACCATTTCCAATGCCTTGACGGTTGAGCTCAATGACGGTACT
AAGCTTGACGAGGTGGCTGTCGAGGCGCCTTTGGGCCATCGCCTACGGCGCGAGGAAGCAAAGCCCATCATCCTC
GCCAAGTATAAGCGTCACCTGGGGCCACACTTCTCCGACGCCAAGGTTAAGGAGCTTGTTGAGCTGGGCGTTGAT
AGCAAGCGTCTCGAGTCCATGGCGGTAGACGACTATGTCGACATGTATGCTGTCAAGCAAAGTCGCTTCTTGTAA
Gene >OphauB2|7450
ATGTCTGCTGCCCGCCAAAGCCTGCGCGCCGCCTCGAAGCATCTGCGTTTGGCCTCGCCCATTGCCTTTGCTCGC
TGTGTCCCGCTGACAGCTGCTCCGCGGCCCAATTCGCATCCCTCGGCCGGCTCGCCCTTTTCAACACTTGCCCCC
CGCCGGTCAGGAGCTTCCACCATGGCTCGGCAAGCTGCCCAGTACGATGCCGAGATCAGCGACATTGCTAGCTAC
GTGGCCAATTACAAAATCGACTCTCAATTGGCCGTCAGTCGCCCCCGCGTTTTGGGCGCGCTCAAGAGCCTCGCC
TTGCCCTTGCTGACCCCGCCGCTGTCTAGTTCGACACTGCCCGATGGGTCTTTCTCGATACCCTCGGCTGCGGCC
TCGAGGGCCTGCGCTTCAAGGAGTGCTCCAAGCTGCTTGGCCCAATAGTCCCTGGCACCATAGTTCCCAACGGGA
CCAAGGTTCCCGGCACCCCCTTTGTCCTCGATCCTGTCAACGGCGCCTTCAACATTGGCGCCATGATCCGCTGGC
TCGACTTCAACGACTGCTGGCTCGCAGCTGAATGGGGCCACCCCTCGGACAACTTGGGCGCCATCCTAGCCGTTG
CCGACTGGGTCAATCGCACCAACAAGGCCGGCGGAACCCTTGCTGGTGGGCGCCTCTTTACCATTCGTGACGTGC
TCGAGGCCATGATCAAGGCACATGAGATTCAGGGCTGTCTTGCCTTGCTCAATTCCTTCAATCGCGTTGGCCTCG
ATCATGTGGTGCTCGTCAAGGTGGCCAGTACTGCCGTAGTCGCAAAAATGCTCAACCTCGGCCAGACCCAGATAG
CCGACGCTGTCACCCAGGCTTGGGCTGATGGCCAGAGCCTGCGCACCTATCGCCACTCTCCCAACACCATGTCTC
GGAAATCATGGGCTGCTGGCGATGCCTGCCAGCGCGCCGTCAATCTAGCCCTCAAGGTGATGAAGGGCGAGCAGG
GCATCCCCACCGTCCTCTCCGCTCCCGTTTGGGGCTTTTACGACGTGCTCTTCAAGGGCAAGAAATTTGAGTTTC
AACGCCCCTACGGCAGTTATGTCATGGAAAATGTTCTCTTCAAAGTTTCCTACCCAGGTATGTCTGCTGCCTCCA
CCTGCAACGTCACTCGACAGCTCACAAGTCTCTGCAGCCGAATTTCATTCCCAGACTGCTGTGGAAGCTTCTGAG
AAGATTCATCACCAGCTCAAGTCCATGGGCAAGACTGCTGCTGACATCAAGGCCATCACCTGCCGTACTCACGAG
GCCTGCATGCGCATCATTGATAAGCAATTCAAGCCAATGGACAACTTTGCTGACCGCGACCATTGCATCCAATAC
ATGTGCTCTGTCATGCTAGTCTTTGGGCGCCTCGAGGCCACGGATTATGTCGATGGCAGTGAAGCGGCTACGTCG
GAGCTTGTCGACTCGCTACGAAAGAAGATCAAGTGCGTTGAAGATGCTCAGTACACCAAGGATTATCATGACCCC
AAGCTGCGAACCATTTCCAATGCCTTGACGGTTGAGCTCAATGACGGTACTAAGCTTGACGAGGTGGCTGTCGAG
GCGCCTTTGGGCCATCGCCTACGGCGCGAGGAAGCAAAGCCCATCATCCTCGCCAAGTATAAGCGTCACCTGGGG
CCACACTTCTCCGACGCCAAGGTTAAGGAGCTTGTTGAGCTGGGCGTTGATAGCAAGCGTCTCGAGTCCATGGCG
GTAGACGACTATGTCGACATGTATGCTGTCAAGCAAAGTCGCTTCTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail