Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7444
Gene name
LocationContig_8:138742..142206
Strand-
Gene length (bp)3464
Transcript length (bp)3213
Coding sequence length (bp)3213
Protein length (aa) 1071

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01391 Collagen Collagen triple helix repeat (20 copies) 1.7E-09 557 615
PF01391 Collagen Collagen triple helix repeat (20 copies) 2.0E-07 614 666
PF01391 Collagen Collagen triple helix repeat (20 copies) 2.7E-09 665 723
PF01391 Collagen Collagen triple helix repeat (20 copies) 1.5E-09 787 845
PF01391 Collagen Collagen triple helix repeat (20 copies) 4.5E-08 838 891
PF01391 Collagen Collagen triple helix repeat (20 copies) 3.9E-07 898 949
PF01391 Collagen Collagen triple helix repeat (20 copies) 3.3E-07 946 998
PF01391 Collagen Collagen triple helix repeat (20 copies) 2.3E-09 997 1055

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 560 1059 9.0E-72
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 557 1046 1.0E-71
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 555 1056 4.0E-70
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 555 1059 3.0E-68
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 549 1055 5.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 560 1059 9.0E-72
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 557 1046 1.0E-71
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 555 1056 4.0E-70
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 555 1059 3.0E-68
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 549 1055 5.0E-66
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 557 1060 8.0E-64
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 555 1057 3.0E-63
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 555 1059 4.0E-63
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 558 1056 5.0E-63
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 555 1055 8.0E-63
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 552 1058 1.0E-60
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 555 1054 4.0E-60
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 557 1057 5.0E-60
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 557 1049 5.0E-60
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 544 1054 4.0E-59
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 554 1001 2.0E-57
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 555 1058 5.0E-57
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 555 1058 1.0E-56
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 555 1058 2.0E-55
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 555 1031 2.0E-55
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 557 1055 7.0E-55
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 555 1055 4.0E-53
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 557 1059 1.0E-52
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 555 1055 5.0E-52
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 545 1056 6.0E-52
sp|Q96P44|COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens GN=COL21A1 PE=2 SV=1 786 1055 1.0E-51
sp|Q96P44|COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens GN=COL21A1 PE=2 SV=1 785 1055 3.0E-51
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 555 1056 3.0E-51
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 557 1048 4.0E-51
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 553 1059 5.0E-51
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 558 1061 6.0E-51
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 518 1062 3.0E-50
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 553 1059 4.0E-50
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 560 1059 2.0E-49
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 533 1051 2.0E-49
sp|Q96P44|COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens GN=COL21A1 PE=2 SV=1 628 979 8.0E-49
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 526 1018 4.0E-48
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 575 1057 4.0E-47
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 563 1054 7.0E-47
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 550 1034 1.0E-46
sp|Q5UPS7|COLL4_MIMIV Collagen-like protein 4 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R240 PE=4 SV=1 556 987 2.0E-46
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 561 1061 2.0E-46
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 544 1056 4.0E-46
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 543 1058 4.0E-46
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 555 1059 6.0E-46
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 550 1054 2.0E-45
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 636 1057 5.0E-45
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 630 1057 6.0E-45
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 556 1046 1.0E-44
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 552 1056 1.0E-44
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 558 1022 2.0E-44
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 560 1055 2.0E-44
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 557 1058 2.0E-44
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 560 1059 3.0E-44
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 635 1058 3.0E-44
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 630 1056 4.0E-44
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 566 1055 5.0E-44
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 544 1056 5.0E-44
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 555 1015 6.0E-44
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 593 1055 1.0E-43
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 563 1055 1.0E-43
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 569 1068 2.0E-43
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 555 1062 4.0E-43
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 555 1055 5.0E-43
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 544 1061 6.0E-43
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 545 1064 6.0E-43
sp|Q96P44|COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens GN=COL21A1 PE=2 SV=1 786 1036 1.0E-42
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 555 1057 1.0E-42
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 555 1057 2.0E-42
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 552 1055 9.0E-42
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 557 1036 2.0E-41
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 556 1055 6.0E-41
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 786 1055 6.0E-41
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 557 1056 1.0E-40
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 544 1062 1.0E-40
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 544 1059 2.0E-40
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 557 1048 2.0E-40
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 557 1055 2.0E-40
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 787 1056 3.0E-40
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 552 1051 3.0E-40
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 548 1055 4.0E-40
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 557 1056 6.0E-40
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 593 1056 1.0E-39
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 786 1059 2.0E-39
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 786 1054 2.0E-39
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 545 997 4.0E-39
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 541 1059 4.0E-39
sp|Q96P44|COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens GN=COL21A1 PE=2 SV=1 552 874 1.0E-38
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 543 1012 1.0E-38
sp|A8TX70|CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens GN=COL6A5 PE=1 SV=1 785 1054 1.0E-38
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 599 1055 4.0E-38
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 552 1051 9.0E-38
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 793 1064 1.0E-37
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 557 1051 1.0E-37
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 563 1058 1.0E-37
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 556 1056 1.0E-37
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 486 1046 1.0E-37
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 548 1056 2.0E-37
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 544 1056 5.0E-37
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 555 1051 5.0E-37
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 550 1054 9.0E-37
sp|A8TX70|CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens GN=COL6A5 PE=1 SV=1 785 1050 1.0E-36
sp|A2AX52|CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus GN=Col6a4 PE=1 SV=2 787 1054 2.0E-36
sp|Q641F3|COLA1_XENLA Collagen alpha-1(XXI) chain OS=Xenopus laevis GN=col21a1 PE=2 SV=1 555 1007 2.0E-36
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 569 1054 2.0E-36
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 649 1059 4.0E-36
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 785 1054 4.0E-36
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 506 1056 7.0E-36
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 555 1055 7.0E-36
sp|Q641F3|COLA1_XENLA Collagen alpha-1(XXI) chain OS=Xenopus laevis GN=col21a1 PE=2 SV=1 785 1054 7.0E-36
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 786 1056 7.0E-36
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 612 1061 1.0E-35
sp|Q60754|MARCO_MOUSE Macrophage receptor MARCO OS=Mus musculus GN=Marco PE=1 SV=1 787 1049 1.0E-35
sp|A2AX52|CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus GN=Col6a4 PE=1 SV=2 787 1053 2.0E-35
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 551 1054 4.0E-35
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 557 1055 1.0E-34
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 786 1059 3.0E-34
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 787 1051 6.0E-34
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 545 886 7.0E-34
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 590 1036 8.0E-34
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 614 1054 9.0E-34
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 563 1056 1.0E-33
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 556 1054 1.0E-33
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 555 1049 2.0E-33
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 580 1055 3.0E-33
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 560 1054 3.0E-33
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 556 1055 3.0E-33
sp|Q641F3|COLA1_XENLA Collagen alpha-1(XXI) chain OS=Xenopus laevis GN=col21a1 PE=2 SV=1 787 1056 4.0E-33
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 561 1054 5.0E-33
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 785 1056 5.0E-33
sp|Q801S8|CO6A1_XENLA Collagen alpha-1(VI) chain OS=Xenopus laevis GN=col6a1 PE=1 SV=1 792 1051 6.0E-33
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 786 1058 7.0E-33
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 624 1055 7.0E-33
sp|Q8C6K9|CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus GN=Col6a6 PE=1 SV=2 785 1051 1.0E-32
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 783 1055 1.0E-32
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 552 1045 2.0E-32
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 560 1059 3.0E-32
sp|P20785|CO6A1_CHICK Collagen alpha-1(VI) chain OS=Gallus gallus GN=COL6A1 PE=2 SV=1 824 1058 3.0E-32
sp|P02457|CO1A1_CHICK Collagen alpha-1(I) chain OS=Gallus gallus GN=COL1A1 PE=1 SV=3 557 1059 4.0E-32
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 797 1049 4.0E-32
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 557 983 6.0E-32
sp|P20785|CO6A1_CHICK Collagen alpha-1(VI) chain OS=Gallus gallus GN=COL6A1 PE=2 SV=1 787 1019 6.0E-32
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 557 995 2.0E-31
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 594 1054 2.0E-31
sp|Q641F3|COLA1_XENLA Collagen alpha-1(XXI) chain OS=Xenopus laevis GN=col21a1 PE=2 SV=1 822 1059 2.0E-31
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 556 1046 2.0E-31
sp|P12110|CO6A2_HUMAN Collagen alpha-2(VI) chain OS=Homo sapiens GN=COL6A2 PE=1 SV=4 791 1049 2.0E-31
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 563 1057 3.0E-31
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 557 1059 3.0E-31
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 552 1062 3.0E-31
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 560 1052 4.0E-31
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 543 865 5.0E-31
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 796 1010 6.0E-31
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 557 1036 6.0E-31
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 811 1051 7.0E-31
sp|P02457|CO1A1_CHICK Collagen alpha-1(I) chain OS=Gallus gallus GN=COL1A1 PE=1 SV=3 544 1048 9.0E-31
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 555 1007 1.0E-30
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 787 1051 1.0E-30
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 563 1055 1.0E-30
sp|Q9WUB9|MARCO_MESAU Macrophage receptor MARCO OS=Mesocricetus auratus GN=MARCO PE=2 SV=1 815 1049 1.0E-30
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 785 1055 2.0E-30
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 557 1055 2.0E-30
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 787 1051 2.0E-30
sp|Q8CQD9|PLS_STAES Accumulation-associated protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0175 PE=3 SV=1 932 1063 2.0E-30
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 539 987 3.0E-30
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 557 1043 4.0E-30
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 552 1055 4.0E-30
sp|P15988|CO6A2_CHICK Collagen alpha-2(VI) chain OS=Gallus gallus GN=COL6A2 PE=2 SV=1 787 1055 4.0E-30
sp|A2AX52|CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus GN=Col6a4 PE=1 SV=2 820 1039 5.0E-30
sp|Q60754|MARCO_MOUSE Macrophage receptor MARCO OS=Mus musculus GN=Marco PE=1 SV=1 826 1055 5.0E-30
sp|Q60754|MARCO_MOUSE Macrophage receptor MARCO OS=Mus musculus GN=Marco PE=1 SV=1 815 1055 6.0E-30
sp|P12110|CO6A2_HUMAN Collagen alpha-2(VI) chain OS=Homo sapiens GN=COL6A2 PE=1 SV=4 785 1057 6.0E-30
sp|Q8CQD9|PLS_STAES Accumulation-associated protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0175 PE=3 SV=1 899 1025 6.0E-30
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 552 1029 1.0E-29
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 787 1042 1.0E-29
sp|P02457|CO1A1_CHICK Collagen alpha-1(I) chain OS=Gallus gallus GN=COL1A1 PE=1 SV=3 555 1046 1.0E-29
sp|Q8CQD9|PLS_STAES Accumulation-associated protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0175 PE=3 SV=1 598 719 1.0E-29
sp|Q05306|COAA1_MOUSE Collagen alpha-1(X) chain OS=Mus musculus GN=Col10a1 PE=2 SV=1 786 1056 1.0E-29
sp|Q8C6K9|CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus GN=Col6a6 PE=1 SV=2 791 1060 2.0E-29
sp|Q9WUB9|MARCO_MESAU Macrophage receptor MARCO OS=Mesocricetus auratus GN=MARCO PE=2 SV=1 803 1036 2.0E-29
sp|Q8CQD9|PLS_STAES Accumulation-associated protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0175 PE=3 SV=1 791 919 2.0E-29
sp|P23206|COAA1_BOVIN Collagen alpha-1(X) chain OS=Bos taurus GN=COL10A1 PE=2 SV=1 786 1031 2.0E-29
sp|Q96P44|COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens GN=COL21A1 PE=2 SV=1 546 726 3.0E-29
sp|Q641F3|COLA1_XENLA Collagen alpha-1(XXI) chain OS=Xenopus laevis GN=col21a1 PE=2 SV=1 786 1043 3.0E-29
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 787 1039 3.0E-29
sp|P12111|CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens GN=COL6A3 PE=1 SV=5 785 1056 4.0E-29
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 786 1039 5.0E-29
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 615 1054 5.0E-29
sp|Q8CQD9|PLS_STAES Accumulation-associated protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0175 PE=3 SV=1 913 1042 5.0E-29
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 557 1055 6.0E-29
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 793 1048 9.0E-29
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 560 959 1.0E-28
sp|A2AX52|CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus GN=Col6a4 PE=1 SV=2 847 1054 1.0E-28
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 786 1054 1.0E-28
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 793 1054 1.0E-28
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 560 1056 1.0E-28
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 787 1055 2.0E-28
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 793 1037 2.0E-28
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 801 1040 2.0E-28
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 791 1055 2.0E-28
sp|P02461|CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens GN=COL3A1 PE=1 SV=4 787 1048 2.0E-28
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 612 1052 3.0E-28
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 611 1048 3.0E-28
sp|Q9WUB9|MARCO_MESAU Macrophage receptor MARCO OS=Mesocricetus auratus GN=MARCO PE=2 SV=1 791 1012 3.0E-28
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 602 1034 3.0E-28
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 785 1056 4.0E-28
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 825 1054 4.0E-28
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 785 1058 5.0E-28
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 787 1059 6.0E-28
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 557 1058 6.0E-28
sp|Q8CQD9|PLS_STAES Accumulation-associated protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0175 PE=3 SV=1 789 911 7.0E-28
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 623 1055 9.0E-28
sp|P12109|CO6A1_HUMAN Collagen alpha-1(VI) chain OS=Homo sapiens GN=COL6A1 PE=1 SV=3 785 1051 9.0E-28
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 785 1051 1.0E-27
sp|Q641F3|COLA1_XENLA Collagen alpha-1(XXI) chain OS=Xenopus laevis GN=col21a1 PE=2 SV=1 790 1046 1.0E-27
sp|Q60754|MARCO_MOUSE Macrophage receptor MARCO OS=Mus musculus GN=Marco PE=1 SV=1 785 1016 1.0E-27
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 637 1043 1.0E-27
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 556 1031 1.0E-27
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 639 1058 1.0E-27
sp|Q8CQD9|PLS_STAES Accumulation-associated protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0175 PE=3 SV=1 561 687 1.0E-27
sp|Q02788|CO6A2_MOUSE Collagen alpha-2(VI) chain OS=Mus musculus GN=Col6a2 PE=1 SV=3 791 1039 1.0E-27
sp|P20849|CO9A1_HUMAN Collagen alpha-1(IX) chain OS=Homo sapiens GN=COL9A1 PE=1 SV=3 783 1055 1.0E-27
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 786 1054 2.0E-27
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 785 1058 2.0E-27
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 545 1055 2.0E-27
sp|P12110|CO6A2_HUMAN Collagen alpha-2(VI) chain OS=Homo sapiens GN=COL6A2 PE=1 SV=4 796 1056 2.0E-27
sp|Q9WUB9|MARCO_MESAU Macrophage receptor MARCO OS=Mesocricetus auratus GN=MARCO PE=2 SV=1 786 995 2.0E-27
sp|Q8CQD9|PLS_STAES Accumulation-associated protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0175 PE=3 SV=1 576 707 2.0E-27
sp|Q8CQD9|PLS_STAES Accumulation-associated protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0175 PE=3 SV=1 908 1033 2.0E-27
sp|P12111|CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens GN=COL6A3 PE=1 SV=5 793 1048 2.0E-27
sp|Q16992|LWA_ANTEL LWamide neuropeptides OS=Anthopleura elegantissima PE=1 SV=1 616 1055 2.0E-27
sp|Q8C6K9|CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus GN=Col6a6 PE=1 SV=2 796 1056 3.0E-27
sp|Q8NFW1|COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens GN=COL22A1 PE=2 SV=2 572 1055 3.0E-27
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 555 1022 4.0E-27
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 637 1043 4.0E-27
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 680 1055 5.0E-27
sp|P23206|COAA1_BOVIN Collagen alpha-1(X) chain OS=Bos taurus GN=COL10A1 PE=2 SV=1 815 1051 6.0E-27
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 552 1059 7.0E-27
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 556 1054 7.0E-27
sp|Q9WUB9|MARCO_MESAU Macrophage receptor MARCO OS=Mesocricetus auratus GN=MARCO PE=2 SV=1 782 997 8.0E-27
sp|P15989|CO6A3_CHICK Collagen alpha-3(VI) chain OS=Gallus gallus GN=COL6A3 PE=2 SV=2 793 1042 9.0E-27
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 785 1055 1.0E-26
sp|P20785|CO6A1_CHICK Collagen alpha-1(VI) chain OS=Gallus gallus GN=COL6A1 PE=2 SV=1 786 994 1.0E-26
sp|P15988|CO6A2_CHICK Collagen alpha-2(VI) chain OS=Gallus gallus GN=COL6A2 PE=2 SV=1 785 1025 1.0E-26
sp|Q28247|CO4A5_CANLF Collagen alpha-5(IV) chain OS=Canis lupus familiaris GN=COL4A5 PE=2 SV=2 787 1058 1.0E-26
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 793 1039 2.0E-26
sp|Q05306|COAA1_MOUSE Collagen alpha-1(X) chain OS=Mus musculus GN=Col10a1 PE=2 SV=1 796 1006 2.0E-26
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 556 1054 2.0E-26
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 787 1058 3.0E-26
sp|A8TX70|CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens GN=COL6A5 PE=1 SV=1 556 725 3.0E-26
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 556 1054 3.0E-26
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 811 1056 3.0E-26
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 778 1039 3.0E-26
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 544 1043 3.0E-26
sp|Q8CQD9|PLS_STAES Accumulation-associated protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0175 PE=3 SV=1 786 902 4.0E-26
sp|P12111|CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens GN=COL6A3 PE=1 SV=5 787 1042 4.0E-26
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 553 983 5.0E-26
sp|Q60754|MARCO_MOUSE Macrophage receptor MARCO OS=Mus musculus GN=Marco PE=1 SV=1 838 1056 5.0E-26
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 785 1055 5.0E-26
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 793 1033 6.0E-26
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 786 1060 6.0E-26
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 819 1056 8.0E-26
sp|Q02788|CO6A2_MOUSE Collagen alpha-2(VI) chain OS=Mus musculus GN=Col6a2 PE=1 SV=3 787 1045 8.0E-26
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 563 1051 8.0E-26
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 557 1052 9.0E-26
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 563 1051 9.0E-26
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 796 1059 1.0E-25
sp|Q02788|CO6A2_MOUSE Collagen alpha-2(VI) chain OS=Mus musculus GN=Col6a2 PE=1 SV=3 787 1057 1.0E-25
sp|Q99MQ5|COPA1_MOUSE Collagen alpha-1(XXV) chain OS=Mus musculus GN=Col25a1 PE=2 SV=2 785 1048 1.0E-25
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 786 1022 2.0E-25
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 787 1060 2.0E-25
sp|Q8CQD9|PLS_STAES Accumulation-associated protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0175 PE=3 SV=1 618 726 2.0E-25
sp|P08121|CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculus GN=Col3a1 PE=1 SV=4 778 1039 2.0E-25
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus GN=Nefh PE=1 SV=3 803 1053 2.0E-25
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 785 1054 3.0E-25
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 785 1051 3.0E-25
sp|Q8CQD9|PLS_STAES Accumulation-associated protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0175 PE=3 SV=1 786 904 3.0E-25
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 545 1055 3.0E-25
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 559 1048 4.0E-25
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 652 1022 5.0E-25
sp|P15989|CO6A3_CHICK Collagen alpha-3(VI) chain OS=Gallus gallus GN=COL6A3 PE=2 SV=2 802 1042 5.0E-25
sp|Q801S8|CO6A1_XENLA Collagen alpha-1(VI) chain OS=Xenopus laevis GN=col6a1 PE=1 SV=1 787 1033 6.0E-25
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 557 1054 6.0E-25
sp|Q04857|CO6A1_MOUSE Collagen alpha-1(VI) chain OS=Mus musculus GN=Col6a1 PE=1 SV=1 796 1051 6.0E-25
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 557 1045 8.0E-25
sp|Q04857|CO6A1_MOUSE Collagen alpha-1(VI) chain OS=Mus musculus GN=Col6a1 PE=1 SV=1 787 1059 9.0E-25
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 787 1056 1.0E-24
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 785 1058 1.0E-24
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 559 719 1.0E-24
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 840 1056 1.0E-24
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 645 985 1.0E-24
sp|Q05306|COAA1_MOUSE Collagen alpha-1(X) chain OS=Mus musculus GN=Col10a1 PE=2 SV=1 787 1024 1.0E-24
sp|Q02788|CO6A2_MOUSE Collagen alpha-2(VI) chain OS=Mus musculus GN=Col6a2 PE=1 SV=3 795 1054 1.0E-24
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 572 1049 1.0E-24
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 782 1054 2.0E-24
sp|Q60754|MARCO_MOUSE Macrophage receptor MARCO OS=Mus musculus GN=Marco PE=1 SV=1 591 914 2.0E-24
sp|P02461|CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens GN=COL3A1 PE=1 SV=4 835 1051 2.0E-24
sp|P15989|CO6A3_CHICK Collagen alpha-3(VI) chain OS=Gallus gallus GN=COL6A3 PE=2 SV=2 844 1054 2.0E-24
sp|P15989|CO6A3_CHICK Collagen alpha-3(VI) chain OS=Gallus gallus GN=COL6A3 PE=2 SV=2 823 1056 2.0E-24
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 787 1057 2.0E-24
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 787 1057 2.0E-24
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 566 1051 2.0E-24
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 556 1048 2.0E-24
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 850 1056 3.0E-24
sp|A2AX52|CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus GN=Col6a4 PE=1 SV=2 785 983 3.0E-24
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 652 1054 3.0E-24
sp|P02457|CO1A1_CHICK Collagen alpha-1(I) chain OS=Gallus gallus GN=COL1A1 PE=1 SV=3 793 1055 3.0E-24
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 818 1056 3.0E-24
sp|P08121|CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculus GN=Col3a1 PE=1 SV=4 836 1056 3.0E-24
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 787 1055 4.0E-24
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 787 1057 4.0E-24
sp|Q4ZJM7|OTOL1_MOUSE Otolin-1 OS=Mus musculus GN=Otol1 PE=1 SV=2 811 1030 4.0E-24
sp|Q9WUB9|MARCO_MESAU Macrophage receptor MARCO OS=Mesocricetus auratus GN=MARCO PE=2 SV=1 857 1055 5.0E-24
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus GN=Nefh PE=1 SV=3 764 1053 5.0E-24
sp|A6NMZ7|CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens GN=COL6A6 PE=1 SV=2 801 1048 5.0E-24
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 786 1039 6.0E-24
sp|Q8BLX7|COGA1_MOUSE Collagen alpha-1(XVI) chain OS=Mus musculus GN=Col16a1 PE=1 SV=2 784 1052 6.0E-24
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 813 1058 7.0E-24
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 787 1059 7.0E-24
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 790 1058 7.0E-24
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 557 985 7.0E-24
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 787 1057 7.0E-24
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 787 1057 7.0E-24
sp|Q0VF58|COJA1_MOUSE Collagen alpha-1(XIX) chain OS=Mus musculus GN=Col19a1 PE=2 SV=2 445 1039 7.0E-24
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 557 726 8.0E-24
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 787 1057 8.0E-24
sp|Q99MQ5|COPA1_MOUSE Collagen alpha-1(XXV) chain OS=Mus musculus GN=Col25a1 PE=2 SV=2 802 1056 9.0E-24
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 785 1049 1.0E-23
sp|A2AX52|CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus GN=Col6a4 PE=1 SV=2 856 1055 1.0E-23
sp|Q801S8|CO6A1_XENLA Collagen alpha-1(VI) chain OS=Xenopus laevis GN=col6a1 PE=1 SV=1 857 1051 1.0E-23
sp|P02461|CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens GN=COL3A1 PE=1 SV=4 844 1056 1.0E-23
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 786 1024 1.0E-23
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 787 1051 1.0E-23
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 557 1056 1.0E-23
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 805 1064 1.0E-23
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 805 1057 2.0E-23
sp|Q641F3|COLA1_XENLA Collagen alpha-1(XXI) chain OS=Xenopus laevis GN=col21a1 PE=2 SV=1 787 1043 2.0E-23
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 785 1055 2.0E-23
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 557 725 2.0E-23
sp|P08121|CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculus GN=Col3a1 PE=1 SV=4 824 1045 2.0E-23
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 787 1057 2.0E-23
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 793 1037 3.0E-23
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 787 1016 3.0E-23
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 787 1037 3.0E-23
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 652 1054 3.0E-23
sp|Q07643|CO9A2_MOUSE Collagen alpha-2(IX) chain OS=Mus musculus GN=Col9a2 PE=2 SV=1 787 1049 3.0E-23
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 782 1052 4.0E-23
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 548 721 4.0E-23
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 553 726 4.0E-23
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 788 1057 4.0E-23
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 787 1043 5.0E-23
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 782 1055 6.0E-23
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 790 1046 6.0E-23
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 787 1057 6.0E-23
sp|Q9BXS0|COPA1_HUMAN Collagen alpha-1(XXV) chain OS=Homo sapiens GN=COL25A1 PE=1 SV=2 823 1046 6.0E-23
sp|Q641F3|COLA1_XENLA Collagen alpha-1(XXI) chain OS=Xenopus laevis GN=col21a1 PE=2 SV=1 541 725 7.0E-23
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 557 725 7.0E-23
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 820 1059 8.0E-23
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 787 1057 8.0E-23
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 787 1057 8.0E-23
sp|Q9BXS0|COPA1_HUMAN Collagen alpha-1(XXV) chain OS=Homo sapiens GN=COL25A1 PE=1 SV=2 802 1055 8.0E-23
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 787 1055 9.0E-23
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 787 1057 9.0E-23
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 538 719 1.0E-22
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 545 719 1.0E-22
sp|Q9WUB9|MARCO_MESAU Macrophage receptor MARCO OS=Mesocricetus auratus GN=MARCO PE=2 SV=1 782 944 1.0E-22
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 785 1055 1.0E-22
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 557 1037 1.0E-22
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 785 1055 1.0E-22
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 785 1056 1.0E-22
sp|A8TX70|CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens GN=COL6A5 PE=1 SV=1 556 726 2.0E-22
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 787 1051 2.0E-22
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 787 1056 2.0E-22
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 560 726 2.0E-22
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 785 1051 2.0E-22
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 793 1055 2.0E-22
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 557 1056 2.0E-22
sp|Q4ZJM7|OTOL1_MOUSE Otolin-1 OS=Mus musculus GN=Otol1 PE=1 SV=2 793 1007 2.0E-22
sp|A6NMZ7|CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens GN=COL6A6 PE=1 SV=2 785 1064 2.0E-22
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 785 1039 3.0E-22
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 555 725 3.0E-22
sp|Q16992|LWA_ANTEL LWamide neuropeptides OS=Anthopleura elegantissima PE=1 SV=1 786 1056 3.0E-22
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 557 1056 3.0E-22
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus GN=Nefh PE=1 SV=3 818 1054 3.0E-22
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 562 1046 3.0E-22
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 560 1054 3.0E-22
sp|Q07643|CO9A2_MOUSE Collagen alpha-2(IX) chain OS=Mus musculus GN=Col9a2 PE=2 SV=1 786 1066 3.0E-22
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 552 914 4.0E-22
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 785 1034 4.0E-22
sp|A6NMZ7|CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens GN=COL6A6 PE=1 SV=2 789 1058 4.0E-22
sp|Q0VF58|COJA1_MOUSE Collagen alpha-1(XIX) chain OS=Mus musculus GN=Col19a1 PE=2 SV=2 786 1056 4.0E-22
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 786 1046 4.0E-22
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 785 1054 5.0E-22
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 795 1055 5.0E-22
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 557 1056 6.0E-22
sp|Q99MQ5|COPA1_MOUSE Collagen alpha-1(XXV) chain OS=Mus musculus GN=Col25a1 PE=2 SV=2 556 947 6.0E-22
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 787 1046 6.0E-22
sp|Q9BXS0|COPA1_HUMAN Collagen alpha-1(XXV) chain OS=Homo sapiens GN=COL25A1 PE=1 SV=2 620 1037 6.0E-22
sp|Q0VF58|COJA1_MOUSE Collagen alpha-1(XIX) chain OS=Mus musculus GN=Col19a1 PE=2 SV=2 787 1054 7.0E-22
sp|P08125|COAA1_CHICK Collagen alpha-1(X) chain OS=Gallus gallus GN=COL10A1 PE=1 SV=4 792 1055 7.0E-22
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 547 1059 8.0E-22
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 564 893 8.0E-22
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 787 1055 8.0E-22
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 787 1058 9.0E-22
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 787 1007 9.0E-22
sp|A8TX70|CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens GN=COL6A5 PE=1 SV=1 559 725 1.0E-21
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 799 1054 1.0E-21
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 823 1045 1.0E-21
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 565 725 1.0E-21
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 787 1056 1.0E-21
sp|Q9WUB9|MARCO_MESAU Macrophage receptor MARCO OS=Mesocricetus auratus GN=MARCO PE=2 SV=1 555 719 1.0E-21
sp|Q16992|LWA_ANTEL LWamide neuropeptides OS=Anthopleura elegantissima PE=1 SV=1 788 1052 1.0E-21
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 787 1057 1.0E-21
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 782 1056 1.0E-21
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 786 1001 2.0E-21
sp|A2AX52|CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus GN=Col6a4 PE=1 SV=2 552 725 2.0E-21
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 786 1051 2.0E-21
sp|Q4ZJM7|OTOL1_MOUSE Otolin-1 OS=Mus musculus GN=Otol1 PE=1 SV=2 835 1054 2.0E-21
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 796 1043 3.0E-21
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 812 1054 3.0E-21
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 557 1045 3.0E-21
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 559 1052 3.0E-21
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 786 1012 4.0E-21
sp|Q28247|CO4A5_CANLF Collagen alpha-5(IV) chain OS=Canis lupus familiaris GN=COL4A5 PE=2 SV=2 596 934 4.0E-21
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 796 1004 5.0E-21
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 779 1054 5.0E-21
sp|A2AX52|CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus GN=Col6a4 PE=1 SV=2 535 725 5.0E-21
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 562 725 6.0E-21
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 785 1058 6.0E-21
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 580 1056 6.0E-21
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 787 1056 7.0E-21
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 790 1055 7.0E-21
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 560 1056 7.0E-21
sp|Q9QZR9|CO4A4_MOUSE Collagen alpha-4(IV) chain OS=Mus musculus GN=Col4a4 PE=2 SV=1 805 1051 7.0E-21
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 787 1059 8.0E-21
sp|P23206|COAA1_BOVIN Collagen alpha-1(X) chain OS=Bos taurus GN=COL10A1 PE=2 SV=1 563 722 8.0E-21
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 556 1045 8.0E-21
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 782 1051 8.0E-21
sp|P08125|COAA1_CHICK Collagen alpha-1(X) chain OS=Gallus gallus GN=COL10A1 PE=1 SV=4 803 1056 8.0E-21
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 877 1058 9.0E-21
sp|P17139|CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans GN=emb-9 PE=1 SV=5 887 1069 1.0E-20
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 785 1061 1.0E-20
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 560 1022 1.0E-20
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 786 1058 1.0E-20
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 787 1057 1.0E-20
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 782 1055 1.0E-20
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 785 1054 1.0E-20
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 782 1055 1.0E-20
sp|A6NHN0|OTOL1_HUMAN Otolin-1 OS=Homo sapiens GN=OTOL1 PE=3 SV=1 842 1066 1.0E-20
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 785 1054 2.0E-20
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 556 726 2.0E-20
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 557 725 2.0E-20
sp|Q801S8|CO6A1_XENLA Collagen alpha-1(VI) chain OS=Xenopus laevis GN=col6a1 PE=1 SV=1 878 1054 2.0E-20
sp|P02457|CO1A1_CHICK Collagen alpha-1(I) chain OS=Gallus gallus GN=COL1A1 PE=1 SV=3 686 1054 2.0E-20
sp|P23206|COAA1_BOVIN Collagen alpha-1(X) chain OS=Bos taurus GN=COL10A1 PE=2 SV=1 557 726 2.0E-20
sp|Q8BLX7|COGA1_MOUSE Collagen alpha-1(XVI) chain OS=Mus musculus GN=Col16a1 PE=1 SV=2 548 934 2.0E-20
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 560 1043 2.0E-20
sp|P08125|COAA1_CHICK Collagen alpha-1(X) chain OS=Gallus gallus GN=COL10A1 PE=1 SV=4 786 1055 2.0E-20
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 785 1051 2.0E-20
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 656 1058 3.0E-20
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 808 1059 3.0E-20
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 557 725 3.0E-20
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 561 726 3.0E-20
sp|P23206|COAA1_BOVIN Collagen alpha-1(X) chain OS=Bos taurus GN=COL10A1 PE=2 SV=1 835 1056 3.0E-20
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 566 1037 3.0E-20
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 556 1051 3.0E-20
sp|A6NHN0|OTOL1_HUMAN Otolin-1 OS=Homo sapiens GN=OTOL1 PE=3 SV=1 813 1030 3.0E-20
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 573 1056 3.0E-20
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 768 1040 4.0E-20
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 557 1055 4.0E-20
sp|Q8C6K9|CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus GN=Col6a6 PE=1 SV=2 557 726 4.0E-20
sp|P20785|CO6A1_CHICK Collagen alpha-1(VI) chain OS=Gallus gallus GN=COL6A1 PE=2 SV=1 558 726 5.0E-20
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 556 726 6.0E-20
sp|P53420|CO4A4_HUMAN Collagen alpha-4(IV) chain OS=Homo sapiens GN=COL4A4 PE=1 SV=3 786 1052 6.0E-20
sp|Q5UPX3|COLL3_MIMIV Collagen-like protein 3 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R239 PE=4 SV=1 834 1034 6.0E-20
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 787 1055 7.0E-20
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 793 1042 7.0E-20
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 782 1055 7.0E-20
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 785 1055 8.0E-20
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 786 1045 8.0E-20
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 555 725 9.0E-20
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 555 725 9.0E-20
sp|Q07643|CO9A2_MOUSE Collagen alpha-2(IX) chain OS=Mus musculus GN=Col9a2 PE=2 SV=1 787 1058 9.0E-20
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 827 1055 1.0E-19
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 785 992 1.0E-19
sp|P20785|CO6A1_CHICK Collagen alpha-1(VI) chain OS=Gallus gallus GN=COL6A1 PE=2 SV=1 557 722 1.0E-19
sp|Q05306|COAA1_MOUSE Collagen alpha-1(X) chain OS=Mus musculus GN=Col10a1 PE=2 SV=1 601 943 1.0E-19
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 791 1055 1.0E-19
sp|P20849|CO9A1_HUMAN Collagen alpha-1(IX) chain OS=Homo sapiens GN=COL9A1 PE=1 SV=3 833 1054 1.0E-19
sp|Q99MQ5|COPA1_MOUSE Collagen alpha-1(XXV) chain OS=Mus musculus GN=Col25a1 PE=2 SV=2 786 1057 1.0E-19
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 799 1054 1.0E-19
sp|Q07643|CO9A2_MOUSE Collagen alpha-2(IX) chain OS=Mus musculus GN=Col9a2 PE=2 SV=1 674 1034 1.0E-19
sp|Q9BXS0|COPA1_HUMAN Collagen alpha-1(XXV) chain OS=Homo sapiens GN=COL25A1 PE=1 SV=2 786 1057 1.0E-19
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 786 1039 1.0E-19
sp|Q9QZR9|CO4A4_MOUSE Collagen alpha-4(IV) chain OS=Mus musculus GN=Col4a4 PE=2 SV=1 782 1007 1.0E-19
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 782 1051 1.0E-19
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 556 1055 1.0E-19
sp|Q5UPX3|COLL3_MIMIV Collagen-like protein 3 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R239 PE=4 SV=1 822 1022 1.0E-19
sp|Q9QZS0|CO4A3_MOUSE Collagen alpha-3(IV) chain OS=Mus musculus GN=Col4a3 PE=1 SV=2 805 1055 1.0E-19
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 556 725 2.0E-19
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 793 1056 2.0E-19
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 577 726 2.0E-19
sp|Q60754|MARCO_MOUSE Macrophage receptor MARCO OS=Mus musculus GN=Marco PE=1 SV=1 557 726 2.0E-19
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 556 726 2.0E-19
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 557 726 2.0E-19
sp|Q99MQ5|COPA1_MOUSE Collagen alpha-1(XXV) chain OS=Mus musculus GN=Col25a1 PE=2 SV=2 877 1066 2.0E-19
sp|Q0VF58|COJA1_MOUSE Collagen alpha-1(XIX) chain OS=Mus musculus GN=Col19a1 PE=2 SV=2 797 1054 2.0E-19
sp|Q9BXS0|COPA1_HUMAN Collagen alpha-1(XXV) chain OS=Homo sapiens GN=COL25A1 PE=1 SV=2 556 934 2.0E-19
sp|A6NHN0|OTOL1_HUMAN Otolin-1 OS=Homo sapiens GN=OTOL1 PE=3 SV=1 788 1010 2.0E-19
sp|A6NHN0|OTOL1_HUMAN Otolin-1 OS=Homo sapiens GN=OTOL1 PE=3 SV=1 825 1051 2.0E-19
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 785 1051 2.0E-19
sp|Q9QZS0|CO4A3_MOUSE Collagen alpha-3(IV) chain OS=Mus musculus GN=Col4a3 PE=1 SV=2 567 991 2.0E-19
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 786 1054 2.0E-19
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 557 725 3.0E-19
sp|Q05306|COAA1_MOUSE Collagen alpha-1(X) chain OS=Mus musculus GN=Col10a1 PE=2 SV=1 555 725 3.0E-19
sp|Q16992|LWA_ANTEL LWamide neuropeptides OS=Anthopleura elegantissima PE=1 SV=1 809 1055 3.0E-19
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 790 1055 3.0E-19
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 793 1055 3.0E-19
sp|P12106|CO9A1_CHICK Collagen alpha-1(IX) chain OS=Gallus gallus GN=COL9A1 PE=1 SV=4 783 1054 3.0E-19
sp|A6NE01|F186A_HUMAN Protein FAM186A OS=Homo sapiens GN=FAM186A PE=2 SV=3 787 1057 3.0E-19
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 785 1056 4.0E-19
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 787 1027 4.0E-19
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 557 725 4.0E-19
sp|Q4ZJM7|OTOL1_MOUSE Otolin-1 OS=Mus musculus GN=Otol1 PE=1 SV=2 529 725 4.0E-19
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 620 1013 4.0E-19
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 787 1043 4.0E-19
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 550 726 5.0E-19
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 816 1055 5.0E-19
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 563 1054 5.0E-19
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 790 1054 5.0E-19
sp|P91285|DPY5_CAEEL Cuticle collagen dpy-5 OS=Caenorhabditis elegans GN=dpy-5 PE=3 SV=1 883 1048 5.0E-19
sp|P29400|CO4A5_HUMAN Collagen alpha-5(IV) chain OS=Homo sapiens GN=COL4A5 PE=1 SV=2 821 976 5.0E-19
sp|Q28668|CO1A2_RABIT Collagen alpha-2(I) chain (Fragment) OS=Oryctolagus cuniculus GN=COL1A2 PE=2 SV=1 799 1013 5.0E-19
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 800 1039 6.0E-19
sp|A2AX52|CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus GN=Col6a4 PE=1 SV=2 557 725 6.0E-19
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 575 1024 6.0E-19
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 786 1056 6.0E-19
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 559 1055 6.0E-19
sp|Q07643|CO9A2_MOUSE Collagen alpha-2(IX) chain OS=Mus musculus GN=Col9a2 PE=2 SV=1 550 938 6.0E-19
sp|P25318|CO8A2_MOUSE Collagen alpha-2(VIII) chain OS=Mus musculus GN=Col8a2 PE=2 SV=2 790 1054 6.0E-19
sp|P12107|COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens GN=COL11A1 PE=1 SV=4 786 1042 6.0E-19
sp|A8TX70|CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens GN=COL6A5 PE=1 SV=1 557 726 7.0E-19
sp|Q60754|MARCO_MOUSE Macrophage receptor MARCO OS=Mus musculus GN=Marco PE=1 SV=1 555 719 7.0E-19
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 552 1051 7.0E-19
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 565 1009 7.0E-19
sp|Q60754|MARCO_MOUSE Macrophage receptor MARCO OS=Mus musculus GN=Marco PE=1 SV=1 555 726 8.0E-19
sp|Q9WUB9|MARCO_MESAU Macrophage receptor MARCO OS=Mesocricetus auratus GN=MARCO PE=2 SV=1 557 725 8.0E-19
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 785 1056 8.0E-19
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 782 1051 8.0E-19
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 785 1056 9.0E-19
sp|Q5UPX3|COLL3_MIMIV Collagen-like protein 3 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R239 PE=4 SV=1 564 720 9.0E-19
sp|Q28668|CO1A2_RABIT Collagen alpha-2(I) chain (Fragment) OS=Oryctolagus cuniculus GN=COL1A2 PE=2 SV=1 787 1031 9.0E-19
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 786 1054 1.0E-18
sp|Q801S8|CO6A1_XENLA Collagen alpha-1(VI) chain OS=Xenopus laevis GN=col6a1 PE=1 SV=1 557 722 1.0E-18
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 786 1042 1.0E-18
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 557 719 1.0E-18
sp|P20785|CO6A1_CHICK Collagen alpha-1(VI) chain OS=Gallus gallus GN=COL6A1 PE=2 SV=1 557 725 1.0E-18
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 555 690 1.0E-18
sp|Q9WUB9|MARCO_MESAU Macrophage receptor MARCO OS=Mesocricetus auratus GN=MARCO PE=2 SV=1 624 917 1.0E-18
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 779 1051 1.0E-18
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 790 1051 1.0E-18
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 787 1054 1.0E-18
sp|Q5UPX3|COLL3_MIMIV Collagen-like protein 3 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R239 PE=4 SV=1 764 1003 1.0E-18
sp|Q5UPX3|COLL3_MIMIV Collagen-like protein 3 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R239 PE=4 SV=1 813 1013 1.0E-18
sp|P91285|DPY5_CAEEL Cuticle collagen dpy-5 OS=Caenorhabditis elegans GN=dpy-5 PE=3 SV=1 802 967 1.0E-18
sp|P12107|COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens GN=COL11A1 PE=1 SV=4 805 1051 1.0E-18
sp|Q9JMH4|COHA1_MESAU Collagen alpha-1(XVII) chain OS=Mesocricetus auratus GN=COL17A1 PE=2 SV=1 785 999 1.0E-18
sp|Q9JMH4|COHA1_MESAU Collagen alpha-1(XVII) chain OS=Mesocricetus auratus GN=COL17A1 PE=2 SV=1 805 1021 1.0E-18
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 555 725 2.0E-18
sp|Q8C6K9|CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus GN=Col6a6 PE=1 SV=2 785 1002 2.0E-18
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 555 722 2.0E-18
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 836 1056 2.0E-18
sp|P02457|CO1A1_CHICK Collagen alpha-1(I) chain OS=Gallus gallus GN=COL1A1 PE=1 SV=3 823 1056 2.0E-18
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 555 725 2.0E-18
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 575 1030 2.0E-18
sp|P15989|CO6A3_CHICK Collagen alpha-3(VI) chain OS=Gallus gallus GN=COL6A3 PE=2 SV=2 548 726 2.0E-18
sp|Q28247|CO4A5_CANLF Collagen alpha-5(IV) chain OS=Canis lupus familiaris GN=COL4A5 PE=2 SV=2 785 1036 2.0E-18
sp|Q4ZJM7|OTOL1_MOUSE Otolin-1 OS=Mus musculus GN=Otol1 PE=1 SV=2 786 983 2.0E-18
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 785 1056 2.0E-18
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 785 1058 2.0E-18
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 786 1052 2.0E-18
sp|Q14993|COJA1_HUMAN Collagen alpha-1(XIX) chain OS=Homo sapiens GN=COL19A1 PE=1 SV=3 790 995 2.0E-18
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 793 1054 2.0E-18
sp|Q641F3|COLA1_XENLA Collagen alpha-1(XXI) chain OS=Xenopus laevis GN=col21a1 PE=2 SV=1 785 1028 3.0E-18
sp|Q60754|MARCO_MOUSE Macrophage receptor MARCO OS=Mus musculus GN=Marco PE=1 SV=1 560 725 3.0E-18
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 808 1054 3.0E-18
sp|Q9WUB9|MARCO_MESAU Macrophage receptor MARCO OS=Mesocricetus auratus GN=MARCO PE=2 SV=1 555 726 3.0E-18
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 796 1051 3.0E-18
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 787 1055 3.0E-18
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 786 1058 3.0E-18
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 672 1048 3.0E-18
sp|Q07643|CO9A2_MOUSE Collagen alpha-2(IX) chain OS=Mus musculus GN=Col9a2 PE=2 SV=1 802 1067 3.0E-18
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 557 959 3.0E-18
sp|G1UBC2|PGA47_CANAL Cell wall adhesin EAP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EAP1 PE=1 SV=1 838 1055 3.0E-18
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 556 722 4.0E-18
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 557 720 4.0E-18
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 658 1054 4.0E-18
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 817 1056 4.0E-18
sp|P98085|COLE_LEPMA Inner ear-specific collagen OS=Lepomis macrochirus PE=2 SV=1 797 970 4.0E-18
sp|Q60754|MARCO_MOUSE Macrophage receptor MARCO OS=Mus musculus GN=Marco PE=1 SV=1 555 726 5.0E-18
sp|Q801S8|CO6A1_XENLA Collagen alpha-1(VI) chain OS=Xenopus laevis GN=col6a1 PE=1 SV=1 548 725 5.0E-18
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 793 1054 5.0E-18
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 553 725 6.0E-18
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 788 1033 6.0E-18
sp|Q5UPX3|COLL3_MIMIV Collagen-like protein 3 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R239 PE=4 SV=1 555 710 7.0E-18
sp|P91285|DPY5_CAEEL Cuticle collagen dpy-5 OS=Caenorhabditis elegans GN=dpy-5 PE=3 SV=1 784 937 7.0E-18
sp|P91285|DPY5_CAEEL Cuticle collagen dpy-5 OS=Caenorhabditis elegans GN=dpy-5 PE=3 SV=1 569 725 7.0E-18
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 789 1054 7.0E-18
sp|Q14993|COJA1_HUMAN Collagen alpha-1(XIX) chain OS=Homo sapiens GN=COL19A1 PE=1 SV=3 786 1054 7.0E-18
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 787 1054 8.0E-18
sp|Q05306|COAA1_MOUSE Collagen alpha-1(X) chain OS=Mus musculus GN=Col10a1 PE=2 SV=1 584 726 8.0E-18
sp|P91285|DPY5_CAEEL Cuticle collagen dpy-5 OS=Caenorhabditis elegans GN=dpy-5 PE=3 SV=1 478 726 8.0E-18
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 793 1054 8.0E-18
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 555 699 9.0E-18
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 786 1056 9.0E-18
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 856 1070 1.0E-17
sp|Q641F3|COLA1_XENLA Collagen alpha-1(XXI) chain OS=Xenopus laevis GN=col21a1 PE=2 SV=1 545 862 1.0E-17
sp|Q60754|MARCO_MOUSE Macrophage receptor MARCO OS=Mus musculus GN=Marco PE=1 SV=1 557 726 1.0E-17
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 785 1055 1.0E-17
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 557 720 1.0E-17
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 557 725 1.0E-17
sp|P20785|CO6A1_CHICK Collagen alpha-1(VI) chain OS=Gallus gallus GN=COL6A1 PE=2 SV=1 555 710 1.0E-17
sp|P20849|CO9A1_HUMAN Collagen alpha-1(IX) chain OS=Homo sapiens GN=COL9A1 PE=1 SV=3 556 726 1.0E-17
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 808 1059 1.0E-17
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 557 986 1.0E-17
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 786 1054 1.0E-17
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 590 974 1.0E-17
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 599 1039 1.0E-17
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 632 1051 1.0E-17
sp|Q5UPX3|COLL3_MIMIV Collagen-like protein 3 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R239 PE=4 SV=1 803 1037 1.0E-17
sp|Q5UPX3|COLL3_MIMIV Collagen-like protein 3 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R239 PE=4 SV=1 576 726 1.0E-17
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 595 1039 1.0E-17
sp|P91285|DPY5_CAEEL Cuticle collagen dpy-5 OS=Caenorhabditis elegans GN=dpy-5 PE=3 SV=1 862 1028 1.0E-17
sp|P91285|DPY5_CAEEL Cuticle collagen dpy-5 OS=Caenorhabditis elegans GN=dpy-5 PE=3 SV=1 904 1054 1.0E-17
sp|P98085|COLE_LEPMA Inner ear-specific collagen OS=Lepomis macrochirus PE=2 SV=1 826 994 1.0E-17
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 557 726 2.0E-17
sp|Q60754|MARCO_MOUSE Macrophage receptor MARCO OS=Mus musculus GN=Marco PE=1 SV=1 557 717 2.0E-17
sp|Q60754|MARCO_MOUSE Macrophage receptor MARCO OS=Mus musculus GN=Marco PE=1 SV=1 555 726 2.0E-17
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 556 716 2.0E-17
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 556 722 2.0E-17
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 556 726 2.0E-17
sp|P12110|CO6A2_HUMAN Collagen alpha-2(VI) chain OS=Homo sapiens GN=COL6A2 PE=1 SV=4 556 725 2.0E-17
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 817 1040 2.0E-17
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 796 1055 2.0E-17
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus GN=Nefh PE=1 SV=3 848 1057 2.0E-17
sp|Q28668|CO1A2_RABIT Collagen alpha-2(I) chain (Fragment) OS=Oryctolagus cuniculus GN=COL1A2 PE=2 SV=1 790 1042 2.0E-17
sp|P98085|COLE_LEPMA Inner ear-specific collagen OS=Lepomis macrochirus PE=2 SV=1 847 1009 2.0E-17
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 793 1054 2.0E-17
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 790 1039 3.0E-17
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 566 722 3.0E-17
sp|P20785|CO6A1_CHICK Collagen alpha-1(VI) chain OS=Gallus gallus GN=COL6A1 PE=2 SV=1 556 726 3.0E-17
sp|Q05306|COAA1_MOUSE Collagen alpha-1(X) chain OS=Mus musculus GN=Col10a1 PE=2 SV=1 572 725 3.0E-17
sp|Q16992|LWA_ANTEL LWamide neuropeptides OS=Anthopleura elegantissima PE=1 SV=1 790 1029 3.0E-17
sp|Q28247|CO4A5_CANLF Collagen alpha-5(IV) chain OS=Canis lupus familiaris GN=COL4A5 PE=2 SV=2 799 982 3.0E-17
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 787 1054 3.0E-17
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 797 1051 3.0E-17
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 797 1051 3.0E-17
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 578 959 3.0E-17
sp|Q5UPX3|COLL3_MIMIV Collagen-like protein 3 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R239 PE=4 SV=1 791 1019 3.0E-17
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 796 1046 3.0E-17
sp|G1UBC2|PGA47_CANAL Cell wall adhesin EAP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EAP1 PE=1 SV=1 786 987 3.0E-17
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 809 1064 4.0E-17
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 785 1056 4.0E-17
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 559 1007 4.0E-17
sp|P20849|CO9A1_HUMAN Collagen alpha-1(IX) chain OS=Homo sapiens GN=COL9A1 PE=1 SV=3 557 726 4.0E-17
sp|Q8BLX7|COGA1_MOUSE Collagen alpha-1(XVI) chain OS=Mus musculus GN=Col16a1 PE=1 SV=2 611 1006 4.0E-17
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 793 1056 4.0E-17
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 796 1046 4.0E-17
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 796 1056 4.0E-17
sp|P18856|CAF1_EPHMU Collagen EMF1-alpha (Fragment) OS=Ephydatia muelleri GN=COLF1 PE=3 SV=2 820 1051 4.0E-17
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 786 953 5.0E-17
sp|Q8C6K9|CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus GN=Col6a6 PE=1 SV=2 555 722 5.0E-17
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 810 1059 5.0E-17
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 787 1055 5.0E-17
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 785 1048 5.0E-17
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 552 725 6.0E-17
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 597 726 6.0E-17
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 786 1055 6.0E-17
sp|Q8C6K9|CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus GN=Col6a6 PE=1 SV=2 563 725 6.0E-17
sp|P12110|CO6A2_HUMAN Collagen alpha-2(VI) chain OS=Homo sapiens GN=COL6A2 PE=1 SV=4 548 719 6.0E-17
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 796 1051 6.0E-17
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 552 725 7.0E-17
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 555 710 7.0E-17
sp|P18856|CAF1_EPHMU Collagen EMF1-alpha (Fragment) OS=Ephydatia muelleri GN=COLF1 PE=3 SV=2 787 1030 7.0E-17
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 787 1058 8.0E-17
sp|A6NHN0|OTOL1_HUMAN Otolin-1 OS=Homo sapiens GN=OTOL1 PE=3 SV=1 786 995 8.0E-17
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 556 726 9.0E-17
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 556 722 1.0E-16
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 557 725 1.0E-16
sp|A2AX52|CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus GN=Col6a4 PE=1 SV=2 555 726 1.0E-16
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 556 725 1.0E-16
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 782 914 1.0E-16
sp|P02461|CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens GN=COL3A1 PE=1 SV=4 786 980 1.0E-16
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 786 1058 1.0E-16
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 790 1059 1.0E-16
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 787 1054 1.0E-16
sp|Q99MQ5|COPA1_MOUSE Collagen alpha-1(XXV) chain OS=Mus musculus GN=Col25a1 PE=2 SV=2 569 725 1.0E-16
sp|Q99MQ5|COPA1_MOUSE Collagen alpha-1(XXV) chain OS=Mus musculus GN=Col25a1 PE=2 SV=2 552 726 1.0E-16
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus GN=Nefh PE=1 SV=3 588 937 1.0E-16
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 845 1051 1.0E-16
sp|A6NE01|F186A_HUMAN Protein FAM186A OS=Homo sapiens GN=FAM186A PE=2 SV=3 566 999 1.0E-16
sp|A6NE01|F186A_HUMAN Protein FAM186A OS=Homo sapiens GN=FAM186A PE=2 SV=3 787 1057 1.0E-16
sp|P91285|DPY5_CAEEL Cuticle collagen dpy-5 OS=Caenorhabditis elegans GN=dpy-5 PE=3 SV=1 549 707 1.0E-16
sp|P12105|CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus GN=COL3A1 PE=2 SV=2 822 1048 1.0E-16
sp|P12105|CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus GN=COL3A1 PE=2 SV=2 808 941 1.0E-16
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 844 1012 1.0E-16
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 785 1056 1.0E-16
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 552 725 2.0E-16
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 605 1049 2.0E-16
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 572 725 2.0E-16
sp|Q8C6K9|CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus GN=Col6a6 PE=1 SV=2 555 722 2.0E-16
sp|Q8C6K9|CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus GN=Col6a6 PE=1 SV=2 570 725 2.0E-16
sp|Q05722|CO9A1_MOUSE Collagen alpha-1(IX) chain OS=Mus musculus GN=Col9a1 PE=2 SV=2 543 726 2.0E-16
sp|P12110|CO6A2_HUMAN Collagen alpha-2(VI) chain OS=Homo sapiens GN=COL6A2 PE=1 SV=4 552 726 2.0E-16
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 794 1048 2.0E-16
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 793 1055 2.0E-16
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 787 1016 2.0E-16
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 787 1059 2.0E-16
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 557 932 2.0E-16
sp|Q9BXS0|COPA1_HUMAN Collagen alpha-1(XXV) chain OS=Homo sapiens GN=COL25A1 PE=1 SV=2 569 726 2.0E-16
sp|P91285|DPY5_CAEEL Cuticle collagen dpy-5 OS=Caenorhabditis elegans GN=dpy-5 PE=3 SV=1 786 938 2.0E-16
sp|P91285|DPY5_CAEEL Cuticle collagen dpy-5 OS=Caenorhabditis elegans GN=dpy-5 PE=3 SV=1 838 992 2.0E-16
sp|P29400|CO4A5_HUMAN Collagen alpha-5(IV) chain OS=Homo sapiens GN=COL4A5 PE=1 SV=2 785 914 2.0E-16
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 787 1056 2.0E-16
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 844 1012 2.0E-16
sp|Q5UNS9|COLL7_MIMIV Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L669 PE=4 SV=1 553 726 3.0E-16
sp|P12111|CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens GN=COL6A3 PE=1 SV=5 560 720 3.0E-16
sp|P20849|CO9A1_HUMAN Collagen alpha-1(IX) chain OS=Homo sapiens GN=COL9A1 PE=1 SV=3 556 719 3.0E-16
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus GN=Nefh PE=1 SV=3 555 722 3.0E-16
sp|P98085|COLE_LEPMA Inner ear-specific collagen OS=Lepomis macrochirus PE=2 SV=1 871 1028 3.0E-16
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 788 1048 3.0E-16
sp|A5PN28|OTO1A_DANRE Otolin-1-A OS=Danio rerio GN=otol1a PE=2 SV=1 883 1058 3.0E-16
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 557 725 4.0E-16
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 793 1055 4.0E-16
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 557 720 4.0E-16
sp|P12111|CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens GN=COL6A3 PE=1 SV=5 569 717 4.0E-16
sp|P20849|CO9A1_HUMAN Collagen alpha-1(IX) chain OS=Homo sapiens GN=COL9A1 PE=1 SV=3 787 1043 4.0E-16
sp|Q16992|LWA_ANTEL LWamide neuropeptides OS=Anthopleura elegantissima PE=1 SV=1 784 1008 4.0E-16
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus GN=Nefh PE=1 SV=3 555 722 4.0E-16
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 786 1055 4.0E-16
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 789 1051 4.0E-16
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 786 1048 4.0E-16
sp|Q9BXS0|COPA1_HUMAN Collagen alpha-1(XXV) chain OS=Homo sapiens GN=COL25A1 PE=1 SV=2 552 722 4.0E-16
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 788 1024 4.0E-16
sp|A6NE01|F186A_HUMAN Protein FAM186A OS=Homo sapiens GN=FAM186A PE=2 SV=3 791 1057 4.0E-16
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 788 1048 4.0E-16
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 557 704 5.0E-16
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 560 726 5.0E-16
sp|A8TX70|CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens GN=COL6A5 PE=1 SV=1 556 712 5.0E-16
sp|P12110|CO6A2_HUMAN Collagen alpha-2(VI) chain OS=Homo sapiens GN=COL6A2 PE=1 SV=4 557 722 5.0E-16
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 790 1056 5.0E-16
sp|A6NE01|F186A_HUMAN Protein FAM186A OS=Homo sapiens GN=FAM186A PE=2 SV=3 787 1057 5.0E-16
sp|P12107|COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens GN=COL11A1 PE=1 SV=4 796 1036 5.0E-16
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 785 1024 5.0E-16
sp|P18856|CAF1_EPHMU Collagen EMF1-alpha (Fragment) OS=Ephydatia muelleri GN=COLF1 PE=3 SV=2 785 994 5.0E-16
sp|A5PN28|OTO1A_DANRE Otolin-1-A OS=Danio rerio GN=otol1a PE=2 SV=1 827 1041 5.0E-16
sp|B4YNE6|V6_SPTNK Collagen-like protein V6 OS=Sputnik virophage GN=ORF6 PE=3 SV=1 811 921 5.0E-16
sp|Q09578|COL75_CAEEL Putative cuticle collagen 75 OS=Caenorhabditis elegans GN=col-75 PE=3 SV=1 539 702 5.0E-16
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 790 1056 6.0E-16
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 790 1056 6.0E-16
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 790 1056 6.0E-16
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus GN=Nefh PE=1 SV=3 559 726 6.0E-16
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 578 1024 6.0E-16
sp|Q5UPX3|COLL3_MIMIV Collagen-like protein 3 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R239 PE=4 SV=1 549 702 6.0E-16
sp|P29400|CO4A5_HUMAN Collagen alpha-5(IV) chain OS=Homo sapiens GN=COL4A5 PE=1 SV=2 582 725 6.0E-16
sp|P12105|CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus GN=COL3A1 PE=2 SV=2 787 920 6.0E-16
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 816 1055 7.0E-16
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 564 705 7.0E-16
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 788 1024 7.0E-16
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 668 1039 7.0E-16
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 555 725 8.0E-16
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 844 1048 8.0E-16
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 796 1059 8.0E-16
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 808 1055 8.0E-16
sp|P12105|CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus GN=COL3A1 PE=2 SV=2 832 965 8.0E-16
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 805 973 8.0E-16
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 783 1058 8.0E-16
sp|P08125|COAA1_CHICK Collagen alpha-1(X) chain OS=Gallus gallus GN=COL10A1 PE=1 SV=4 786 1003 9.0E-16
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 782 1058 9.0E-16
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 782 1030 9.0E-16
sp|Q28668|CO1A2_RABIT Collagen alpha-2(I) chain (Fragment) OS=Oryctolagus cuniculus GN=COL1A2 PE=2 SV=1 779 988 9.0E-16
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 581 725 1.0E-15
sp|A8TX70|CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens GN=COL6A5 PE=1 SV=1 555 721 1.0E-15
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 557 725 1.0E-15
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 788 1051 1.0E-15
sp|Q801S8|CO6A1_XENLA Collagen alpha-1(VI) chain OS=Xenopus laevis GN=col6a1 PE=1 SV=1 555 725 1.0E-15
sp|Q801S8|CO6A1_XENLA Collagen alpha-1(VI) chain OS=Xenopus laevis GN=col6a1 PE=1 SV=1 557 725 1.0E-15
sp|Q801S8|CO6A1_XENLA Collagen alpha-1(VI) chain OS=Xenopus laevis GN=col6a1 PE=1 SV=1 555 725 1.0E-15
sp|Q8C6K9|CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus GN=Col6a6 PE=1 SV=2 557 723 1.0E-15
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 789 1055 1.0E-15
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 785 1055 1.0E-15
sp|Q9QZR9|CO4A4_MOUSE Collagen alpha-4(IV) chain OS=Mus musculus GN=Col4a4 PE=2 SV=1 558 714 1.0E-15
sp|A6NE01|F186A_HUMAN Protein FAM186A OS=Homo sapiens GN=FAM186A PE=2 SV=3 787 1055 1.0E-15
sp|Q28668|CO1A2_RABIT Collagen alpha-2(I) chain (Fragment) OS=Oryctolagus cuniculus GN=COL1A2 PE=2 SV=1 557 722 1.0E-15
sp|Q28668|CO1A2_RABIT Collagen alpha-2(I) chain (Fragment) OS=Oryctolagus cuniculus GN=COL1A2 PE=2 SV=1 862 1056 1.0E-15
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 785 1001 1.0E-15
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 788 1055 1.0E-15
sp|A5PN28|OTO1A_DANRE Otolin-1-A OS=Danio rerio GN=otol1a PE=2 SV=1 817 1008 1.0E-15
sp|P16884|NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus GN=Nefh PE=1 SV=4 791 1048 1.0E-15
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 557 713 2.0E-15
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 560 725 2.0E-15
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 555 722 2.0E-15
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 556 726 2.0E-15
sp|P20785|CO6A1_CHICK Collagen alpha-1(VI) chain OS=Gallus gallus GN=COL6A1 PE=2 SV=1 556 726 2.0E-15
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 556 725 2.0E-15
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 552 710 2.0E-15
sp|P15988|CO6A2_CHICK Collagen alpha-2(VI) chain OS=Gallus gallus GN=COL6A2 PE=2 SV=1 557 725 2.0E-15
sp|P12111|CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens GN=COL6A3 PE=1 SV=5 581 726 2.0E-15
sp|P12111|CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens GN=COL6A3 PE=1 SV=5 827 1052 2.0E-15
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 552 725 2.0E-15
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 808 1055 2.0E-15
sp|Q4ZJM7|OTOL1_MOUSE Otolin-1 OS=Mus musculus GN=Otol1 PE=1 SV=2 785 976 2.0E-15
sp|Q0VF58|COJA1_MOUSE Collagen alpha-1(XIX) chain OS=Mus musculus GN=Col19a1 PE=2 SV=2 836 1058 2.0E-15
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 650 1024 2.0E-15
sp|P53420|CO4A4_HUMAN Collagen alpha-4(IV) chain OS=Homo sapiens GN=COL4A4 PE=1 SV=3 805 1054 2.0E-15
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 802 1055 2.0E-15
sp|Q9QZS0|CO4A3_MOUSE Collagen alpha-3(IV) chain OS=Mus musculus GN=Col4a3 PE=1 SV=2 786 1055 2.0E-15
sp|Q14993|COJA1_HUMAN Collagen alpha-1(XIX) chain OS=Homo sapiens GN=COL19A1 PE=1 SV=3 826 1054 2.0E-15
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 785 1039 2.0E-15
sp|P98085|COLE_LEPMA Inner ear-specific collagen OS=Lepomis macrochirus PE=2 SV=1 557 719 2.0E-15
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 805 973 2.0E-15
sp|Q09457|BLI1_CAEEL Cuticle collagen bli-1 OS=Caenorhabditis elegans GN=bli-1 PE=3 SV=2 559 683 2.0E-15
sp|Q09457|BLI1_CAEEL Cuticle collagen bli-1 OS=Caenorhabditis elegans GN=bli-1 PE=3 SV=2 808 934 2.0E-15
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 557 725 3.0E-15
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 557 725 3.0E-15
sp|P20785|CO6A1_CHICK Collagen alpha-1(VI) chain OS=Gallus gallus GN=COL6A1 PE=2 SV=1 557 714 3.0E-15
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 785 1045 3.0E-15
sp|P12111|CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens GN=COL6A3 PE=1 SV=5 786 968 3.0E-15
sp|Q02788|CO6A2_MOUSE Collagen alpha-2(VI) chain OS=Mus musculus GN=Col6a2 PE=1 SV=3 785 1033 3.0E-15
sp|Q02788|CO6A2_MOUSE Collagen alpha-2(VI) chain OS=Mus musculus GN=Col6a2 PE=1 SV=3 556 726 3.0E-15
sp|P20849|CO9A1_HUMAN Collagen alpha-1(IX) chain OS=Homo sapiens GN=COL9A1 PE=1 SV=3 612 1028 3.0E-15
sp|P15989|CO6A3_CHICK Collagen alpha-3(VI) chain OS=Gallus gallus GN=COL6A3 PE=2 SV=2 787 1006 3.0E-15
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 811 1056 3.0E-15
sp|Q4ZJM7|OTOL1_MOUSE Otolin-1 OS=Mus musculus GN=Otol1 PE=1 SV=2 886 1058 3.0E-15
sp|A6NE01|F186A_HUMAN Protein FAM186A OS=Homo sapiens GN=FAM186A PE=2 SV=3 787 1057 3.0E-15
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 557 1012 3.0E-15
sp|P12107|COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens GN=COL11A1 PE=1 SV=4 659 1012 3.0E-15
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 814 1054 3.0E-15
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 860 1030 3.0E-15
sp|Q09457|BLI1_CAEEL Cuticle collagen bli-1 OS=Caenorhabditis elegans GN=bli-1 PE=3 SV=2 915 1036 3.0E-15
sp|P39061|COIA1_MOUSE Collagen alpha-1(XVIII) chain OS=Mus musculus GN=Col18a1 PE=1 SV=4 814 1054 3.0E-15
sp|C0HJN3|CO1A1_ORYAF Collagen alpha-1(I) chain (Fragments) OS=Orycteropus afer GN=COL1A1 PE=1 SV=1 785 1055 3.0E-15
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 581 725 4.0E-15
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 553 714 4.0E-15
sp|P12109|CO6A1_HUMAN Collagen alpha-1(VI) chain OS=Homo sapiens GN=COL6A1 PE=1 SV=3 548 716 4.0E-15
sp|Q4ZJM7|OTOL1_MOUSE Otolin-1 OS=Mus musculus GN=Otol1 PE=1 SV=2 557 726 4.0E-15
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 802 1056 4.0E-15
sp|P12105|CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus GN=COL3A1 PE=2 SV=2 597 723 4.0E-15
sp|Q09457|BLI1_CAEEL Cuticle collagen bli-1 OS=Caenorhabditis elegans GN=bli-1 PE=3 SV=2 825 949 4.0E-15
sp|Q02788|CO6A2_MOUSE Collagen alpha-2(VI) chain OS=Mus musculus GN=Col6a2 PE=1 SV=3 548 725 5.0E-15
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus GN=Nefh PE=1 SV=3 555 726 5.0E-15
sp|Q5UPX3|COLL3_MIMIV Collagen-like protein 3 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R239 PE=4 SV=1 556 726 5.0E-15
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 860 1030 5.0E-15
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 786 1055 6.0E-15
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 544 726 6.0E-15
sp|P15988|CO6A2_CHICK Collagen alpha-2(VI) chain OS=Gallus gallus GN=COL6A2 PE=2 SV=1 428 726 6.0E-15
sp|Q8NFW1|COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens GN=COL22A1 PE=2 SV=2 845 1046 6.0E-15
sp|P08121|CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculus GN=Col3a1 PE=1 SV=4 786 1040 6.0E-15
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 786 1046 6.0E-15
sp|A6NHN0|OTOL1_HUMAN Otolin-1 OS=Homo sapiens GN=OTOL1 PE=3 SV=1 546 725 6.0E-15
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 599 1039 6.0E-15
sp|G1UBC2|PGA47_CANAL Cell wall adhesin EAP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EAP1 PE=1 SV=1 503 723 6.0E-15
sp|Q09457|BLI1_CAEEL Cuticle collagen bli-1 OS=Caenorhabditis elegans GN=bli-1 PE=3 SV=2 790 910 6.0E-15
sp|Q9N281|COHA1_CANLF Collagen alpha-1(XVII) chain OS=Canis lupus familiaris GN=COL17A1 PE=2 SV=2 814 1052 6.0E-15
sp|Q07092|COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens GN=COL16A1 PE=1 SV=2 844 1061 6.0E-15
sp|Q05306|COAA1_MOUSE Collagen alpha-1(X) chain OS=Mus musculus GN=Col10a1 PE=2 SV=1 560 722 7.0E-15
sp|P08121|CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculus GN=Col3a1 PE=1 SV=4 557 726 7.0E-15
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus GN=Nefh PE=1 SV=3 564 722 7.0E-15
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 557 725 7.0E-15
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 563 977 7.0E-15
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 818 989 7.0E-15
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 841 1059 7.0E-15
sp|Q02788|CO6A2_MOUSE Collagen alpha-2(VI) chain OS=Mus musculus GN=Col6a2 PE=1 SV=3 428 725 8.0E-15
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 686 1051 8.0E-15
sp|P12106|CO9A1_CHICK Collagen alpha-1(IX) chain OS=Gallus gallus GN=COL9A1 PE=1 SV=4 796 1056 8.0E-15
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 797 1055 8.0E-15
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 557 725 9.0E-15
sp|Q04857|CO6A1_MOUSE Collagen alpha-1(VI) chain OS=Mus musculus GN=Col6a1 PE=1 SV=1 557 716 9.0E-15
sp|Q9QZS0|CO4A3_MOUSE Collagen alpha-3(IV) chain OS=Mus musculus GN=Col4a3 PE=1 SV=2 557 962 9.0E-15
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 556 723 9.0E-15
sp|P12105|CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus GN=COL3A1 PE=2 SV=2 904 1037 9.0E-15
sp|P12105|CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus GN=COL3A1 PE=2 SV=2 874 1001 9.0E-15
sp|P12105|CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus GN=COL3A1 PE=2 SV=2 899 1034 9.0E-15
sp|Q14050|CO9A3_HUMAN Collagen alpha-3(IX) chain OS=Homo sapiens GN=COL9A3 PE=1 SV=2 806 1059 9.0E-15
sp|P83371|OTOL1_ONCKE Otolin-1 OS=Oncorhynchus keta GN=otol1 PE=1 SV=1 872 1044 9.0E-15
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 552 708 1.0E-14
sp|A2AX52|CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus GN=Col6a4 PE=1 SV=2 557 682 1.0E-14
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 556 714 1.0E-14
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 545 940 1.0E-14
sp|P15988|CO6A2_CHICK Collagen alpha-2(VI) chain OS=Gallus gallus GN=COL6A2 PE=2 SV=1 557 725 1.0E-14
sp|P15988|CO6A2_CHICK Collagen alpha-2(VI) chain OS=Gallus gallus GN=COL6A2 PE=2 SV=1 557 725 1.0E-14
sp|P15989|CO6A3_CHICK Collagen alpha-3(VI) chain OS=Gallus gallus GN=COL6A3 PE=2 SV=2 555 719 1.0E-14
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 782 1055 1.0E-14
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 557 958 1.0E-14
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 790 1058 1.0E-14
sp|A6NHN0|OTOL1_HUMAN Otolin-1 OS=Homo sapiens GN=OTOL1 PE=3 SV=1 785 983 1.0E-14
sp|P53420|CO4A4_HUMAN Collagen alpha-4(IV) chain OS=Homo sapiens GN=COL4A4 PE=1 SV=3 848 1059 1.0E-14
sp|P53420|CO4A4_HUMAN Collagen alpha-4(IV) chain OS=Homo sapiens GN=COL4A4 PE=1 SV=3 557 719 1.0E-14
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 563 1009 1.0E-14
sp|P12106|CO9A1_CHICK Collagen alpha-1(IX) chain OS=Gallus gallus GN=COL9A1 PE=1 SV=4 826 1058 1.0E-14
sp|A6NE01|F186A_HUMAN Protein FAM186A OS=Homo sapiens GN=FAM186A PE=2 SV=3 787 1055 1.0E-14
sp|P12105|CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus GN=COL3A1 PE=2 SV=2 582 717 1.0E-14
sp|P12105|CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus GN=COL3A1 PE=2 SV=2 920 1055 1.0E-14
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 818 989 1.0E-14
sp|Q09457|BLI1_CAEEL Cuticle collagen bli-1 OS=Caenorhabditis elegans GN=bli-1 PE=3 SV=2 785 907 1.0E-14
sp|Q9N281|COHA1_CANLF Collagen alpha-1(XVII) chain OS=Canis lupus familiaris GN=COL17A1 PE=2 SV=2 785 977 1.0E-14
sp|Q14050|CO9A3_HUMAN Collagen alpha-3(IX) chain OS=Homo sapiens GN=COL9A3 PE=1 SV=2 785 1016 1.0E-14
sp|P34340|COL90_CAEEL Putative cuticle collagen 90 OS=Caenorhabditis elegans GN=col-90 PE=3 SV=1 531 680 1.0E-14
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 557 726 2.0E-14
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 557 719 2.0E-14
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 552 725 2.0E-14
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 557 726 2.0E-14
sp|Q801S8|CO6A1_XENLA Collagen alpha-1(VI) chain OS=Xenopus laevis GN=col6a1 PE=1 SV=1 786 938 2.0E-14
sp|P12111|CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens GN=COL6A3 PE=1 SV=5 556 725 2.0E-14
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 557 725 2.0E-14
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 557 726 2.0E-14
sp|Q02788|CO6A2_MOUSE Collagen alpha-2(VI) chain OS=Mus musculus GN=Col6a2 PE=1 SV=3 557 722 2.0E-14
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 820 1059 2.0E-14
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 796 1054 2.0E-14
sp|P08121|CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculus GN=Col3a1 PE=1 SV=4 557 725 2.0E-14
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus GN=Nefh PE=1 SV=3 555 723 2.0E-14
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 811 1054 2.0E-14
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 831 1058 2.0E-14
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 788 998 2.0E-14
sp|P53420|CO4A4_HUMAN Collagen alpha-4(IV) chain OS=Homo sapiens GN=COL4A4 PE=1 SV=3 614 1059 2.0E-14
sp|Q9QZS0|CO4A3_MOUSE Collagen alpha-3(IV) chain OS=Mus musculus GN=Col4a3 PE=1 SV=2 785 1040 2.0E-14
sp|P12106|CO9A1_CHICK Collagen alpha-1(IX) chain OS=Gallus gallus GN=COL9A1 PE=1 SV=4 828 1059 2.0E-14
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 790 1055 2.0E-14
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 785 1054 2.0E-14
sp|Q28668|CO1A2_RABIT Collagen alpha-2(I) chain (Fragment) OS=Oryctolagus cuniculus GN=COL1A2 PE=2 SV=1 563 725 2.0E-14
sp|Q14993|COJA1_HUMAN Collagen alpha-1(XIX) chain OS=Homo sapiens GN=COL19A1 PE=1 SV=3 819 1055 2.0E-14
sp|Q14993|COJA1_HUMAN Collagen alpha-1(XIX) chain OS=Homo sapiens GN=COL19A1 PE=1 SV=3 557 726 2.0E-14
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 552 1001 2.0E-14
sp|P12105|CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus GN=COL3A1 PE=2 SV=2 896 1031 2.0E-14
sp|P12105|CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus GN=COL3A1 PE=2 SV=2 853 986 2.0E-14
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 868 1036 2.0E-14
sp|B4YNE6|V6_SPTNK Collagen-like protein V6 OS=Sputnik virophage GN=ORF6 PE=3 SV=1 605 716 2.0E-14
sp|P16884|NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus GN=Nefh PE=1 SV=4 806 1053 2.0E-14
sp|Q9N281|COHA1_CANLF Collagen alpha-1(XVII) chain OS=Canis lupus familiaris GN=COL17A1 PE=2 SV=2 805 1031 2.0E-14
sp|P12108|CO9A2_CHICK Collagen alpha-2(IX) chain OS=Gallus gallus GN=COL9A2 PE=1 SV=3 785 1057 2.0E-14
sp|Q5TAT6|CODA1_HUMAN Collagen alpha-1(XIII) chain OS=Homo sapiens GN=COL13A1 PE=1 SV=1 796 1055 2.0E-14
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 555 869 3.0E-14
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 653 1007 3.0E-14
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 552 726 3.0E-14
sp|Q801S8|CO6A1_XENLA Collagen alpha-1(VI) chain OS=Xenopus laevis GN=col6a1 PE=1 SV=1 555 722 3.0E-14
sp|Q16992|LWA_ANTEL LWamide neuropeptides OS=Anthopleura elegantissima PE=1 SV=1 553 726 3.0E-14
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 787 1018 3.0E-14
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 818 1045 3.0E-14
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 557 723 3.0E-14
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 548 725 3.0E-14
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 823 1055 3.0E-14
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 557 1039 3.0E-14
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 782 1055 3.0E-14
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 792 1056 3.0E-14
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 790 1048 3.0E-14
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 557 943 3.0E-14
sp|Q07643|CO9A2_MOUSE Collagen alpha-2(IX) chain OS=Mus musculus GN=Col9a2 PE=2 SV=1 593 959 3.0E-14
sp|Q9QZR9|CO4A4_MOUSE Collagen alpha-4(IV) chain OS=Mus musculus GN=Col4a4 PE=2 SV=1 573 726 3.0E-14
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 790 1054 3.0E-14
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 796 1051 3.0E-14
sp|P98085|COLE_LEPMA Inner ear-specific collagen OS=Lepomis macrochirus PE=2 SV=1 785 940 3.0E-14
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 829 997 3.0E-14
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 824 995 3.0E-14
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 556 722 3.0E-14
sp|P39061|COIA1_MOUSE Collagen alpha-1(XVIII) chain OS=Mus musculus GN=Col18a1 PE=1 SV=4 785 1051 3.0E-14
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 545 726 4.0E-14
sp|P12110|CO6A2_HUMAN Collagen alpha-2(VI) chain OS=Homo sapiens GN=COL6A2 PE=1 SV=4 557 725 4.0E-14
sp|P23206|COAA1_BOVIN Collagen alpha-1(X) chain OS=Bos taurus GN=COL10A1 PE=2 SV=1 567 725 4.0E-14
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 557 726 4.0E-14
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 787 1054 4.0E-14
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 817 1054 4.0E-14
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 868 1036 4.0E-14
sp|Q09457|BLI1_CAEEL Cuticle collagen bli-1 OS=Caenorhabditis elegans GN=bli-1 PE=3 SV=2 939 1056 4.0E-14
sp|Q09457|BLI1_CAEEL Cuticle collagen bli-1 OS=Caenorhabditis elegans GN=bli-1 PE=3 SV=2 605 725 4.0E-14
sp|P34340|COL90_CAEEL Putative cuticle collagen 90 OS=Caenorhabditis elegans GN=col-90 PE=3 SV=1 849 971 4.0E-14
sp|Q60467|CO5A1_CRILO Collagen alpha-1(V) chain OS=Cricetulus longicaudatus GN=COL5A1 PE=2 SV=1 830 1036 4.0E-14
sp|Q9JI03|CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus GN=Col5a1 PE=1 SV=1 830 1036 4.0E-14
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 820 1054 5.0E-14
sp|P02461|CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens GN=COL3A1 PE=1 SV=4 557 719 5.0E-14
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 557 953 5.0E-14
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 826 1055 5.0E-14
sp|Q9QZR9|CO4A4_MOUSE Collagen alpha-4(IV) chain OS=Mus musculus GN=Col4a4 PE=2 SV=1 555 726 5.0E-14
sp|P12105|CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus GN=COL3A1 PE=2 SV=2 575 708 5.0E-14
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 556 722 5.0E-14
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 566 689 5.0E-14
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 829 997 5.0E-14
sp|O88207|CO5A1_MOUSE Collagen alpha-1(V) chain OS=Mus musculus GN=Col5a1 PE=1 SV=2 830 1036 5.0E-14
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 793 1045 6.0E-14
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 817 1055 6.0E-14
sp|Q9JMH4|COHA1_MESAU Collagen alpha-1(XVII) chain OS=Mesocricetus auratus GN=COL17A1 PE=2 SV=1 557 722 6.0E-14
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 824 995 6.0E-14
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 875 1045 6.0E-14
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 560 713 7.0E-14
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 552 714 7.0E-14
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 555 726 7.0E-14
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 790 1015 7.0E-14
sp|P02461|CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens GN=COL3A1 PE=1 SV=4 552 719 7.0E-14
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 785 1055 7.0E-14
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 827 1055 7.0E-14
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 881 1049 7.0E-14
sp|Q09578|COL75_CAEEL Putative cuticle collagen 75 OS=Caenorhabditis elegans GN=col-75 PE=3 SV=1 834 977 7.0E-14
sp|P34340|COL90_CAEEL Putative cuticle collagen 90 OS=Caenorhabditis elegans GN=col-90 PE=3 SV=1 870 1000 7.0E-14
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 557 725 8.0E-14
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 552 723 8.0E-14
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 808 1055 8.0E-14
sp|Q05306|COAA1_MOUSE Collagen alpha-1(X) chain OS=Mus musculus GN=Col10a1 PE=2 SV=1 543 701 8.0E-14
sp|Q9QZR9|CO4A4_MOUSE Collagen alpha-4(IV) chain OS=Mus musculus GN=Col4a4 PE=2 SV=1 563 717 8.0E-14
sp|A6NE01|F186A_HUMAN Protein FAM186A OS=Homo sapiens GN=FAM186A PE=2 SV=3 787 1058 8.0E-14
sp|Q9N281|COHA1_CANLF Collagen alpha-1(XVII) chain OS=Canis lupus familiaris GN=COL17A1 PE=2 SV=2 786 998 8.0E-14
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 802 1043 8.0E-14
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 556 726 9.0E-14
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 557 725 9.0E-14
sp|P02461|CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens GN=COL3A1 PE=1 SV=4 557 725 9.0E-14
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 552 725 9.0E-14
sp|Q9N281|COHA1_CANLF Collagen alpha-1(XVII) chain OS=Canis lupus familiaris GN=COL17A1 PE=2 SV=2 856 1056 9.0E-14
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 808 1025 9.0E-14
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 793 1051 9.0E-14
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 799 1030 9.0E-14
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 787 1024 1.0E-13
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 552 692 1.0E-13
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 532 726 1.0E-13
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 555 705 1.0E-13
sp|Q60754|MARCO_MOUSE Macrophage receptor MARCO OS=Mus musculus GN=Marco PE=1 SV=1 556 693 1.0E-13
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 552 716 1.0E-13
sp|Q02788|CO6A2_MOUSE Collagen alpha-2(VI) chain OS=Mus musculus GN=Col6a2 PE=1 SV=3 555 719 1.0E-13
sp|P15989|CO6A3_CHICK Collagen alpha-3(VI) chain OS=Gallus gallus GN=COL6A3 PE=2 SV=2 557 725 1.0E-13
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 557 1039 1.0E-13
sp|A6NMZ7|CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens GN=COL6A6 PE=1 SV=2 557 725 1.0E-13
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 557 1055 1.0E-13
sp|P53420|CO4A4_HUMAN Collagen alpha-4(IV) chain OS=Homo sapiens GN=COL4A4 PE=1 SV=3 554 714 1.0E-13
sp|Q9QZS0|CO4A3_MOUSE Collagen alpha-3(IV) chain OS=Mus musculus GN=Col4a3 PE=1 SV=2 787 998 1.0E-13
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 693 1059 1.0E-13
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 817 1056 1.0E-13
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 817 1054 1.0E-13
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 875 1045 1.0E-13
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 886 1049 1.0E-13
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 790 958 1.0E-13
sp|B4YNE6|V6_SPTNK Collagen-like protein V6 OS=Sputnik virophage GN=ORF6 PE=3 SV=1 886 1002 1.0E-13
sp|B4YNE6|V6_SPTNK Collagen-like protein V6 OS=Sputnik virophage GN=ORF6 PE=3 SV=1 579 697 1.0E-13
sp|Q09578|COL75_CAEEL Putative cuticle collagen 75 OS=Caenorhabditis elegans GN=col-75 PE=3 SV=1 900 1039 1.0E-13
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 782 992 1.0E-13
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 555 723 2.0E-13
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 786 1055 2.0E-13
sp|P15988|CO6A2_CHICK Collagen alpha-2(VI) chain OS=Gallus gallus GN=COL6A2 PE=2 SV=1 555 726 2.0E-13
sp|P20849|CO9A1_HUMAN Collagen alpha-1(IX) chain OS=Homo sapiens GN=COL9A1 PE=1 SV=3 543 699 2.0E-13
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 555 689 2.0E-13
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 555 726 2.0E-13
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 785 1051 2.0E-13
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus GN=Nefh PE=1 SV=3 555 726 2.0E-13
sp|Q4ZJM7|OTOL1_MOUSE Otolin-1 OS=Mus musculus GN=Otol1 PE=1 SV=2 555 711 2.0E-13
sp|Q4ZJM7|OTOL1_MOUSE Otolin-1 OS=Mus musculus GN=Otol1 PE=1 SV=2 584 726 2.0E-13
sp|P53420|CO4A4_HUMAN Collagen alpha-4(IV) chain OS=Homo sapiens GN=COL4A4 PE=1 SV=3 556 723 2.0E-13
sp|Q28668|CO1A2_RABIT Collagen alpha-2(I) chain (Fragment) OS=Oryctolagus cuniculus GN=COL1A2 PE=2 SV=1 563 725 2.0E-13
sp|Q28668|CO1A2_RABIT Collagen alpha-2(I) chain (Fragment) OS=Oryctolagus cuniculus GN=COL1A2 PE=2 SV=1 555 716 2.0E-13
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 786 1045 2.0E-13
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 783 1039 2.0E-13
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 817 1054 2.0E-13
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 823 992 2.0E-13
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 563 719 2.0E-13
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 790 958 2.0E-13
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 785 1054 2.0E-13
sp|Q09578|COL75_CAEEL Putative cuticle collagen 75 OS=Caenorhabditis elegans GN=col-75 PE=3 SV=1 873 1027 2.0E-13
sp|Q9N281|COHA1_CANLF Collagen alpha-1(XVII) chain OS=Canis lupus familiaris GN=COL17A1 PE=2 SV=2 557 722 2.0E-13
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 790 1055 2.0E-13
sp|P34340|COL90_CAEEL Putative cuticle collagen 90 OS=Caenorhabditis elegans GN=col-90 PE=3 SV=1 601 722 2.0E-13
sp|Q5TAT6|CODA1_HUMAN Collagen alpha-1(XIII) chain OS=Homo sapiens GN=COL13A1 PE=1 SV=1 611 988 2.0E-13
sp|A6QPB3|COHA1_BOVIN Collagen alpha-1(XVII) chain OS=Bos taurus GN=COL17A1 PE=2 SV=1 769 973 2.0E-13
sp|A6QPB3|COHA1_BOVIN Collagen alpha-1(XVII) chain OS=Bos taurus GN=COL17A1 PE=2 SV=1 805 998 2.0E-13
sp|Q318P8|IF2_PROM9 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9312) GN=infB PE=3 SV=1 538 702 2.0E-13
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 785 1054 3.0E-13
sp|Q9WUB9|MARCO_MESAU Macrophage receptor MARCO OS=Mesocricetus auratus GN=MARCO PE=2 SV=1 556 672 3.0E-13
sp|Q0VF58|COJA1_MOUSE Collagen alpha-1(XIX) chain OS=Mus musculus GN=Col19a1 PE=2 SV=2 785 1009 3.0E-13
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 552 961 3.0E-13
sp|P98085|COLE_LEPMA Inner ear-specific collagen OS=Lepomis macrochirus PE=2 SV=1 785 955 3.0E-13
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 787 1045 3.0E-13
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 823 992 3.0E-13
sp|P16884|NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus GN=Nefh PE=1 SV=4 818 1054 3.0E-13
sp|P16884|NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus GN=Nefh PE=1 SV=4 786 1042 3.0E-13
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 787 1054 3.0E-13
sp|P34340|COL90_CAEEL Putative cuticle collagen 90 OS=Caenorhabditis elegans GN=col-90 PE=3 SV=1 785 907 3.0E-13
sp|Q60467|CO5A1_CRILO Collagen alpha-1(V) chain OS=Cricetulus longicaudatus GN=COL5A1 PE=2 SV=1 806 1003 3.0E-13
sp|Q9JI03|CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus GN=Col5a1 PE=1 SV=1 806 1003 3.0E-13
sp|Q07563|COHA1_MOUSE Collagen alpha-1(XVII) chain OS=Mus musculus GN=Col17a1 PE=1 SV=3 785 1013 3.0E-13
sp|Q07563|COHA1_MOUSE Collagen alpha-1(XVII) chain OS=Mus musculus GN=Col17a1 PE=1 SV=3 805 1040 3.0E-13
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 564 710 4.0E-13
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 557 704 4.0E-13
sp|P02461|CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens GN=COL3A1 PE=1 SV=4 868 1059 4.0E-13
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 804 1055 4.0E-13
sp|Q9QZS0|CO4A3_MOUSE Collagen alpha-3(IV) chain OS=Mus musculus GN=Col4a3 PE=1 SV=2 839 1062 4.0E-13
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 563 719 4.0E-13
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 786 953 4.0E-13
sp|B4YNE6|V6_SPTNK Collagen-like protein V6 OS=Sputnik virophage GN=ORF6 PE=3 SV=1 845 960 4.0E-13
sp|Q09578|COL75_CAEEL Putative cuticle collagen 75 OS=Caenorhabditis elegans GN=col-75 PE=3 SV=1 798 937 4.0E-13
sp|Q09578|COL75_CAEEL Putative cuticle collagen 75 OS=Caenorhabditis elegans GN=col-75 PE=3 SV=1 785 926 4.0E-13
sp|P39061|COIA1_MOUSE Collagen alpha-1(XVIII) chain OS=Mus musculus GN=Col18a1 PE=1 SV=4 833 1049 4.0E-13
sp|Q60467|CO5A1_CRILO Collagen alpha-1(V) chain OS=Cricetulus longicaudatus GN=COL5A1 PE=2 SV=1 850 1042 4.0E-13
sp|Q9JI03|CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus GN=Col5a1 PE=1 SV=1 850 1042 4.0E-13
sp|O88207|CO5A1_MOUSE Collagen alpha-1(V) chain OS=Mus musculus GN=Col5a1 PE=1 SV=2 806 1003 4.0E-13
sp|Q318P8|IF2_PROM9 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9312) GN=infB PE=3 SV=1 587 713 4.0E-13
sp|Q318P8|IF2_PROM9 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9312) GN=infB PE=3 SV=1 799 889 4.0E-13
sp|Q7UZZ9|IF2_PROMP Translation initiation factor IF-2 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=infB PE=3 SV=1 544 710 4.0E-13
sp|Q03692|COAA1_HUMAN Collagen alpha-1(X) chain OS=Homo sapiens GN=COL10A1 PE=1 SV=2 791 1039 4.0E-13
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 790 1059 5.0E-13
sp|Q801S8|CO6A1_XENLA Collagen alpha-1(VI) chain OS=Xenopus laevis GN=col6a1 PE=1 SV=1 557 707 5.0E-13
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 802 1056 5.0E-13
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 830 1055 5.0E-13
sp|A5PN28|OTO1A_DANRE Otolin-1-A OS=Danio rerio GN=otol1a PE=2 SV=1 572 710 5.0E-13
sp|P83371|OTOL1_ONCKE Otolin-1 OS=Oncorhynchus keta GN=otol1 PE=1 SV=1 836 1008 5.0E-13
sp|O88207|CO5A1_MOUSE Collagen alpha-1(V) chain OS=Mus musculus GN=Col5a1 PE=1 SV=2 850 1042 5.0E-13
sp|Q2UY11|COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus GN=Col28a1 PE=2 SV=1 787 1048 5.0E-13
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 559 726 6.0E-13
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 600 726 6.0E-13
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 823 1055 6.0E-13
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 809 1049 6.0E-13
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 785 1056 6.0E-13
sp|Q318P8|IF2_PROM9 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9312) GN=infB PE=3 SV=1 874 967 6.0E-13
sp|Q318P8|IF2_PROM9 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9312) GN=infB PE=3 SV=1 919 1046 6.0E-13
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 557 716 7.0E-13
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 785 1007 7.0E-13
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 555 719 7.0E-13
sp|P34340|COL90_CAEEL Putative cuticle collagen 90 OS=Caenorhabditis elegans GN=col-90 PE=3 SV=1 780 925 7.0E-13
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 556 707 8.0E-13
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 785 1000 8.0E-13
sp|P12111|CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens GN=COL6A3 PE=1 SV=5 555 719 8.0E-13
sp|P08121|CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculus GN=Col3a1 PE=1 SV=4 555 713 8.0E-13
sp|P12105|CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus GN=COL3A1 PE=2 SV=2 555 714 8.0E-13
sp|B4YNE6|V6_SPTNK Collagen-like protein V6 OS=Sputnik virophage GN=ORF6 PE=3 SV=1 935 1061 8.0E-13
sp|B4YNE6|V6_SPTNK Collagen-like protein V6 OS=Sputnik virophage GN=ORF6 PE=3 SV=1 914 1035 8.0E-13
sp|Q07092|COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens GN=COL16A1 PE=1 SV=2 548 940 8.0E-13
sp|Q9QZR9|CO4A4_MOUSE Collagen alpha-4(IV) chain OS=Mus musculus GN=Col4a4 PE=2 SV=1 552 707 9.0E-13
sp|Q14050|CO9A3_HUMAN Collagen alpha-3(IX) chain OS=Homo sapiens GN=COL9A3 PE=1 SV=2 782 989 9.0E-13
sp|P34340|COL90_CAEEL Putative cuticle collagen 90 OS=Caenorhabditis elegans GN=col-90 PE=3 SV=1 915 1036 9.0E-13
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 557 725 1.0E-12
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 555 689 1.0E-12
sp|P20849|CO9A1_HUMAN Collagen alpha-1(IX) chain OS=Homo sapiens GN=COL9A1 PE=1 SV=3 873 1055 1.0E-12
sp|Q28247|CO4A5_CANLF Collagen alpha-5(IV) chain OS=Canis lupus familiaris GN=COL4A5 PE=2 SV=2 555 726 1.0E-12
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 786 997 1.0E-12
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 786 1054 1.0E-12
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 779 1051 1.0E-12
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 557 722 1.0E-12
sp|P08125|COAA1_CHICK Collagen alpha-1(X) chain OS=Gallus gallus GN=COL10A1 PE=1 SV=4 787 980 1.0E-12
sp|Q9JMH4|COHA1_MESAU Collagen alpha-1(XVII) chain OS=Mesocricetus auratus GN=COL17A1 PE=2 SV=1 557 676 1.0E-12
sp|Q14993|COJA1_HUMAN Collagen alpha-1(XIX) chain OS=Homo sapiens GN=COL19A1 PE=1 SV=3 404 725 1.0E-12
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 787 1043 1.0E-12
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 787 953 1.0E-12
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 902 1058 1.0E-12
sp|Q09578|COL75_CAEEL Putative cuticle collagen 75 OS=Caenorhabditis elegans GN=col-75 PE=3 SV=1 861 1001 1.0E-12
sp|P16884|NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus GN=Nefh PE=1 SV=4 786 1053 1.0E-12
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 779 1056 1.0E-12
sp|P83371|OTOL1_ONCKE Otolin-1 OS=Oncorhynchus keta GN=otol1 PE=1 SV=1 818 993 1.0E-12
sp|P34340|COL90_CAEEL Putative cuticle collagen 90 OS=Caenorhabditis elegans GN=col-90 PE=3 SV=1 939 1056 1.0E-12
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 821 1054 1.0E-12
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 829 1012 1.0E-12
sp|Q318P8|IF2_PROM9 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9312) GN=infB PE=3 SV=1 624 720 1.0E-12
sp|Q318P8|IF2_PROM9 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9312) GN=infB PE=3 SV=1 786 899 1.0E-12
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 552 710 2.0E-12
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 593 726 2.0E-12
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 537 726 2.0E-12
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 557 725 2.0E-12
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 552 722 2.0E-12
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 557 726 2.0E-12
sp|Q05306|COAA1_MOUSE Collagen alpha-1(X) chain OS=Mus musculus GN=Col10a1 PE=2 SV=1 891 1059 2.0E-12
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 560 702 2.0E-12
sp|Q02788|CO6A2_MOUSE Collagen alpha-2(VI) chain OS=Mus musculus GN=Col6a2 PE=1 SV=3 616 726 2.0E-12
sp|P08121|CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculus GN=Col3a1 PE=1 SV=4 564 725 2.0E-12
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus GN=Nefh PE=1 SV=3 556 721 2.0E-12
sp|Q04857|CO6A1_MOUSE Collagen alpha-1(VI) chain OS=Mus musculus GN=Col6a1 PE=1 SV=1 547 686 2.0E-12
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 578 1039 2.0E-12
sp|A6NMZ7|CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens GN=COL6A6 PE=1 SV=2 565 675 2.0E-12
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 556 726 2.0E-12
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 557 726 2.0E-12
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 819 1046 2.0E-12
sp|Q9QZS0|CO4A3_MOUSE Collagen alpha-3(IV) chain OS=Mus musculus GN=Col4a3 PE=1 SV=2 656 1030 2.0E-12
sp|A6NE01|F186A_HUMAN Protein FAM186A OS=Homo sapiens GN=FAM186A PE=2 SV=3 802 1047 2.0E-12
sp|P12107|COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens GN=COL11A1 PE=1 SV=4 581 916 2.0E-12
sp|P98085|COLE_LEPMA Inner ear-specific collagen OS=Lepomis macrochirus PE=2 SV=1 555 695 2.0E-12
sp|P98085|COLE_LEPMA Inner ear-specific collagen OS=Lepomis macrochirus PE=2 SV=1 581 726 2.0E-12
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 838 1055 2.0E-12
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 787 1045 2.0E-12
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 786 944 2.0E-12
sp|B4YNE6|V6_SPTNK Collagen-like protein V6 OS=Sputnik virophage GN=ORF6 PE=3 SV=1 614 724 2.0E-12
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 786 1045 2.0E-12
sp|P34340|COL90_CAEEL Putative cuticle collagen 90 OS=Caenorhabditis elegans GN=col-90 PE=3 SV=1 918 1040 2.0E-12
sp|Q60467|CO5A1_CRILO Collagen alpha-1(V) chain OS=Cricetulus longicaudatus GN=COL5A1 PE=2 SV=1 788 970 2.0E-12
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 788 1007 2.0E-12
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 848 1042 2.0E-12
sp|Q318P8|IF2_PROM9 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9312) GN=infB PE=3 SV=1 877 1009 2.0E-12
sp|Q318P8|IF2_PROM9 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9312) GN=infB PE=3 SV=1 808 932 2.0E-12
sp|Q318P8|IF2_PROM9 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9312) GN=infB PE=3 SV=1 853 980 2.0E-12
sp|Q318P8|IF2_PROM9 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9312) GN=infB PE=3 SV=1 904 1016 2.0E-12
sp|Q03692|COAA1_HUMAN Collagen alpha-1(X) chain OS=Homo sapiens GN=COL10A1 PE=1 SV=2 786 1055 2.0E-12
sp|Q03637|COLQ_TORMA Acetylcholinesterase collagenic tail peptide OS=Torpedo marmorata PE=1 SV=1 874 997 2.0E-12
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 826 1039 3.0E-12
sp|P23206|COAA1_BOVIN Collagen alpha-1(X) chain OS=Bos taurus GN=COL10A1 PE=2 SV=1 545 689 3.0E-12
sp|Q16992|LWA_ANTEL LWamide neuropeptides OS=Anthopleura elegantissima PE=1 SV=1 557 726 3.0E-12
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 794 1058 3.0E-12
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 572 1051 3.0E-12
sp|P12106|CO9A1_CHICK Collagen alpha-1(IX) chain OS=Gallus gallus GN=COL9A1 PE=1 SV=4 830 1049 3.0E-12
sp|P12106|CO9A1_CHICK Collagen alpha-1(IX) chain OS=Gallus gallus GN=COL9A1 PE=1 SV=4 787 1027 3.0E-12
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 847 1054 3.0E-12
sp|P25318|CO8A2_MOUSE Collagen alpha-2(VIII) chain OS=Mus musculus GN=Col8a2 PE=2 SV=2 785 1039 3.0E-12
sp|Q9JMH4|COHA1_MESAU Collagen alpha-1(XVII) chain OS=Mesocricetus auratus GN=COL17A1 PE=2 SV=1 557 726 3.0E-12
sp|Q9JMH4|COHA1_MESAU Collagen alpha-1(XVII) chain OS=Mesocricetus auratus GN=COL17A1 PE=2 SV=1 558 709 3.0E-12
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 787 1045 3.0E-12
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 902 1058 3.0E-12
sp|P39061|COIA1_MOUSE Collagen alpha-1(XVIII) chain OS=Mus musculus GN=Col18a1 PE=1 SV=4 561 726 3.0E-12
sp|Q9JI03|CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus GN=Col5a1 PE=1 SV=1 788 970 3.0E-12
sp|O88207|CO5A1_MOUSE Collagen alpha-1(V) chain OS=Mus musculus GN=Col5a1 PE=1 SV=2 788 970 3.0E-12
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 811 994 3.0E-12
sp|Q318P8|IF2_PROM9 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9312) GN=infB PE=3 SV=1 861 986 3.0E-12
sp|P15988|CO6A2_CHICK Collagen alpha-2(VI) chain OS=Gallus gallus GN=COL6A2 PE=2 SV=1 555 719 4.0E-12
sp|Q16992|LWA_ANTEL LWamide neuropeptides OS=Anthopleura elegantissima PE=1 SV=1 553 726 4.0E-12
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 802 1056 4.0E-12
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus GN=Nefh PE=1 SV=3 558 726 4.0E-12
sp|A6NMZ7|CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens GN=COL6A6 PE=1 SV=2 555 717 4.0E-12
sp|Q8BLX7|COGA1_MOUSE Collagen alpha-1(XVI) chain OS=Mus musculus GN=Col16a1 PE=1 SV=2 543 725 4.0E-12
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 562 725 4.0E-12
sp|A6NHN0|OTOL1_HUMAN Otolin-1 OS=Homo sapiens GN=OTOL1 PE=3 SV=1 552 725 4.0E-12
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 802 1003 4.0E-12
sp|Q9JMH4|COHA1_MESAU Collagen alpha-1(XVII) chain OS=Mesocricetus auratus GN=COL17A1 PE=2 SV=1 886 1054 4.0E-12
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 537 726 4.0E-12
sp|G1UBC2|PGA47_CANAL Cell wall adhesin EAP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EAP1 PE=1 SV=1 894 1057 4.0E-12
sp|Q07092|COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens GN=COL16A1 PE=1 SV=2 786 964 4.0E-12
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 563 726 4.0E-12
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 788 1039 4.0E-12
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 563 719 4.0E-12
sp|Q03637|COLQ_TORMA Acetylcholinesterase collagenic tail peptide OS=Torpedo marmorata PE=1 SV=1 907 1036 4.0E-12
sp|Q03637|COLQ_TORMA Acetylcholinesterase collagenic tail peptide OS=Torpedo marmorata PE=1 SV=1 838 968 4.0E-12
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 557 710 5.0E-12
sp|Q8NFW1|COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens GN=COL22A1 PE=2 SV=2 786 1058 5.0E-12
sp|Q28247|CO4A5_CANLF Collagen alpha-5(IV) chain OS=Canis lupus familiaris GN=COL4A5 PE=2 SV=2 563 725 5.0E-12
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 776 1056 5.0E-12
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 787 1027 5.0E-12
sp|P12107|COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens GN=COL11A1 PE=1 SV=4 563 719 5.0E-12
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 578 701 5.0E-12
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 563 719 5.0E-12
sp|Q318P8|IF2_PROM9 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9312) GN=infB PE=3 SV=1 605 725 5.0E-12
sp|C0HJN8|CO1A2_TAPTE Collagen alpha-2(I) chain (Fragments) OS=Tapirus terrestris GN=COL1A2 PE=1 SV=1 557 1043 5.0E-12
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 796 1056 5.0E-12
sp|Q4ZJN1|C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus GN=C1qtnf9 PE=1 SV=1 844 1012 5.0E-12
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 874 1058 6.0E-12
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus GN=Nefh PE=1 SV=3 555 726 6.0E-12
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus GN=Nefh PE=1 SV=3 559 721 6.0E-12
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 555 724 6.0E-12
sp|A6NMZ7|CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens GN=COL6A6 PE=1 SV=2 557 725 6.0E-12
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 808 1031 6.0E-12
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 557 1056 6.0E-12
sp|P29400|CO4A5_HUMAN Collagen alpha-5(IV) chain OS=Homo sapiens GN=COL4A5 PE=1 SV=2 800 1059 6.0E-12
sp|Q28668|CO1A2_RABIT Collagen alpha-2(I) chain (Fragment) OS=Oryctolagus cuniculus GN=COL1A2 PE=2 SV=1 555 722 6.0E-12
sp|P98085|COLE_LEPMA Inner ear-specific collagen OS=Lepomis macrochirus PE=2 SV=1 578 726 6.0E-12
sp|Q14050|CO9A3_HUMAN Collagen alpha-3(IX) chain OS=Homo sapiens GN=COL9A3 PE=1 SV=2 560 714 6.0E-12
sp|Q318P8|IF2_PROM9 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9312) GN=infB PE=3 SV=1 829 956 6.0E-12
sp|Q03637|COLQ_TORMA Acetylcholinesterase collagenic tail peptide OS=Torpedo marmorata PE=1 SV=1 799 922 6.0E-12
sp|P02461|CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens GN=COL3A1 PE=1 SV=4 557 725 8.0E-12
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 776 1056 8.0E-12
sp|Q04857|CO6A1_MOUSE Collagen alpha-1(VI) chain OS=Mus musculus GN=Col6a1 PE=1 SV=1 553 719 8.0E-12
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 557 714 8.0E-12
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 814 1021 8.0E-12
sp|Q14050|CO9A3_HUMAN Collagen alpha-3(IX) chain OS=Homo sapiens GN=COL9A3 PE=1 SV=2 544 708 8.0E-12
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 824 1065 9.0E-12
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 785 1061 9.0E-12
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 572 1055 9.0E-12
sp|P12108|CO9A2_CHICK Collagen alpha-2(IX) chain OS=Gallus gallus GN=COL9A2 PE=1 SV=3 832 1058 9.0E-12
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 587 893 1.0E-11
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 467 723 1.0E-11
sp|P08120|CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster GN=Cg25C PE=2 SV=3 893 1059 1.0E-11
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 557 726 1.0E-11
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 782 1055 1.0E-11
sp|P23206|COAA1_BOVIN Collagen alpha-1(X) chain OS=Bos taurus GN=COL10A1 PE=2 SV=1 557 817 1.0E-11
sp|P23206|COAA1_BOVIN Collagen alpha-1(X) chain OS=Bos taurus GN=COL10A1 PE=2 SV=1 785 916 1.0E-11
sp|Q16992|LWA_ANTEL LWamide neuropeptides OS=Anthopleura elegantissima PE=1 SV=1 553 720 1.0E-11
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 556 686 1.0E-11
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 871 1062 1.0E-11
sp|A6NMZ7|CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens GN=COL6A6 PE=1 SV=2 625 725 1.0E-11
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 562 725 1.0E-11
sp|Q9QZS0|CO4A3_MOUSE Collagen alpha-3(IV) chain OS=Mus musculus GN=Col4a3 PE=1 SV=2 788 1055 1.0E-11
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 823 1024 1.0E-11
sp|Q9JMH4|COHA1_MESAU Collagen alpha-1(XVII) chain OS=Mesocricetus auratus GN=COL17A1 PE=2 SV=1 555 725 1.0E-11
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 838 1055 1.0E-11
sp|P18856|CAF1_EPHMU Collagen EMF1-alpha (Fragment) OS=Ephydatia muelleri GN=COLF1 PE=3 SV=2 552 725 1.0E-11
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 555 717 1.0E-11
sp|C0HJN3|CO1A1_ORYAF Collagen alpha-1(I) chain (Fragments) OS=Orycteropus afer GN=COL1A1 PE=1 SV=1 650 1021 1.0E-11
sp|P83371|OTOL1_ONCKE Otolin-1 OS=Oncorhynchus keta GN=otol1 PE=1 SV=1 806 978 1.0E-11
sp|P34340|COL90_CAEEL Putative cuticle collagen 90 OS=Caenorhabditis elegans GN=col-90 PE=3 SV=1 796 946 1.0E-11
sp|P34340|COL90_CAEEL Putative cuticle collagen 90 OS=Caenorhabditis elegans GN=col-90 PE=3 SV=1 930 1051 1.0E-11
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 880 1045 1.0E-11
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 783 1045 1.0E-11
sp|Q03637|COLQ_TORMA Acetylcholinesterase collagenic tail peptide OS=Torpedo marmorata PE=1 SV=1 883 1021 1.0E-11
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 805 1024 1.0E-11
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 783 1045 1.0E-11
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 874 1013 1.0E-11
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 555 726 2.0E-11
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 556 701 2.0E-11
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 552 711 2.0E-11
sp|A8TX70|CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens GN=COL6A5 PE=1 SV=1 604 726 2.0E-11
sp|P20785|CO6A1_CHICK Collagen alpha-1(VI) chain OS=Gallus gallus GN=COL6A1 PE=2 SV=1 556 687 2.0E-11
sp|P12110|CO6A2_HUMAN Collagen alpha-2(VI) chain OS=Homo sapiens GN=COL6A2 PE=1 SV=4 555 722 2.0E-11
sp|Q16992|LWA_ANTEL LWamide neuropeptides OS=Anthopleura elegantissima PE=1 SV=1 553 726 2.0E-11
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 865 1059 2.0E-11
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 891 1042 2.0E-11
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 796 1045 2.0E-11
sp|A6NMZ7|CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens GN=COL6A6 PE=1 SV=2 568 714 2.0E-11
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 557 1015 2.0E-11
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 556 726 2.0E-11
sp|P53420|CO4A4_HUMAN Collagen alpha-4(IV) chain OS=Homo sapiens GN=COL4A4 PE=1 SV=3 548 702 2.0E-11
sp|P12106|CO9A1_CHICK Collagen alpha-1(IX) chain OS=Gallus gallus GN=COL9A1 PE=1 SV=4 557 725 2.0E-11
sp|P29400|CO4A5_HUMAN Collagen alpha-5(IV) chain OS=Homo sapiens GN=COL4A5 PE=1 SV=2 790 994 2.0E-11
sp|Q28668|CO1A2_RABIT Collagen alpha-2(I) chain (Fragment) OS=Oryctolagus cuniculus GN=COL1A2 PE=2 SV=1 555 720 2.0E-11
sp|G1UBC2|PGA47_CANAL Cell wall adhesin EAP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EAP1 PE=1 SV=1 674 933 2.0E-11
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 556 668 2.0E-11
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 555 717 2.0E-11
sp|Q09578|COL75_CAEEL Putative cuticle collagen 75 OS=Caenorhabditis elegans GN=col-75 PE=3 SV=1 571 720 2.0E-11
sp|Q09457|BLI1_CAEEL Cuticle collagen bli-1 OS=Caenorhabditis elegans GN=bli-1 PE=3 SV=2 617 726 2.0E-11
sp|Q07092|COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens GN=COL16A1 PE=1 SV=2 784 1056 2.0E-11
sp|Q14050|CO9A3_HUMAN Collagen alpha-3(IX) chain OS=Homo sapiens GN=COL9A3 PE=1 SV=2 584 722 2.0E-11
sp|Q14050|CO9A3_HUMAN Collagen alpha-3(IX) chain OS=Homo sapiens GN=COL9A3 PE=1 SV=2 552 716 2.0E-11
sp|Q60467|CO5A1_CRILO Collagen alpha-1(V) chain OS=Cricetulus longicaudatus GN=COL5A1 PE=2 SV=1 555 719 2.0E-11
sp|Q9JI03|CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus GN=Col5a1 PE=1 SV=1 555 719 2.0E-11
sp|O88207|CO5A1_MOUSE Collagen alpha-1(V) chain OS=Mus musculus GN=Col5a1 PE=1 SV=2 555 719 2.0E-11
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 787 1054 2.0E-11
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 793 1055 2.0E-11
sp|Q03637|COLQ_TORMA Acetylcholinesterase collagenic tail peptide OS=Torpedo marmorata PE=1 SV=1 814 943 2.0E-11
sp|Q03637|COLQ_TORMA Acetylcholinesterase collagenic tail peptide OS=Torpedo marmorata PE=1 SV=1 569 698 2.0E-11
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 787 878 2.0E-11
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 578 710 2.0E-11
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 578 663 2.0E-11
sp|Q23628|LON3_CAEEL Cuticle collagen lon-3 OS=Caenorhabditis elegans GN=lon-3 PE=1 SV=1 892 1070 2.0E-11
sp|Q23628|LON3_CAEEL Cuticle collagen lon-3 OS=Caenorhabditis elegans GN=lon-3 PE=1 SV=1 844 1010 2.0E-11
sp|Q28083|COBA1_BOVIN Collagen alpha-1(XI) chain (Fragment) OS=Bos taurus GN=COL11A1 PE=1 SV=1 805 1051 2.0E-11
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 808 1054 2.0E-11
sp|P39060|COIA1_HUMAN Collagen alpha-1(XVIII) chain OS=Homo sapiens GN=COL18A1 PE=1 SV=5 835 1049 2.0E-11
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 787 938 3.0E-11
sp|Q30D77|COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus GN=Col24a1 PE=2 SV=2 596 726 3.0E-11
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 578 1037 3.0E-11
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 782 1056 3.0E-11
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 802 1056 3.0E-11
sp|P53420|CO4A4_HUMAN Collagen alpha-4(IV) chain OS=Homo sapiens GN=COL4A4 PE=1 SV=3 781 1030 3.0E-11
sp|P12107|COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens GN=COL11A1 PE=1 SV=4 856 1056 3.0E-11
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 797 1055 3.0E-11
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 838 1055 3.0E-11
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 808 1003 3.0E-11
sp|A6QPB3|COHA1_BOVIN Collagen alpha-1(XVII) chain OS=Bos taurus GN=COL17A1 PE=2 SV=1 557 722 3.0E-11
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 566 654 3.0E-11
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 796 1055 3.0E-11
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 862 1021 3.0E-11
sp|P32018|COEA1_CHICK Collagen alpha-1(XIV) chain OS=Gallus gallus GN=COL14A1 PE=1 SV=2 787 959 3.0E-11
sp|Q2UY09|COSA1_HUMAN Collagen alpha-1(XXVIII) chain OS=Homo sapiens GN=COL28A1 PE=2 SV=2 803 1059 3.0E-11
sp|P0C2W8|CO1A1_MAMAE Collagen alpha-1(I) chain OS=Mammut americanum GN=COL1A1 PE=1 SV=4 785 1042 3.0E-11
sp|P04258|CO3A1_BOVIN Collagen alpha-1(III) chain OS=Bos taurus GN=COL3A1 PE=1 SV=1 796 1007 3.0E-11
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 833 1056 4.0E-11
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 555 726 4.0E-11
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 556 689 4.0E-11
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 802 1003 4.0E-11
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 607 726 4.0E-11
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 555 724 4.0E-11
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 557 726 4.0E-11
sp|A5PN28|OTO1A_DANRE Otolin-1-A OS=Danio rerio GN=otol1a PE=2 SV=1 555 715 4.0E-11
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 790 1054 4.0E-11
sp|P0C2W8|CO1A1_MAMAE Collagen alpha-1(I) chain OS=Mammut americanum GN=COL1A1 PE=1 SV=4 786 1055 4.0E-11
sp|Q01443|SSP2_PLAYO Sporozoite surface protein 2 OS=Plasmodium yoelii yoelii GN=SSP2 PE=1 SV=2 949 1035 4.0E-11
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 940 1058 5.0E-11
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 537 726 5.0E-11
sp|P02461|CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens GN=COL3A1 PE=1 SV=4 572 704 5.0E-11
sp|P12109|CO6A1_HUMAN Collagen alpha-1(VI) chain OS=Homo sapiens GN=COL6A1 PE=1 SV=3 555 719 5.0E-11
sp|Q8NFW1|COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens GN=COL22A1 PE=2 SV=2 557 725 5.0E-11
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 847 1054 5.0E-11
sp|P08121|CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculus GN=Col3a1 PE=1 SV=4 557 726 5.0E-11
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 786 1055 5.0E-11
sp|Q03637|COLQ_TORMA Acetylcholinesterase collagenic tail peptide OS=Torpedo marmorata PE=1 SV=1 802 931 5.0E-11
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 970 1055 5.0E-11
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 793 884 5.0E-11
sp|Q2UY09|COSA1_HUMAN Collagen alpha-1(XXVIII) chain OS=Homo sapiens GN=COL28A1 PE=2 SV=2 787 1031 5.0E-11
sp|Q6XPR3|RPTN_HUMAN Repetin OS=Homo sapiens GN=RPTN PE=1 SV=1 783 1054 5.0E-11
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 641 1055 6.0E-11
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 544 725 6.0E-11
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 778 946 6.0E-11
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus GN=Nefh PE=1 SV=3 893 1057 6.0E-11
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 841 1054 6.0E-11
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 817 1054 6.0E-11
sp|P16884|NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus GN=Nefh PE=1 SV=4 848 1057 6.0E-11
sp|C0HJN8|CO1A2_TAPTE Collagen alpha-2(I) chain (Fragments) OS=Tapirus terrestris GN=COL1A2 PE=1 SV=1 659 1056 6.0E-11
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 572 663 6.0E-11
sp|Q28083|COBA1_BOVIN Collagen alpha-1(XI) chain (Fragment) OS=Bos taurus GN=COL11A1 PE=1 SV=1 786 1036 6.0E-11
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 820 979 6.0E-11
sp|Q01443|SSP2_PLAYO Sporozoite surface protein 2 OS=Plasmodium yoelii yoelii GN=SSP2 PE=1 SV=2 566 724 6.0E-11
sp|Q9UMD9|COHA1_HUMAN Collagen alpha-1(XVII) chain OS=Homo sapiens GN=COL17A1 PE=1 SV=3 785 998 6.0E-11
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 557 716 7.0E-11
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 563 714 7.0E-11
sp|P12109|CO6A1_HUMAN Collagen alpha-1(VI) chain OS=Homo sapiens GN=COL6A1 PE=1 SV=3 966 1058 7.0E-11
sp|Q16992|LWA_ANTEL LWamide neuropeptides OS=Anthopleura elegantissima PE=1 SV=1 553 726 7.0E-11
sp|Q8NFW1|COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens GN=COL22A1 PE=2 SV=2 564 720 7.0E-11
sp|Q8NFW1|COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens GN=COL22A1 PE=2 SV=2 785 991 7.0E-11
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 820 1046 7.0E-11
sp|P39061|COIA1_MOUSE Collagen alpha-1(XVIII) chain OS=Mus musculus GN=Col18a1 PE=1 SV=4 821 1055 7.0E-11
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 779 959 7.0E-11
sp|Q14050|CO9A3_HUMAN Collagen alpha-3(IX) chain OS=Homo sapiens GN=COL9A3 PE=1 SV=2 585 710 7.0E-11
sp|P12108|CO9A2_CHICK Collagen alpha-2(IX) chain OS=Gallus gallus GN=COL9A2 PE=1 SV=3 557 716 7.0E-11
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 805 889 7.0E-11
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 868 1027 7.0E-11
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 557 726 8.0E-11
sp|A6NMZ7|CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens GN=COL6A6 PE=1 SV=2 586 696 8.0E-11
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 555 716 8.0E-11
sp|Q07092|COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens GN=COL16A1 PE=1 SV=2 557 842 8.0E-11
sp|Q03637|COLQ_TORMA Acetylcholinesterase collagenic tail peptide OS=Torpedo marmorata PE=1 SV=1 572 701 8.0E-11
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 787 1046 8.0E-11
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 522 713 9.0E-11
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 557 725 9.0E-11
sp|P08125|COAA1_CHICK Collagen alpha-1(X) chain OS=Gallus gallus GN=COL10A1 PE=1 SV=4 560 725 9.0E-11
sp|P12106|CO9A1_CHICK Collagen alpha-1(IX) chain OS=Gallus gallus GN=COL9A1 PE=1 SV=4 560 725 9.0E-11
sp|P12107|COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens GN=COL11A1 PE=1 SV=4 543 725 9.0E-11
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 686 1028 9.0E-11
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 808 1054 9.0E-11
sp|Q4ZJN1|C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus GN=C1qtnf9 PE=1 SV=1 805 973 9.0E-11
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 934 1019 9.0E-11
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 787 943 9.0E-11
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 565 725 1.0E-10
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 607 726 1.0E-10
sp|Q8C6K9|CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus GN=Col6a6 PE=1 SV=2 557 714 1.0E-10
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 552 699 1.0E-10
sp|P02461|CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens GN=COL3A1 PE=1 SV=4 549 681 1.0E-10
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 549 725 1.0E-10
sp|Q04857|CO6A1_MOUSE Collagen alpha-1(VI) chain OS=Mus musculus GN=Col6a1 PE=1 SV=1 786 961 1.0E-10
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 555 726 1.0E-10
sp|A6NMZ7|CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens GN=COL6A6 PE=1 SV=2 610 713 1.0E-10
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 555 720 1.0E-10
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 560 725 1.0E-10
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 556 725 1.0E-10
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 783 967 1.0E-10
sp|P83371|OTOL1_ONCKE Otolin-1 OS=Oncorhynchus keta GN=otol1 PE=1 SV=1 797 948 1.0E-10
sp|A6QPB3|COHA1_BOVIN Collagen alpha-1(XVII) chain OS=Bos taurus GN=COL17A1 PE=2 SV=1 578 675 1.0E-10
sp|Q4ZJN1|C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus GN=C1qtnf9 PE=1 SV=1 868 1036 1.0E-10
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 856 947 1.0E-10
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 811 934 1.0E-10
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 560 644 1.0E-10
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 590 681 1.0E-10
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 868 952 1.0E-10
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 838 988 1.0E-10
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 563 725 1.0E-10
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 556 701 2.0E-10
sp|Q16992|LWA_ANTEL LWamide neuropeptides OS=Anthopleura elegantissima PE=1 SV=1 553 726 2.0E-10
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 840 1056 2.0E-10
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 814 1021 2.0E-10
sp|P15989|CO6A3_CHICK Collagen alpha-3(VI) chain OS=Gallus gallus GN=COL6A3 PE=2 SV=2 557 716 2.0E-10
sp|Q28247|CO4A5_CANLF Collagen alpha-5(IV) chain OS=Canis lupus familiaris GN=COL4A5 PE=2 SV=2 556 716 2.0E-10
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 604 722 2.0E-10
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus GN=Nefh PE=1 SV=3 555 724 2.0E-10
sp|Q04857|CO6A1_MOUSE Collagen alpha-1(VI) chain OS=Mus musculus GN=Col6a1 PE=1 SV=1 552 725 2.0E-10
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 555 724 2.0E-10
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 551 726 2.0E-10
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 549 717 2.0E-10
sp|Q9QZR9|CO4A4_MOUSE Collagen alpha-4(IV) chain OS=Mus musculus GN=Col4a4 PE=2 SV=1 541 683 2.0E-10
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 795 988 2.0E-10
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 565 932 2.0E-10
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 783 967 2.0E-10
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 783 1054 2.0E-10
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 783 1043 2.0E-10
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 783 967 2.0E-10
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 790 1024 2.0E-10
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 584 725 2.0E-10
sp|Q14050|CO9A3_HUMAN Collagen alpha-3(IX) chain OS=Homo sapiens GN=COL9A3 PE=1 SV=2 566 726 2.0E-10
sp|P34340|COL90_CAEEL Putative cuticle collagen 90 OS=Caenorhabditis elegans GN=col-90 PE=3 SV=1 592 714 2.0E-10
sp|Q60467|CO5A1_CRILO Collagen alpha-1(V) chain OS=Cricetulus longicaudatus GN=COL5A1 PE=2 SV=1 564 725 2.0E-10
sp|Q9JI03|CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus GN=Col5a1 PE=1 SV=1 564 725 2.0E-10
sp|O88207|CO5A1_MOUSE Collagen alpha-1(V) chain OS=Mus musculus GN=Col5a1 PE=1 SV=2 564 725 2.0E-10
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 584 725 2.0E-10
sp|Q07563|COHA1_MOUSE Collagen alpha-1(XVII) chain OS=Mus musculus GN=Col17a1 PE=1 SV=3 886 1054 2.0E-10
sp|Q7UZZ9|IF2_PROMP Translation initiation factor IF-2 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=infB PE=3 SV=1 551 678 2.0E-10
sp|Q03637|COLQ_TORMA Acetylcholinesterase collagenic tail peptide OS=Torpedo marmorata PE=1 SV=1 608 722 2.0E-10
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 787 1028 2.0E-10
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 844 929 2.0E-10
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 892 1024 2.0E-10
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 958 1042 2.0E-10
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 563 689 2.0E-10
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 844 1048 2.0E-10
sp|C0HJP6|CO1A2_MACSX Collagen alpha-2(I) chain (Fragments) OS=Macrauchenia sp. GN=COL1A2 PE=1 SV=1 796 1056 2.0E-10
sp|Q96WV6|YHU2_SCHPO Uncharacterized threonine-rich GPI-anchored glycoprotein PJ4664.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.02 PE=3 SV=1 503 1048 2.0E-10
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 553 723 3.0E-10
sp|A8TX70|CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens GN=COL6A5 PE=1 SV=1 939 1054 3.0E-10
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 557 720 3.0E-10
sp|P12111|CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens GN=COL6A3 PE=1 SV=5 934 1056 3.0E-10
sp|P20849|CO9A1_HUMAN Collagen alpha-1(IX) chain OS=Homo sapiens GN=COL9A1 PE=1 SV=3 549 725 3.0E-10
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 779 1056 3.0E-10
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 787 1054 3.0E-10
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 785 1015 3.0E-10
sp|P53420|CO4A4_HUMAN Collagen alpha-4(IV) chain OS=Homo sapiens GN=COL4A4 PE=1 SV=3 785 1052 3.0E-10
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 557 959 3.0E-10
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 783 967 3.0E-10
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 783 1054 3.0E-10
sp|P12105|CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus GN=COL3A1 PE=2 SV=2 624 725 3.0E-10
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 796 1039 3.0E-10
sp|P34340|COL90_CAEEL Putative cuticle collagen 90 OS=Caenorhabditis elegans GN=col-90 PE=3 SV=1 613 726 3.0E-10
sp|Q60467|CO5A1_CRILO Collagen alpha-1(V) chain OS=Cricetulus longicaudatus GN=COL5A1 PE=2 SV=1 805 1051 3.0E-10
sp|Q9JI03|CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus GN=Col5a1 PE=1 SV=1 805 1051 3.0E-10
sp|A6QPB3|COHA1_BOVIN Collagen alpha-1(XVII) chain OS=Bos taurus GN=COL17A1 PE=2 SV=1 886 1054 3.0E-10
sp|Q07563|COHA1_MOUSE Collagen alpha-1(XVII) chain OS=Mus musculus GN=Col17a1 PE=1 SV=3 555 722 3.0E-10
sp|Q2UY11|COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus GN=Col28a1 PE=2 SV=1 786 1022 3.0E-10
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 779 1006 3.0E-10
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 556 642 3.0E-10
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 632 720 3.0E-10
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 811 896 3.0E-10
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 544 704 3.0E-10
sp|P39060|COIA1_HUMAN Collagen alpha-1(XVIII) chain OS=Homo sapiens GN=COL18A1 PE=1 SV=5 823 1033 3.0E-10
sp|P04258|CO3A1_BOVIN Collagen alpha-1(III) chain OS=Bos taurus GN=COL3A1 PE=1 SV=1 862 1056 3.0E-10
sp|P35799|DPY2_CAEEL Cuticle collagen dpy-2 OS=Caenorhabditis elegans GN=dpy-2 PE=1 SV=1 870 1016 3.0E-10
sp|B7Z0K8|COLL1_DROME Collagen alpha chain CG42342 OS=Drosophila melanogaster GN=CG42342 PE=2 SV=1 781 1019 3.0E-10
sp|Q96P44|COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens GN=COL21A1 PE=2 SV=1 984 1062 4.0E-10
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 556 713 4.0E-10
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 563 725 4.0E-10
sp|P02461|CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens GN=COL3A1 PE=1 SV=4 590 725 4.0E-10
sp|Q16992|LWA_ANTEL LWamide neuropeptides OS=Anthopleura elegantissima PE=1 SV=1 553 715 4.0E-10
sp|Q8NFW1|COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens GN=COL22A1 PE=2 SV=2 560 698 4.0E-10
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 557 725 4.0E-10
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 557 726 4.0E-10
sp|P18856|CAF1_EPHMU Collagen EMF1-alpha (Fragment) OS=Ephydatia muelleri GN=COLF1 PE=3 SV=2 560 725 4.0E-10
sp|B4YNE6|V6_SPTNK Collagen-like protein V6 OS=Sputnik virophage GN=ORF6 PE=3 SV=1 792 879 4.0E-10
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 787 1054 4.0E-10
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 555 708 4.0E-10
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 779 1027 4.0E-10
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 813 1042 4.0E-10
sp|P83371|OTOL1_ONCKE Otolin-1 OS=Oncorhynchus keta GN=otol1 PE=1 SV=1 593 714 4.0E-10
sp|P83371|OTOL1_ONCKE Otolin-1 OS=Oncorhynchus keta GN=otol1 PE=1 SV=1 573 726 4.0E-10
sp|O88207|CO5A1_MOUSE Collagen alpha-1(V) chain OS=Mus musculus GN=Col5a1 PE=1 SV=2 805 1051 4.0E-10
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 776 1054 4.0E-10
sp|Q2UY11|COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus GN=Col28a1 PE=2 SV=1 566 710 4.0E-10
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 952 1037 4.0E-10
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 823 908 4.0E-10
sp|Q6XPR3|RPTN_HUMAN Repetin OS=Homo sapiens GN=RPTN PE=1 SV=1 785 1049 4.0E-10
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 557 726 5.0E-10
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 786 959 5.0E-10
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 540 725 5.0E-10
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 552 725 5.0E-10
sp|Q8NFW1|COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens GN=COL22A1 PE=2 SV=2 796 962 5.0E-10
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 850 1059 5.0E-10
sp|P39061|COIA1_MOUSE Collagen alpha-1(XVIII) chain OS=Mus musculus GN=Col18a1 PE=1 SV=4 555 726 5.0E-10
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 555 717 5.0E-10
sp|Q2UY11|COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus GN=Col28a1 PE=2 SV=1 786 1022 5.0E-10
sp|B7Z0K8|COLL1_DROME Collagen alpha chain CG42342 OS=Drosophila melanogaster GN=CG42342 PE=2 SV=1 611 723 5.0E-10
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 829 962 6.0E-10
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 570 719 6.0E-10
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 555 726 6.0E-10
sp|P29400|CO4A5_HUMAN Collagen alpha-5(IV) chain OS=Homo sapiens GN=COL4A5 PE=1 SV=2 932 1056 6.0E-10
sp|B4YNE6|V6_SPTNK Collagen-like protein V6 OS=Sputnik virophage GN=ORF6 PE=3 SV=1 621 725 6.0E-10
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 785 1054 6.0E-10
sp|Q14050|CO9A3_HUMAN Collagen alpha-3(IX) chain OS=Homo sapiens GN=COL9A3 PE=1 SV=2 552 725 6.0E-10
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 817 905 6.0E-10
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 946 1031 6.0E-10
sp|P17657|DPY13_CAEEL Cuticle collagen dpy-13 OS=Caenorhabditis elegans GN=dpy-13 PE=1 SV=2 785 896 6.0E-10
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 787 1028 6.0E-10
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 560 722 7.0E-10
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 835 1039 7.0E-10
sp|P08125|COAA1_CHICK Collagen alpha-1(X) chain OS=Gallus gallus GN=COL10A1 PE=1 SV=4 552 726 7.0E-10
sp|P12106|CO9A1_CHICK Collagen alpha-1(IX) chain OS=Gallus gallus GN=COL9A1 PE=1 SV=4 826 986 7.0E-10
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 785 1021 7.0E-10
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 787 1055 7.0E-10
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 786 866 7.0E-10
sp|P32018|COEA1_CHICK Collagen alpha-1(XIV) chain OS=Gallus gallus GN=COL14A1 PE=1 SV=2 578 725 7.0E-10
sp|P17657|DPY13_CAEEL Cuticle collagen dpy-13 OS=Caenorhabditis elegans GN=dpy-13 PE=1 SV=2 818 916 7.0E-10
sp|P17657|DPY13_CAEEL Cuticle collagen dpy-13 OS=Caenorhabditis elegans GN=dpy-13 PE=1 SV=2 869 994 7.0E-10
sp|P20908|CO5A1_HUMAN Collagen alpha-1(V) chain OS=Homo sapiens GN=COL5A1 PE=1 SV=3 851 1036 7.0E-10
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 566 726 8.0E-10
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 549 725 8.0E-10
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 555 725 8.0E-10
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 555 725 8.0E-10
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 557 887 8.0E-10
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 491 716 8.0E-10
sp|B4YNE6|V6_SPTNK Collagen-like protein V6 OS=Sputnik virophage GN=ORF6 PE=3 SV=1 556 658 8.0E-10
sp|Q4ZJN1|C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus GN=C1qtnf9 PE=1 SV=1 860 1030 8.0E-10
sp|Q23628|LON3_CAEEL Cuticle collagen lon-3 OS=Caenorhabditis elegans GN=lon-3 PE=1 SV=1 790 914 8.0E-10
sp|P39060|COIA1_HUMAN Collagen alpha-1(XVIII) chain OS=Homo sapiens GN=COL18A1 PE=1 SV=5 786 916 8.0E-10
sp|P35247|SFTPD_HUMAN Pulmonary surfactant-associated protein D OS=Homo sapiens GN=SFTPD PE=1 SV=3 764 948 8.0E-10
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 837 1061 9.0E-10
sp|P12109|CO6A1_HUMAN Collagen alpha-1(VI) chain OS=Homo sapiens GN=COL6A1 PE=1 SV=3 555 725 9.0E-10
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 560 726 9.0E-10
sp|Q9N281|COHA1_CANLF Collagen alpha-1(XVII) chain OS=Canis lupus familiaris GN=COL17A1 PE=2 SV=2 569 723 9.0E-10
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 545 726 1.0E-09
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 556 952 1.0E-09
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 559 724 1.0E-09
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 559 708 1.0E-09
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 530 725 1.0E-09
sp|P08125|COAA1_CHICK Collagen alpha-1(X) chain OS=Gallus gallus GN=COL10A1 PE=1 SV=4 552 701 1.0E-09
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 810 1045 1.0E-09
sp|Q14050|CO9A3_HUMAN Collagen alpha-3(IX) chain OS=Homo sapiens GN=COL9A3 PE=1 SV=2 552 725 1.0E-09
sp|Q07563|COHA1_MOUSE Collagen alpha-1(XVII) chain OS=Mus musculus GN=Col17a1 PE=1 SV=3 557 675 1.0E-09
sp|Q7UZZ9|IF2_PROMP Translation initiation factor IF-2 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=infB PE=3 SV=1 787 923 1.0E-09
sp|Q4ZJN1|C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus GN=C1qtnf9 PE=1 SV=1 824 995 1.0E-09
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 638 723 1.0E-09
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 916 1052 1.0E-09
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 835 926 1.0E-09
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 799 955 1.0E-09
sp|P39060|COIA1_HUMAN Collagen alpha-1(XVIII) chain OS=Homo sapiens GN=COL18A1 PE=1 SV=5 560 693 1.0E-09
sp|P17657|DPY13_CAEEL Cuticle collagen dpy-13 OS=Caenorhabditis elegans GN=dpy-13 PE=1 SV=2 609 723 1.0E-09
sp|P20908|CO5A1_HUMAN Collagen alpha-1(V) chain OS=Homo sapiens GN=COL5A1 PE=1 SV=3 809 1003 1.0E-09
sp|Q9R1N9|CODA1_MOUSE Collagen alpha-1(XIII) chain OS=Mus musculus GN=Col13a1 PE=2 SV=1 796 1037 1.0E-09
sp|Q86Y22|CONA1_HUMAN Collagen alpha-1(XXIII) chain OS=Homo sapiens GN=COL23A1 PE=1 SV=1 859 1055 1.0E-09
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 566 726 2.0E-09
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 549 725 2.0E-09
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 538 725 2.0E-09
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 589 713 2.0E-09
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 557 719 2.0E-09
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 538 725 2.0E-09
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 865 1055 2.0E-09
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 546 726 2.0E-09
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 556 725 2.0E-09
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 552 983 2.0E-09
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 557 725 2.0E-09
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 555 720 2.0E-09
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 555 723 2.0E-09
sp|Q8BLX7|COGA1_MOUSE Collagen alpha-1(XVI) chain OS=Mus musculus GN=Col16a1 PE=1 SV=2 557 839 2.0E-09
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 553 696 2.0E-09
sp|P53420|CO4A4_HUMAN Collagen alpha-4(IV) chain OS=Homo sapiens GN=COL4A4 PE=1 SV=3 839 1039 2.0E-09
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 559 725 2.0E-09
sp|B4YNE6|V6_SPTNK Collagen-like protein V6 OS=Sputnik virophage GN=ORF6 PE=3 SV=1 785 871 2.0E-09
sp|P39061|COIA1_MOUSE Collagen alpha-1(XVIII) chain OS=Mus musculus GN=Col18a1 PE=1 SV=4 555 724 2.0E-09
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 560 698 2.0E-09
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 560 698 2.0E-09
sp|A6QPB3|COHA1_BOVIN Collagen alpha-1(XVII) chain OS=Bos taurus GN=COL17A1 PE=2 SV=1 605 702 2.0E-09
sp|A6QPB3|COHA1_BOVIN Collagen alpha-1(XVII) chain OS=Bos taurus GN=COL17A1 PE=2 SV=1 557 681 2.0E-09
sp|Q7UZZ9|IF2_PROMP Translation initiation factor IF-2 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=infB PE=3 SV=1 784 908 2.0E-09
sp|Q7UZZ9|IF2_PROMP Translation initiation factor IF-2 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=infB PE=3 SV=1 896 1027 2.0E-09
sp|Q4ZJN1|C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus GN=C1qtnf9 PE=1 SV=1 829 997 2.0E-09
sp|Q23628|LON3_CAEEL Cuticle collagen lon-3 OS=Caenorhabditis elegans GN=lon-3 PE=1 SV=1 785 938 2.0E-09
sp|P39060|COIA1_HUMAN Collagen alpha-1(XVIII) chain OS=Homo sapiens GN=COL18A1 PE=1 SV=5 785 1051 2.0E-09
sp|P32018|COEA1_CHICK Collagen alpha-1(XIV) chain OS=Gallus gallus GN=COL14A1 PE=1 SV=2 844 1013 2.0E-09
sp|P32018|COEA1_CHICK Collagen alpha-1(XIV) chain OS=Gallus gallus GN=COL14A1 PE=1 SV=2 862 1024 2.0E-09
sp|C0HJP6|CO1A2_MACSX Collagen alpha-2(I) chain (Fragments) OS=Macrauchenia sp. GN=COL1A2 PE=1 SV=1 793 1030 2.0E-09
sp|P17657|DPY13_CAEEL Cuticle collagen dpy-13 OS=Caenorhabditis elegans GN=dpy-13 PE=1 SV=2 935 1046 2.0E-09
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 817 1056 2.0E-09
sp|P35247|SFTPD_HUMAN Pulmonary surfactant-associated protein D OS=Homo sapiens GN=SFTPD PE=1 SV=3 794 972 2.0E-09
sp|P35247|SFTPD_HUMAN Pulmonary surfactant-associated protein D OS=Homo sapiens GN=SFTPD PE=1 SV=3 872 1047 2.0E-09
sp|Q9R1N9|CODA1_MOUSE Collagen alpha-1(XIII) chain OS=Mus musculus GN=Col13a1 PE=2 SV=1 841 1046 2.0E-09
sp|Q21184|CO155_CAEEL Putative cuticle collagen 155 OS=Caenorhabditis elegans GN=col-155 PE=3 SV=3 863 1027 2.0E-09
sp|Q9Y215|COLQ_HUMAN Acetylcholinesterase collagenic tail peptide OS=Homo sapiens GN=COLQ PE=1 SV=2 844 970 2.0E-09
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 557 726 3.0E-09
sp|P02461|CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens GN=COL3A1 PE=1 SV=4 563 701 3.0E-09
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 787 1012 3.0E-09
sp|Q4ZJM7|OTOL1_MOUSE Otolin-1 OS=Mus musculus GN=Otol1 PE=1 SV=2 552 693 3.0E-09
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 543 726 3.0E-09
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 557 726 3.0E-09
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 555 725 3.0E-09
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 638 722 3.0E-09
sp|Q14993|COJA1_HUMAN Collagen alpha-1(XIX) chain OS=Homo sapiens GN=COL19A1 PE=1 SV=3 581 719 3.0E-09
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 557 725 3.0E-09
sp|Q4ZJN1|C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus GN=C1qtnf9 PE=1 SV=1 790 958 3.0E-09
sp|Q23628|LON3_CAEEL Cuticle collagen lon-3 OS=Caenorhabditis elegans GN=lon-3 PE=1 SV=1 551 714 3.0E-09
sp|Q23628|LON3_CAEEL Cuticle collagen lon-3 OS=Caenorhabditis elegans GN=lon-3 PE=1 SV=1 584 726 3.0E-09
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 898 1056 3.0E-09
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 575 701 3.0E-09
sp|P35247|SFTPD_HUMAN Pulmonary surfactant-associated protein D OS=Homo sapiens GN=SFTPD PE=1 SV=3 818 993 3.0E-09
sp|Q28084|CO4A3_BOVIN Collagen alpha-3(IV) chain (Fragment) OS=Bos taurus GN=COL4A3 PE=1 SV=1 790 1014 3.0E-09
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 557 714 4.0E-09
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 563 726 4.0E-09
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 522 725 4.0E-09
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 569 707 4.0E-09
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 544 723 4.0E-09
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 560 722 4.0E-09
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 581 723 4.0E-09
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 557 725 4.0E-09
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 592 962 4.0E-09
sp|Q14993|COJA1_HUMAN Collagen alpha-1(XIX) chain OS=Homo sapiens GN=COL19A1 PE=1 SV=3 787 917 4.0E-09
sp|P18856|CAF1_EPHMU Collagen EMF1-alpha (Fragment) OS=Ephydatia muelleri GN=COLF1 PE=3 SV=2 555 726 4.0E-09
sp|Q07092|COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens GN=COL16A1 PE=1 SV=2 835 1055 4.0E-09
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 881 1059 4.0E-09
sp|Q2UY09|COSA1_HUMAN Collagen alpha-1(XXVIII) chain OS=Homo sapiens GN=COL28A1 PE=2 SV=2 786 1046 4.0E-09
sp|P0C2W8|CO1A1_MAMAE Collagen alpha-1(I) chain OS=Mammut americanum GN=COL1A1 PE=1 SV=4 793 1056 4.0E-09
sp|P35799|DPY2_CAEEL Cuticle collagen dpy-2 OS=Caenorhabditis elegans GN=dpy-2 PE=1 SV=1 791 923 4.0E-09
sp|P20908|CO5A1_HUMAN Collagen alpha-1(V) chain OS=Homo sapiens GN=COL5A1 PE=1 SV=3 564 725 4.0E-09
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 925 982 4.0E-09
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 552 725 5.0E-09
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 595 716 5.0E-09
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 557 725 5.0E-09
sp|P08121|CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculus GN=Col3a1 PE=1 SV=4 500 863 5.0E-09
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 557 725 5.0E-09
sp|Q8BLX7|COGA1_MOUSE Collagen alpha-1(XVI) chain OS=Mus musculus GN=Col16a1 PE=1 SV=2 799 1009 5.0E-09
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 572 716 5.0E-09
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 787 1043 5.0E-09
sp|Q09578|COL75_CAEEL Putative cuticle collagen 75 OS=Caenorhabditis elegans GN=col-75 PE=3 SV=1 598 726 5.0E-09
sp|Q09457|BLI1_CAEEL Cuticle collagen bli-1 OS=Caenorhabditis elegans GN=bli-1 PE=3 SV=2 966 1059 5.0E-09
sp|C0HJN3|CO1A1_ORYAF Collagen alpha-1(I) chain (Fragments) OS=Orycteropus afer GN=COL1A1 PE=1 SV=1 811 1054 5.0E-09
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 552 687 5.0E-09
sp|Q7UZZ9|IF2_PROMP Translation initiation factor IF-2 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=infB PE=3 SV=1 895 1055 5.0E-09
sp|Q4ZJN1|C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus GN=C1qtnf9 PE=1 SV=1 773 965 5.0E-09
sp|Q4ZJN1|C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus GN=C1qtnf9 PE=1 SV=1 563 717 5.0E-09
sp|Q4ZJN1|C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus GN=C1qtnf9 PE=1 SV=1 886 1049 5.0E-09
sp|P0C2W8|CO1A1_MAMAE Collagen alpha-1(I) chain OS=Mammut americanum GN=COL1A1 PE=1 SV=4 817 1055 5.0E-09
sp|P04258|CO3A1_BOVIN Collagen alpha-1(III) chain OS=Bos taurus GN=COL3A1 PE=1 SV=1 838 1034 5.0E-09
sp|P35799|DPY2_CAEEL Cuticle collagen dpy-2 OS=Caenorhabditis elegans GN=dpy-2 PE=1 SV=1 891 1028 5.0E-09
sp|P35247|SFTPD_HUMAN Pulmonary surfactant-associated protein D OS=Homo sapiens GN=SFTPD PE=1 SV=3 844 1020 5.0E-09
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 555 690 6.0E-09
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 605 699 6.0E-09
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 785 916 6.0E-09
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 545 681 6.0E-09
sp|Q9UEW3|MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens GN=MARCO PE=1 SV=1 559 725 6.0E-09
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 796 1059 6.0E-09
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 599 695 6.0E-09
sp|P12107|COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens GN=COL11A1 PE=1 SV=4 797 1039 6.0E-09
sp|C0HJN3|CO1A1_ORYAF Collagen alpha-1(I) chain (Fragments) OS=Orycteropus afer GN=COL1A1 PE=1 SV=1 563 919 6.0E-09
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 814 1056 6.0E-09
sp|C0HJN8|CO1A2_TAPTE Collagen alpha-2(I) chain (Fragments) OS=Tapirus terrestris GN=COL1A2 PE=1 SV=1 794 1056 6.0E-09
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 828 950 6.0E-09
sp|Q4ZJN1|C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus GN=C1qtnf9 PE=1 SV=1 557 711 6.0E-09
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 590 710 6.0E-09
sp|P35799|DPY2_CAEEL Cuticle collagen dpy-2 OS=Caenorhabditis elegans GN=dpy-2 PE=1 SV=1 849 1000 6.0E-09
sp|P17657|DPY13_CAEEL Cuticle collagen dpy-13 OS=Caenorhabditis elegans GN=dpy-13 PE=1 SV=2 558 657 6.0E-09
sp|P12114|SQT1_CAEEL Cuticle collagen sqt-1 OS=Caenorhabditis elegans GN=sqt-1 PE=3 SV=2 826 989 6.0E-09
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 556 725 7.0E-09
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 581 723 7.0E-09
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 787 1040 7.0E-09
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 786 1051 7.0E-09
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 569 704 7.0E-09
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 779 908 7.0E-09
sp|Q4ZJN1|C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus GN=C1qtnf9 PE=1 SV=1 557 719 7.0E-09
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 862 998 7.0E-09
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 833 1014 7.0E-09
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 552 824 8.0E-09
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 560 722 8.0E-09
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 555 695 8.0E-09
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 555 725 8.0E-09
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 841 1058 8.0E-09
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 552 722 8.0E-09
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 543 726 8.0E-09
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 799 1035 8.0E-09
sp|Q21184|CO155_CAEEL Putative cuticle collagen 155 OS=Caenorhabditis elegans GN=col-155 PE=3 SV=3 561 689 8.0E-09
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 898 955 8.0E-09
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 952 1009 8.0E-09
sp|P12114|SQT1_CAEEL Cuticle collagen sqt-1 OS=Caenorhabditis elegans GN=sqt-1 PE=3 SV=2 862 1028 8.0E-09
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 839 1020 8.0E-09
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 550 722 9.0E-09
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 562 701 9.0E-09
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 563 717 9.0E-09
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 579 726 9.0E-09
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 555 719 9.0E-09
sp|B4YNE6|V6_SPTNK Collagen-like protein V6 OS=Sputnik virophage GN=ORF6 PE=3 SV=1 785 874 9.0E-09
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 569 704 9.0E-09
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 807 929 9.0E-09
sp|Q23628|LON3_CAEEL Cuticle collagen lon-3 OS=Caenorhabditis elegans GN=lon-3 PE=1 SV=1 548 678 9.0E-09
sp|C0HJP6|CO1A2_MACSX Collagen alpha-2(I) chain (Fragments) OS=Macrauchenia sp. GN=COL1A2 PE=1 SV=1 780 992 9.0E-09
sp|Q86Y22|CONA1_HUMAN Collagen alpha-1(XXIII) chain OS=Homo sapiens GN=COL23A1 PE=1 SV=1 564 720 9.0E-09
sp|A8XV36|COL10_CAEBR Cuticle collagen 10 OS=Caenorhabditis briggsae GN=col-10 PE=3 SV=1 593 686 9.0E-09
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 545 681 1.0E-08
sp|C7DZK3|CRA1A_DANRE Collagen alpha-1(XXVII) chain A OS=Danio rerio GN=col27a1a PE=2 SV=1 555 719 1.0E-08
sp|Q8C6K9|CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus GN=Col6a6 PE=1 SV=2 599 726 1.0E-08
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 555 726 1.0E-08
sp|P13941|CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus GN=Col3a1 PE=2 SV=3 549 680 1.0E-08
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 566 707 1.0E-08
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 850 1033 1.0E-08
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 572 725 1.0E-08
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 566 720 1.0E-08
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 787 1048 1.0E-08
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 581 722 1.0E-08
sp|Q9QZS0|CO4A3_MOUSE Collagen alpha-3(IV) chain OS=Mus musculus GN=Col4a3 PE=1 SV=2 553 726 1.0E-08
sp|A6NE01|F186A_HUMAN Protein FAM186A OS=Homo sapiens GN=FAM186A PE=2 SV=3 553 1025 1.0E-08
sp|Q28668|CO1A2_RABIT Collagen alpha-2(I) chain (Fragment) OS=Oryctolagus cuniculus GN=COL1A2 PE=2 SV=1 611 726 1.0E-08
sp|P25318|CO8A2_MOUSE Collagen alpha-2(VIII) chain OS=Mus musculus GN=Col8a2 PE=2 SV=2 785 977 1.0E-08
sp|P98085|COLE_LEPMA Inner ear-specific collagen OS=Lepomis macrochirus PE=2 SV=1 934 1055 1.0E-08
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 557 722 1.0E-08
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 557 722 1.0E-08
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 557 722 1.0E-08
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 552 726 1.0E-08
sp|P16884|NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus GN=Nefh PE=1 SV=4 559 726 1.0E-08
sp|Q03692|COAA1_HUMAN Collagen alpha-1(X) chain OS=Homo sapiens GN=COL10A1 PE=1 SV=2 880 1056 1.0E-08
sp|Q01443|SSP2_PLAYO Sporozoite surface protein 2 OS=Plasmodium yoelii yoelii GN=SSP2 PE=1 SV=2 979 1057 1.0E-08
sp|Q6XPR3|RPTN_HUMAN Repetin OS=Homo sapiens GN=RPTN PE=1 SV=1 789 1042 1.0E-08
sp|Q6XPR3|RPTN_HUMAN Repetin OS=Homo sapiens GN=RPTN PE=1 SV=1 784 1051 1.0E-08
sp|Q96WV6|YHU2_SCHPO Uncharacterized threonine-rich GPI-anchored glycoprotein PJ4664.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.02 PE=3 SV=1 530 1056 1.0E-08
sp|B7Z0K8|COLL1_DROME Collagen alpha chain CG42342 OS=Drosophila melanogaster GN=CG42342 PE=2 SV=1 847 1058 1.0E-08
sp|P20908|CO5A1_HUMAN Collagen alpha-1(V) chain OS=Homo sapiens GN=COL5A1 PE=1 SV=3 788 970 1.0E-08
sp|P35247|SFTPD_HUMAN Pulmonary surfactant-associated protein D OS=Homo sapiens GN=SFTPD PE=1 SV=3 854 1032 1.0E-08
sp|P35247|SFTPD_HUMAN Pulmonary surfactant-associated protein D OS=Homo sapiens GN=SFTPD PE=1 SV=3 535 721 1.0E-08
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 560 617 1.0E-08
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 874 931 1.0E-08
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 626 689 1.0E-08
sp|P12114|SQT1_CAEEL Cuticle collagen sqt-1 OS=Caenorhabditis elegans GN=sqt-1 PE=3 SV=2 880 1030 1.0E-08
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 791 972 1.0E-08
sp|A8XV36|COL10_CAEBR Cuticle collagen 10 OS=Caenorhabditis briggsae GN=col-10 PE=3 SV=1 811 889 1.0E-08
sp|P18503|CAS4_EPHMU Short-chain collagen C4 (Fragment) OS=Ephydatia muelleri PE=2 SV=1 892 983 1.0E-08
sp|Q0II24|C1QT9_BOVIN Complement C1q and tumor necrosis factor-related protein 9 OS=Bos taurus GN=C1QTNF9 PE=2 SV=1 844 1012 1.0E-08
sp|Q01456|OAM_ASCSU Ovarian abundant message protein OS=Ascaris suum GN=OAM PE=2 SV=1 544 712 1.0E-08
sp|Q01456|OAM_ASCSU Ovarian abundant message protein OS=Ascaris suum GN=OAM PE=2 SV=1 591 724 1.0E-08
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 552 713 2.0E-08
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 552 726 2.0E-08
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 556 713 2.0E-08
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 560 726 2.0E-08
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 605 726 2.0E-08
sp|Q5QNQ9|CORA1_MOUSE Collagen alpha-1(XXVII) chain OS=Mus musculus GN=Col27a1 PE=2 SV=1 552 722 2.0E-08
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 957 1056 2.0E-08
sp|P02461|CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens GN=COL3A1 PE=1 SV=4 541 665 2.0E-08
sp|Q8NFW1|COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens GN=COL22A1 PE=2 SV=2 555 726 2.0E-08
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 566 725 2.0E-08
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 779 986 2.0E-08
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 587 726 2.0E-08
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 552 717 2.0E-08
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 545 725 2.0E-08
sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi GN=TCNA PE=2 SV=1 555 710 2.0E-08
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 552 726 2.0E-08
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 552 726 2.0E-08
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 923 1054 2.0E-08
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 796 1043 2.0E-08
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 560 726 2.0E-08
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 819 1031 2.0E-08
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 818 974 2.0E-08
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 556 726 2.0E-08
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 557 710 2.0E-08
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 552 726 2.0E-08
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 584 722 2.0E-08
sp|P29400|CO4A5_HUMAN Collagen alpha-5(IV) chain OS=Homo sapiens GN=COL4A5 PE=1 SV=2 787 902 2.0E-08
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 786 1054 2.0E-08
sp|G1UBC2|PGA47_CANAL Cell wall adhesin EAP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EAP1 PE=1 SV=1 629 873 2.0E-08
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 552 726 2.0E-08
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 787 959 2.0E-08
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 552 726 2.0E-08
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 787 959 2.0E-08
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 787 959 2.0E-08
sp|P18856|CAF1_EPHMU Collagen EMF1-alpha (Fragment) OS=Ephydatia muelleri GN=COLF1 PE=3 SV=2 555 726 2.0E-08
sp|Q07092|COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens GN=COL16A1 PE=1 SV=2 569 839 2.0E-08
sp|P12108|CO9A2_CHICK Collagen alpha-2(IX) chain OS=Gallus gallus GN=COL9A2 PE=1 SV=3 491 723 2.0E-08
sp|Q2UY11|COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus GN=Col28a1 PE=2 SV=1 552 664 2.0E-08
sp|Q23628|LON3_CAEEL Cuticle collagen lon-3 OS=Caenorhabditis elegans GN=lon-3 PE=1 SV=1 859 1028 2.0E-08
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 552 710 2.0E-08
sp|P32018|COEA1_CHICK Collagen alpha-1(XIV) chain OS=Gallus gallus GN=COL14A1 PE=1 SV=2 823 988 2.0E-08
sp|P32018|COEA1_CHICK Collagen alpha-1(XIV) chain OS=Gallus gallus GN=COL14A1 PE=1 SV=2 880 1042 2.0E-08
sp|P0C2W8|CO1A1_MAMAE Collagen alpha-1(I) chain OS=Mammut americanum GN=COL1A1 PE=1 SV=4 799 1059 2.0E-08
sp|P04258|CO3A1_BOVIN Collagen alpha-1(III) chain OS=Bos taurus GN=COL3A1 PE=1 SV=1 787 977 2.0E-08
sp|P35799|DPY2_CAEEL Cuticle collagen dpy-2 OS=Caenorhabditis elegans GN=dpy-2 PE=1 SV=1 912 1054 2.0E-08
sp|P17657|DPY13_CAEEL Cuticle collagen dpy-13 OS=Caenorhabditis elegans GN=dpy-13 PE=1 SV=2 923 1019 2.0E-08
sp|P17657|DPY13_CAEEL Cuticle collagen dpy-13 OS=Caenorhabditis elegans GN=dpy-13 PE=1 SV=2 568 684 2.0E-08
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 790 1054 2.0E-08
sp|P35247|SFTPD_HUMAN Pulmonary surfactant-associated protein D OS=Homo sapiens GN=SFTPD PE=1 SV=3 841 999 2.0E-08
sp|Q9Y215|COLQ_HUMAN Acetylcholinesterase collagenic tail peptide OS=Homo sapiens GN=COLQ PE=1 SV=2 823 949 2.0E-08
sp|Q9Y215|COLQ_HUMAN Acetylcholinesterase collagenic tail peptide OS=Homo sapiens GN=COLQ PE=1 SV=2 874 1001 2.0E-08
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 964 1021 2.0E-08
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 895 952 2.0E-08
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 910 967 2.0E-08
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 788 969 2.0E-08
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 891 1059 2.0E-08
sp|A8XV36|COL10_CAEBR Cuticle collagen 10 OS=Caenorhabditis briggsae GN=col-10 PE=3 SV=1 910 991 2.0E-08
sp|P27951|BAG_STRAG IgA FC receptor OS=Streptococcus agalactiae GN=bag PE=1 SV=1 560 687 2.0E-08
sp|Q5UPS6|COLL5_MIMIV Collagen-like protein 5 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R241 PE=4 SV=1 557 651 2.0E-08
sp|A8XV37|CO145_CAEBR Putative cuticle collagen 145 OS=Caenorhabditis briggsae GN=col-145 PE=3 SV=1 569 654 2.0E-08
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 794 1037 3.0E-08
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 841 1057 3.0E-08
sp|Q801S8|CO6A1_XENLA Collagen alpha-1(VI) chain OS=Xenopus laevis GN=col6a1 PE=1 SV=1 972 1058 3.0E-08
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 552 726 3.0E-08
sp|Q8NFW1|COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens GN=COL22A1 PE=2 SV=2 445 725 3.0E-08
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 689 976 3.0E-08
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 555 725 3.0E-08
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 556 962 3.0E-08
sp|Q4ZJM7|OTOL1_MOUSE Otolin-1 OS=Mus musculus GN=Otol1 PE=1 SV=2 949 1061 3.0E-08
sp|Q8BLX7|COGA1_MOUSE Collagen alpha-1(XVI) chain OS=Mus musculus GN=Col16a1 PE=1 SV=2 805 1022 3.0E-08
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 787 1051 3.0E-08
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 535 713 3.0E-08
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 862 1056 3.0E-08
sp|P12106|CO9A1_CHICK Collagen alpha-1(IX) chain OS=Gallus gallus GN=COL9A1 PE=1 SV=4 557 725 3.0E-08
sp|A6NE01|F186A_HUMAN Protein FAM186A OS=Homo sapiens GN=FAM186A PE=2 SV=3 553 711 3.0E-08
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 550 726 3.0E-08
sp|Q9JMH4|COHA1_MESAU Collagen alpha-1(XVII) chain OS=Mesocricetus auratus GN=COL17A1 PE=2 SV=1 782 886 3.0E-08
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 796 1051 3.0E-08
sp|G1UBC2|PGA47_CANAL Cell wall adhesin EAP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EAP1 PE=1 SV=1 505 723 3.0E-08
sp|P98085|COLE_LEPMA Inner ear-specific collagen OS=Lepomis macrochirus PE=2 SV=1 938 1054 3.0E-08
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 557 722 3.0E-08
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 779 979 3.0E-08
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 644 726 3.0E-08
sp|Q07563|COHA1_MOUSE Collagen alpha-1(XVII) chain OS=Mus musculus GN=Col17a1 PE=1 SV=3 584 708 3.0E-08
sp|Q7UZZ9|IF2_PROMP Translation initiation factor IF-2 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=infB PE=3 SV=1 808 977 3.0E-08
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 556 677 3.0E-08
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 560 722 3.0E-08
sp|C0HJP6|CO1A2_MACSX Collagen alpha-2(I) chain (Fragments) OS=Macrauchenia sp. GN=COL1A2 PE=1 SV=1 545 967 3.0E-08
sp|P35799|DPY2_CAEEL Cuticle collagen dpy-2 OS=Caenorhabditis elegans GN=dpy-2 PE=1 SV=1 582 722 3.0E-08
sp|P35799|DPY2_CAEEL Cuticle collagen dpy-2 OS=Caenorhabditis elegans GN=dpy-2 PE=1 SV=1 443 678 3.0E-08
sp|Q21184|CO155_CAEEL Putative cuticle collagen 155 OS=Caenorhabditis elegans GN=col-155 PE=3 SV=3 905 1056 3.0E-08
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 650 707 3.0E-08
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 805 868 3.0E-08
sp|P12114|SQT1_CAEEL Cuticle collagen sqt-1 OS=Caenorhabditis elegans GN=sqt-1 PE=3 SV=2 566 717 3.0E-08
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 815 996 3.0E-08
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 865 1041 3.0E-08
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 825 1005 3.0E-08
sp|Q7TVV6|LEU1_MYCBO 2-isopropylmalate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=leuA PE=3 SV=1 820 920 3.0E-08
sp|O35167|COLQ_RAT Acetylcholinesterase collagenic tail peptide OS=Rattus norvegicus GN=Colq PE=2 SV=1 844 970 3.0E-08
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 965 1030 3.0E-08
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 820 1042 4.0E-08
sp|Q02788|CO6A2_MOUSE Collagen alpha-2(VI) chain OS=Mus musculus GN=Col6a2 PE=1 SV=3 563 692 4.0E-08
sp|Q8NFW1|COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens GN=COL22A1 PE=2 SV=2 556 675 4.0E-08
sp|Q9QZS0|CO4A3_MOUSE Collagen alpha-3(IV) chain OS=Mus musculus GN=Col4a3 PE=1 SV=2 793 1037 4.0E-08
sp|Q28668|CO1A2_RABIT Collagen alpha-2(I) chain (Fragment) OS=Oryctolagus cuniculus GN=COL1A2 PE=2 SV=1 555 692 4.0E-08
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 787 1055 4.0E-08
sp|P12108|CO9A2_CHICK Collagen alpha-2(IX) chain OS=Gallus gallus GN=COL9A2 PE=1 SV=3 555 705 4.0E-08
sp|Q60467|CO5A1_CRILO Collagen alpha-1(V) chain OS=Cricetulus longicaudatus GN=COL5A1 PE=2 SV=1 786 964 4.0E-08
sp|Q9JI03|CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus GN=Col5a1 PE=1 SV=1 786 964 4.0E-08
sp|O88207|CO5A1_MOUSE Collagen alpha-1(V) chain OS=Mus musculus GN=Col5a1 PE=1 SV=2 786 964 4.0E-08
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 773 992 4.0E-08
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 605 726 4.0E-08
sp|P32018|COEA1_CHICK Collagen alpha-1(XIV) chain OS=Gallus gallus GN=COL14A1 PE=1 SV=2 847 1034 4.0E-08
sp|Q01443|SSP2_PLAYO Sporozoite surface protein 2 OS=Plasmodium yoelii yoelii GN=SSP2 PE=1 SV=2 650 726 4.0E-08
sp|P35247|SFTPD_HUMAN Pulmonary surfactant-associated protein D OS=Homo sapiens GN=SFTPD PE=1 SV=3 914 1059 4.0E-08
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 605 662 4.0E-08
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 943 1006 4.0E-08
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 856 913 4.0E-08
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 866 1047 4.0E-08
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 863 1044 4.0E-08
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 857 1038 4.0E-08
sp|C0HJN9|CO1A1_EQUSP Collagen alpha-1(I) chain (Fragments) OS=Equus sp. GN=COL1A1 PE=1 SV=1 796 1040 4.0E-08
sp|P27177|PRIO_CHICK Major prion protein homolog OS=Gallus gallus GN=PRNP PE=1 SV=2 569 626 4.0E-08
sp|C0HJP8|CO1A2_TOXSP Collagen alpha-2(I) chain (Fragments) OS=Toxodon sp. GN=COL1A2 PE=1 SV=1 574 687 4.0E-08
sp|C0HJP8|CO1A2_TOXSP Collagen alpha-2(I) chain (Fragments) OS=Toxodon sp. GN=COL1A2 PE=1 SV=1 779 908 4.0E-08
sp|D4B1B1|ALS1_ARTBC Agglutinin-like protein ARB_02240 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02240 PE=1 SV=1 224 357 4.0E-08
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 560 716 5.0E-08
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 543 690 5.0E-08
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 601 725 5.0E-08
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 589 713 5.0E-08
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 552 726 5.0E-08
sp|Q8NFW1|COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens GN=COL22A1 PE=2 SV=2 934 1056 5.0E-08
sp|Q28247|CO4A5_CANLF Collagen alpha-5(IV) chain OS=Canis lupus familiaris GN=COL4A5 PE=2 SV=2 590 671 5.0E-08
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 785 995 5.0E-08
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 560 726 5.0E-08
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 555 722 5.0E-08
sp|P12106|CO9A1_CHICK Collagen alpha-1(IX) chain OS=Gallus gallus GN=COL9A1 PE=1 SV=4 555 716 5.0E-08
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 563 725 5.0E-08
sp|Q14993|COJA1_HUMAN Collagen alpha-1(XIX) chain OS=Homo sapiens GN=COL19A1 PE=1 SV=3 588 844 5.0E-08
sp|Q14050|CO9A3_HUMAN Collagen alpha-3(IX) chain OS=Homo sapiens GN=COL9A3 PE=1 SV=2 605 866 5.0E-08
sp|Q7UZZ9|IF2_PROMP Translation initiation factor IF-2 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=infB PE=3 SV=1 862 988 5.0E-08
sp|Q4ZJN1|C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus GN=C1qtnf9 PE=1 SV=1 902 1061 5.0E-08
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 617 726 5.0E-08
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 593 719 5.0E-08
sp|P32018|COEA1_CHICK Collagen alpha-1(XIV) chain OS=Gallus gallus GN=COL14A1 PE=1 SV=2 904 1055 5.0E-08
sp|C0HJP6|CO1A2_MACSX Collagen alpha-2(I) chain (Fragments) OS=Macrauchenia sp. GN=COL1A2 PE=1 SV=1 790 1054 5.0E-08
sp|C0HJP6|CO1A2_MACSX Collagen alpha-2(I) chain (Fragments) OS=Macrauchenia sp. GN=COL1A2 PE=1 SV=1 786 1054 5.0E-08
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 557 722 5.0E-08
sp|P20908|CO5A1_HUMAN Collagen alpha-1(V) chain OS=Homo sapiens GN=COL5A1 PE=1 SV=3 555 719 5.0E-08
sp|Q21184|CO155_CAEEL Putative cuticle collagen 155 OS=Caenorhabditis elegans GN=col-155 PE=3 SV=3 899 1046 5.0E-08
sp|P12114|SQT1_CAEEL Cuticle collagen sqt-1 OS=Caenorhabditis elegans GN=sqt-1 PE=3 SV=2 785 941 5.0E-08
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 811 987 5.0E-08
sp|P18503|CAS4_EPHMU Short-chain collagen C4 (Fragment) OS=Ephydatia muelleri PE=2 SV=1 590 680 5.0E-08
sp|P27951|BAG_STRAG IgA FC receptor OS=Streptococcus agalactiae GN=bag PE=1 SV=1 882 1000 5.0E-08
sp|O35348|COLQ_MOUSE Acetylcholinesterase collagenic tail peptide OS=Mus musculus GN=Colq PE=2 SV=2 844 970 5.0E-08
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 557 726 6.0E-08
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 562 701 6.0E-08
sp|Q8NFW1|COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens GN=COL22A1 PE=2 SV=2 938 1056 6.0E-08
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 572 725 6.0E-08
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 785 1007 6.0E-08
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 579 726 6.0E-08
sp|A6NE01|F186A_HUMAN Protein FAM186A OS=Homo sapiens GN=FAM186A PE=2 SV=3 555 721 6.0E-08
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 560 722 6.0E-08
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 635 725 6.0E-08
sp|P12105|CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus GN=COL3A1 PE=2 SV=2 828 1054 6.0E-08
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 785 1043 6.0E-08
sp|P12108|CO9A2_CHICK Collagen alpha-2(IX) chain OS=Gallus gallus GN=COL9A2 PE=1 SV=3 555 726 6.0E-08
sp|Q2UY11|COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus GN=Col28a1 PE=2 SV=1 557 725 6.0E-08
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 560 687 6.0E-08
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 603 725 6.0E-08
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 820 1042 6.0E-08
sp|Q6XPR3|RPTN_HUMAN Repetin OS=Homo sapiens GN=RPTN PE=1 SV=1 793 1049 6.0E-08
sp|P20908|CO5A1_HUMAN Collagen alpha-1(V) chain OS=Homo sapiens GN=COL5A1 PE=1 SV=3 793 1045 6.0E-08
sp|Q28084|CO4A3_BOVIN Collagen alpha-3(IV) chain (Fragment) OS=Bos taurus GN=COL4A3 PE=1 SV=1 605 711 6.0E-08
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 671 726 6.0E-08
sp|A8XV36|COL10_CAEBR Cuticle collagen 10 OS=Caenorhabditis briggsae GN=col-10 PE=3 SV=1 793 871 6.0E-08
sp|P27951|BAG_STRAG IgA FC receptor OS=Streptococcus agalactiae GN=bag PE=1 SV=1 838 965 6.0E-08
sp|Q7TVV6|LEU1_MYCBO 2-isopropylmalate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=leuA PE=3 SV=1 839 943 6.0E-08
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 876 944 6.0E-08
sp|Q28247|CO4A5_CANLF Collagen alpha-5(IV) chain OS=Canis lupus familiaris GN=COL4A5 PE=2 SV=2 790 878 7.0E-08
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 556 725 7.0E-08
sp|A6NE01|F186A_HUMAN Protein FAM186A OS=Homo sapiens GN=FAM186A PE=2 SV=3 542 721 7.0E-08
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 557 725 7.0E-08
sp|P25318|CO8A2_MOUSE Collagen alpha-2(VIII) chain OS=Mus musculus GN=Col8a2 PE=2 SV=2 578 929 7.0E-08
sp|Q14050|CO9A3_HUMAN Collagen alpha-3(IX) chain OS=Homo sapiens GN=COL9A3 PE=1 SV=2 633 923 7.0E-08
sp|P12108|CO9A2_CHICK Collagen alpha-2(IX) chain OS=Gallus gallus GN=COL9A2 PE=1 SV=3 549 726 7.0E-08
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 555 726 7.0E-08
sp|Q21184|CO155_CAEEL Putative cuticle collagen 155 OS=Caenorhabditis elegans GN=col-155 PE=3 SV=3 801 962 7.0E-08
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 608 665 7.0E-08
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 955 1012 7.0E-08
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 852 1032 7.0E-08
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 877 941 7.0E-08
sp|P34688|DPY7_CAEEL Cuticle collagen dpy-7 OS=Caenorhabditis elegans GN=dpy-7 PE=1 SV=1 952 1039 7.0E-08
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 552 725 8.0E-08
sp|Q8NFW1|COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens GN=COL22A1 PE=2 SV=2 357 704 8.0E-08
sp|Q8NFW1|COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens GN=COL22A1 PE=2 SV=2 557 723 8.0E-08
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 572 720 8.0E-08
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 889 1058 8.0E-08
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 785 1054 8.0E-08
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 796 964 8.0E-08
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 555 722 8.0E-08
sp|P35799|DPY2_CAEEL Cuticle collagen dpy-2 OS=Caenorhabditis elegans GN=dpy-2 PE=1 SV=1 555 699 8.0E-08
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 901 964 8.0E-08
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 802 978 8.0E-08
sp|A8XV36|COL10_CAEBR Cuticle collagen 10 OS=Caenorhabditis briggsae GN=col-10 PE=3 SV=1 805 878 8.0E-08
sp|P34688|DPY7_CAEEL Cuticle collagen dpy-7 OS=Caenorhabditis elegans GN=dpy-7 PE=1 SV=1 892 982 8.0E-08
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 953 1009 8.0E-08
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 599 723 9.0E-08
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 556 725 9.0E-08
sp|P12107|COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens GN=COL11A1 PE=1 SV=4 555 725 9.0E-08
sp|Q07092|COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens GN=COL16A1 PE=1 SV=2 793 940 9.0E-08
sp|Q21184|CO155_CAEEL Putative cuticle collagen 155 OS=Caenorhabditis elegans GN=col-155 PE=3 SV=3 610 726 9.0E-08
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 832 889 9.0E-08
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 614 677 9.0E-08
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 965 1030 9.0E-08
sp|Q3AZB7|IF2_SYNS9 Translation initiation factor IF-2 OS=Synechococcus sp. (strain CC9902) GN=infB PE=3 SV=1 852 1070 9.0E-08
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 633 726 1.0E-07
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 557 684 1.0E-07
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 558 655 1.0E-07
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 552 719 1.0E-07
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 785 1034 1.0E-07
sp|Q8BLX7|COGA1_MOUSE Collagen alpha-1(XVI) chain OS=Mus musculus GN=Col16a1 PE=1 SV=2 829 1055 1.0E-07
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 528 693 1.0E-07
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 552 702 1.0E-07
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 848 1056 1.0E-07
sp|A6NE01|F186A_HUMAN Protein FAM186A OS=Homo sapiens GN=FAM186A PE=2 SV=3 555 721 1.0E-07
sp|P29400|CO4A5_HUMAN Collagen alpha-5(IV) chain OS=Homo sapiens GN=COL4A5 PE=1 SV=2 557 716 1.0E-07
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 557 726 1.0E-07
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 556 714 1.0E-07
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 558 720 1.0E-07
sp|Q9N281|COHA1_CANLF Collagen alpha-1(XVII) chain OS=Canis lupus familiaris GN=COL17A1 PE=2 SV=2 557 675 1.0E-07
sp|Q07092|COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens GN=COL16A1 PE=1 SV=2 799 1009 1.0E-07
sp|Q5TAT6|CODA1_HUMAN Collagen alpha-1(XIII) chain OS=Homo sapiens GN=COL13A1 PE=1 SV=1 557 710 1.0E-07
sp|Q60467|CO5A1_CRILO Collagen alpha-1(V) chain OS=Cricetulus longicaudatus GN=COL5A1 PE=2 SV=1 790 1034 1.0E-07
sp|Q2UY11|COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus GN=Col28a1 PE=2 SV=1 803 1054 1.0E-07
sp|P0C2W8|CO1A1_MAMAE Collagen alpha-1(I) chain OS=Mammut americanum GN=COL1A1 PE=1 SV=4 783 1021 1.0E-07
sp|P0C2W8|CO1A1_MAMAE Collagen alpha-1(I) chain OS=Mammut americanum GN=COL1A1 PE=1 SV=4 578 943 1.0E-07
sp|Q6XPR3|RPTN_HUMAN Repetin OS=Homo sapiens GN=RPTN PE=1 SV=1 562 722 1.0E-07
sp|B7Z0K8|COLL1_DROME Collagen alpha chain CG42342 OS=Drosophila melanogaster GN=CG42342 PE=2 SV=1 566 677 1.0E-07
sp|P20908|CO5A1_HUMAN Collagen alpha-1(V) chain OS=Homo sapiens GN=COL5A1 PE=1 SV=3 830 1021 1.0E-07
sp|Q9R1N9|CODA1_MOUSE Collagen alpha-1(XIII) chain OS=Mus musculus GN=Col13a1 PE=2 SV=1 865 1055 1.0E-07
sp|Q21184|CO155_CAEEL Putative cuticle collagen 155 OS=Caenorhabditis elegans GN=col-155 PE=3 SV=3 788 934 1.0E-07
sp|Q28084|CO4A3_BOVIN Collagen alpha-3(IV) chain (Fragment) OS=Bos taurus GN=COL4A3 PE=1 SV=1 785 914 1.0E-07
sp|Q28084|CO4A3_BOVIN Collagen alpha-3(IV) chain (Fragment) OS=Bos taurus GN=COL4A3 PE=1 SV=1 835 1057 1.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 862 919 1.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 566 623 1.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 982 1045 1.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 835 892 1.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 853 910 1.0E-07
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 846 1026 1.0E-07
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 787 963 1.0E-07
sp|P34688|DPY7_CAEEL Cuticle collagen dpy-7 OS=Caenorhabditis elegans GN=dpy-7 PE=1 SV=1 857 953 1.0E-07
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 966 1018 1.0E-07
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 926 992 1.0E-07
sp|P35246|SFTPD_BOVIN Pulmonary surfactant-associated protein D OS=Bos taurus GN=SFTPD PE=1 SV=2 872 1042 1.0E-07
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 551 719 2.0E-07
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 557 726 2.0E-07
sp|P05997|CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens GN=COL5A2 PE=1 SV=3 545 725 2.0E-07
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 850 1033 2.0E-07
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 545 725 2.0E-07
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 543 707 2.0E-07
sp|P20849|CO9A1_HUMAN Collagen alpha-1(IX) chain OS=Homo sapiens GN=COL9A1 PE=1 SV=3 553 723 2.0E-07
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 616 726 2.0E-07
sp|Q28247|CO4A5_CANLF Collagen alpha-5(IV) chain OS=Canis lupus familiaris GN=COL4A5 PE=2 SV=2 566 647 2.0E-07
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 555 725 2.0E-07
sp|Q99MQ5|COPA1_MOUSE Collagen alpha-1(XXV) chain OS=Mus musculus GN=Col25a1 PE=2 SV=2 647 726 2.0E-07
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 558 919 2.0E-07
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 549 723 2.0E-07
sp|A6NMZ7|CO6A6_HUMAN Collagen alpha-6(VI) chain OS=Homo sapiens GN=COL6A6 PE=1 SV=2 643 726 2.0E-07
sp|P32017|CO9A3_CHICK Collagen alpha-3(IX) chain OS=Gallus gallus GN=COL9A3 PE=2 SV=1 941 1058 2.0E-07
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 557 710 2.0E-07
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 581 714 2.0E-07
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 572 716 2.0E-07
sp|A6NE01|F186A_HUMAN Protein FAM186A OS=Homo sapiens GN=FAM186A PE=2 SV=3 553 721 2.0E-07
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 556 698 2.0E-07
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 648 726 2.0E-07
sp|Q14993|COJA1_HUMAN Collagen alpha-1(XIX) chain OS=Homo sapiens GN=COL19A1 PE=1 SV=3 556 726 2.0E-07
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 608 704 2.0E-07
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 558 720 2.0E-07
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 558 720 2.0E-07
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 786 1043 2.0E-07
sp|P12105|CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus GN=COL3A1 PE=2 SV=2 663 847 2.0E-07
sp|P12105|CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus GN=COL3A1 PE=2 SV=2 647 726 2.0E-07
sp|A5PN28|OTO1A_DANRE Otolin-1-A OS=Danio rerio GN=otol1a PE=2 SV=1 638 726 2.0E-07
sp|P39061|COIA1_MOUSE Collagen alpha-1(XVIII) chain OS=Mus musculus GN=Col18a1 PE=1 SV=4 540 722 2.0E-07
sp|Q07092|COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens GN=COL16A1 PE=1 SV=2 557 671 2.0E-07
sp|Q07092|COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens GN=COL16A1 PE=1 SV=2 790 916 2.0E-07
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 846 1051 2.0E-07
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 555 680 2.0E-07
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 555 680 2.0E-07
sp|Q2UY09|COSA1_HUMAN Collagen alpha-1(XXVIII) chain OS=Homo sapiens GN=COL28A1 PE=2 SV=2 786 992 2.0E-07
sp|P04258|CO3A1_BOVIN Collagen alpha-1(III) chain OS=Bos taurus GN=COL3A1 PE=1 SV=1 557 726 2.0E-07
sp|Q9UMD9|COHA1_HUMAN Collagen alpha-1(XVII) chain OS=Homo sapiens GN=COL17A1 PE=1 SV=3 883 1054 2.0E-07
sp|Q9Y215|COLQ_HUMAN Acetylcholinesterase collagenic tail peptide OS=Homo sapiens GN=COLQ PE=1 SV=2 910 1024 2.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 811 874 2.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 787 844 2.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 602 659 2.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 940 997 2.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 976 1033 2.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 799 856 2.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 820 877 2.0E-07
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 832 1008 2.0E-07
sp|Q0II24|C1QT9_BOVIN Complement C1q and tumor necrosis factor-related protein 9 OS=Bos taurus GN=C1QTNF9 PE=2 SV=1 805 973 2.0E-07
sp|P27951|BAG_STRAG IgA FC receptor OS=Streptococcus agalactiae GN=bag PE=1 SV=1 814 949 2.0E-07
sp|Q7TVV6|LEU1_MYCBO 2-isopropylmalate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=leuA PE=3 SV=1 863 974 2.0E-07
sp|Q7TVV6|LEU1_MYCBO 2-isopropylmalate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=leuA PE=3 SV=1 959 1045 2.0E-07
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 926 992 2.0E-07
sp|P27177|PRIO_CHICK Major prion protein homolog OS=Gallus gallus GN=PRNP PE=1 SV=2 611 668 2.0E-07
sp|P27177|PRIO_CHICK Major prion protein homolog OS=Gallus gallus GN=PRNP PE=1 SV=2 656 713 2.0E-07
sp|P27177|PRIO_CHICK Major prion protein homolog OS=Gallus gallus GN=PRNP PE=1 SV=2 931 988 2.0E-07
sp|P27177|PRIO_CHICK Major prion protein homolog OS=Gallus gallus GN=PRNP PE=1 SV=2 979 1036 2.0E-07
sp|P27177|PRIO_CHICK Major prion protein homolog OS=Gallus gallus GN=PRNP PE=1 SV=2 1000 1058 2.0E-07
sp|P27177|PRIO_CHICK Major prion protein homolog OS=Gallus gallus GN=PRNP PE=1 SV=2 590 647 2.0E-07
sp|P34688|DPY7_CAEEL Cuticle collagen dpy-7 OS=Caenorhabditis elegans GN=dpy-7 PE=1 SV=1 796 895 2.0E-07
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 927 979 2.0E-07
sp|P35246|SFTPD_BOVIN Pulmonary surfactant-associated protein D OS=Bos taurus GN=SFTPD PE=1 SV=2 893 1059 2.0E-07
sp|Q6UXY8|TMC5_HUMAN Transmembrane channel-like protein 5 OS=Homo sapiens GN=TMC5 PE=2 SV=3 797 1026 2.0E-07
sp|Q6UXY8|TMC5_HUMAN Transmembrane channel-like protein 5 OS=Homo sapiens GN=TMC5 PE=2 SV=3 804 1044 2.0E-07
sp|Q1PBC5|SFTPD_MACMU Pulmonary surfactant-associated protein D OS=Macaca mulatta GN=SFTPD PE=2 SV=1 836 1014 2.0E-07
sp|Q1PBC5|SFTPD_MACMU Pulmonary surfactant-associated protein D OS=Macaca mulatta GN=SFTPD PE=2 SV=1 529 709 2.0E-07
sp|P16053|NFM_CHICK Neurofilament medium polypeptide OS=Gallus gallus GN=NEFM PE=2 SV=2 899 999 2.0E-07
sp|C0HJN4|CO1A2_ORYAF Collagen alpha-2(I) chain (Fragments) OS=Orycteropus afer GN=COL1A2 PE=1 SV=1 797 1056 2.0E-07
sp|C0HJP7|CO1A1_TOXSP Collagen alpha-1(I) chain (Fragments) OS=Toxodon sp. GN=COL1A1 PE=1 SV=1 796 1042 2.0E-07
sp|Q16998|LWA_ACTEQ LWamide neuropeptides (Fragment) OS=Actinia equina PE=2 SV=1 854 971 2.0E-07
sp|P23206|COAA1_BOVIN Collagen alpha-1(X) chain OS=Bos taurus GN=COL10A1 PE=2 SV=1 901 1058 3.0E-07
sp|P12111|CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens GN=COL6A3 PE=1 SV=5 566 669 3.0E-07
sp|Q02788|CO6A2_MOUSE Collagen alpha-2(VI) chain OS=Mus musculus GN=Col6a2 PE=1 SV=3 557 719 3.0E-07
sp|P12107|COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens GN=COL11A1 PE=1 SV=4 555 680 3.0E-07
sp|Q14055|CO9A2_HUMAN Collagen alpha-2(IX) chain OS=Homo sapiens GN=COL9A2 PE=1 SV=2 555 723 3.0E-07
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 596 692 3.0E-07
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 557 725 3.0E-07
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 786 1043 3.0E-07
sp|B4YNE6|V6_SPTNK Collagen-like protein V6 OS=Sputnik virophage GN=ORF6 PE=3 SV=1 786 864 3.0E-07
sp|Q07092|COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens GN=COL16A1 PE=1 SV=2 526 725 3.0E-07
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 836 1007 3.0E-07
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 812 992 3.0E-07
sp|Q14050|CO9A3_HUMAN Collagen alpha-3(IX) chain OS=Homo sapiens GN=COL9A3 PE=1 SV=2 672 965 3.0E-07
sp|Q60467|CO5A1_CRILO Collagen alpha-1(V) chain OS=Cricetulus longicaudatus GN=COL5A1 PE=2 SV=1 793 1056 3.0E-07
sp|Q60467|CO5A1_CRILO Collagen alpha-1(V) chain OS=Cricetulus longicaudatus GN=COL5A1 PE=2 SV=1 560 698 3.0E-07
sp|Q9JI03|CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus GN=Col5a1 PE=1 SV=1 793 1056 3.0E-07
sp|Q9JI03|CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus GN=Col5a1 PE=1 SV=1 560 698 3.0E-07
sp|O88207|CO5A1_MOUSE Collagen alpha-1(V) chain OS=Mus musculus GN=Col5a1 PE=1 SV=2 793 1056 3.0E-07
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 918 1033 3.0E-07
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 841 1051 3.0E-07
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 799 1027 3.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 871 928 3.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 557 614 3.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 970 1027 3.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 880 943 3.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 877 934 3.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 620 683 3.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 826 883 3.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 922 985 3.0E-07
sp|P12114|SQT1_CAEEL Cuticle collagen sqt-1 OS=Caenorhabditis elegans GN=sqt-1 PE=3 SV=2 883 1033 3.0E-07
sp|P18503|CAS4_EPHMU Short-chain collagen C4 (Fragment) OS=Ephydatia muelleri PE=2 SV=1 967 1056 3.0E-07
sp|O35167|COLQ_RAT Acetylcholinesterase collagenic tail peptide OS=Rattus norvegicus GN=Colq PE=2 SV=1 823 949 3.0E-07
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 832 895 3.0E-07
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 585 651 3.0E-07
sp|P27177|PRIO_CHICK Major prion protein homolog OS=Gallus gallus GN=PRNP PE=1 SV=2 814 871 3.0E-07
sp|P27177|PRIO_CHICK Major prion protein homolog OS=Gallus gallus GN=PRNP PE=1 SV=2 623 680 3.0E-07
sp|P27177|PRIO_CHICK Major prion protein homolog OS=Gallus gallus GN=PRNP PE=1 SV=2 802 859 3.0E-07
sp|P27177|PRIO_CHICK Major prion protein homolog OS=Gallus gallus GN=PRNP PE=1 SV=2 841 898 3.0E-07
sp|P27177|PRIO_CHICK Major prion protein homolog OS=Gallus gallus GN=PRNP PE=1 SV=2 641 698 3.0E-07
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 965 1030 3.0E-07
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 876 941 3.0E-07
sp|P35246|SFTPD_BOVIN Pulmonary surfactant-associated protein D OS=Bos taurus GN=SFTPD PE=1 SV=2 823 991 3.0E-07
sp|P35246|SFTPD_BOVIN Pulmonary surfactant-associated protein D OS=Bos taurus GN=SFTPD PE=1 SV=2 797 967 3.0E-07
sp|P16053|NFM_CHICK Neurofilament medium polypeptide OS=Gallus gallus GN=NEFM PE=2 SV=2 555 649 3.0E-07
sp|C0HJN5|CO1A1_HIPAM Collagen alpha-1(I) chain (Fragments) OS=Hippopotamus amphibius GN=COL1A1 PE=1 SV=1 793 1042 3.0E-07
sp|C0HJN6|CO1A2_HIPAM Collagen alpha-2(I) chain (Fragments) OS=Hippopotamus amphibius GN=COL1A2 PE=1 SV=1 790 1024 3.0E-07
sp|P98086|C1QA_MOUSE Complement C1q subcomponent subunit A OS=Mus musculus GN=C1qa PE=1 SV=2 970 1043 3.0E-07
sp|P30204|MSRE_MOUSE Macrophage scavenger receptor types I and II OS=Mus musculus GN=Msr1 PE=1 SV=3 888 958 3.0E-07
sp|Q2LK94|COL11_CHICK Collectin-11 OS=Gallus gallus GN=COLEC11 PE=2 SV=1 819 877 3.0E-07
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 781 1056 4.0E-07
sp|P08122|CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus GN=Col4a2 PE=1 SV=4 543 662 4.0E-07
sp|P12109|CO6A1_HUMAN Collagen alpha-1(VI) chain OS=Homo sapiens GN=COL6A1 PE=1 SV=3 555 689 4.0E-07
sp|O46392|CO1A2_CANLF Collagen alpha-2(I) chain OS=Canis lupus familiaris GN=COL1A2 PE=2 SV=2 563 725 4.0E-07
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 785 1054 4.0E-07
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 555 726 4.0E-07
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 541 716 4.0E-07
sp|O42350|CO1A2_LITCT Collagen alpha-2(I) chain OS=Lithobates catesbeiana GN=COL1A2 PE=2 SV=1 787 1062 4.0E-07
sp|P29400|CO4A5_HUMAN Collagen alpha-5(IV) chain OS=Homo sapiens GN=COL4A5 PE=1 SV=2 555 726 4.0E-07
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 557 725 4.0E-07
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 793 1054 4.0E-07
sp|O88207|CO5A1_MOUSE Collagen alpha-1(V) chain OS=Mus musculus GN=Col5a1 PE=1 SV=2 560 698 4.0E-07
sp|Q07563|COHA1_MOUSE Collagen alpha-1(XVII) chain OS=Mus musculus GN=Col17a1 PE=1 SV=3 566 720 4.0E-07
sp|P0C2W8|CO1A1_MAMAE Collagen alpha-1(I) chain OS=Mammut americanum GN=COL1A1 PE=1 SV=4 787 1046 4.0E-07
sp|Q6XPR3|RPTN_HUMAN Repetin OS=Homo sapiens GN=RPTN PE=1 SV=1 556 722 4.0E-07
sp|Q9UMD9|COHA1_HUMAN Collagen alpha-1(XVII) chain OS=Homo sapiens GN=COL17A1 PE=1 SV=3 555 722 4.0E-07
sp|Q9Y215|COLQ_HUMAN Acetylcholinesterase collagenic tail peptide OS=Homo sapiens GN=COLQ PE=1 SV=2 820 947 4.0E-07
sp|Q9Y215|COLQ_HUMAN Acetylcholinesterase collagenic tail peptide OS=Homo sapiens GN=COLQ PE=1 SV=2 604 702 4.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 916 973 4.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 790 847 4.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 590 647 4.0E-07
sp|P12114|SQT1_CAEEL Cuticle collagen sqt-1 OS=Caenorhabditis elegans GN=sqt-1 PE=3 SV=2 895 1056 4.0E-07
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 781 966 4.0E-07
sp|P27951|BAG_STRAG IgA FC receptor OS=Streptococcus agalactiae GN=bag PE=1 SV=1 566 693 4.0E-07
sp|P27951|BAG_STRAG IgA FC receptor OS=Streptococcus agalactiae GN=bag PE=1 SV=1 574 699 4.0E-07
sp|Q7TVV6|LEU1_MYCBO 2-isopropylmalate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=leuA PE=3 SV=1 946 1034 4.0E-07
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 651 717 4.0E-07
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 851 917 4.0E-07
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 651 719 4.0E-07
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 875 931 4.0E-07
sp|Q3AZB7|IF2_SYNS9 Translation initiation factor IF-2 OS=Synechococcus sp. (strain CC9902) GN=infB PE=3 SV=1 815 1029 4.0E-07
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 876 928 4.0E-07
sp|Q6UXY8|TMC5_HUMAN Transmembrane channel-like protein 5 OS=Homo sapiens GN=TMC5 PE=2 SV=3 791 1008 4.0E-07
sp|Q1PBC5|SFTPD_MACMU Pulmonary surfactant-associated protein D OS=Macaca mulatta GN=SFTPD PE=2 SV=1 865 1020 4.0E-07
sp|P98086|C1QA_MOUSE Complement C1q subcomponent subunit A OS=Mus musculus GN=C1qa PE=1 SV=2 829 908 4.0E-07
sp|Q90584|COHA1_CHICK Collagen alpha-1(XVII) chain OS=Gallus gallus GN=COL17A1 PE=2 SV=2 768 997 4.0E-07
sp|P23805|CONG_BOVIN Conglutinin OS=Bos taurus GN=CGN1 PE=1 SV=2 891 1057 4.0E-07
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 555 708 5.0E-07
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 916 1056 5.0E-07
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 566 698 5.0E-07
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 555 726 5.0E-07
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 787 989 5.0E-07
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 581 723 5.0E-07
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 556 725 5.0E-07
sp|Q07092|COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens GN=COL16A1 PE=1 SV=2 793 908 5.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 578 641 5.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 641 698 5.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 967 1024 5.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 829 886 5.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 913 970 5.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 850 907 5.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 553 611 5.0E-07
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 920 1049 5.0E-07
sp|A8XV36|COL10_CAEBR Cuticle collagen 10 OS=Caenorhabditis briggsae GN=col-10 PE=3 SV=1 557 636 5.0E-07
sp|P18503|CAS4_EPHMU Short-chain collagen C4 (Fragment) OS=Ephydatia muelleri PE=2 SV=1 581 672 5.0E-07
sp|Q0II24|C1QT9_BOVIN Complement C1q and tumor necrosis factor-related protein 9 OS=Bos taurus GN=C1QTNF9 PE=2 SV=1 868 1036 5.0E-07
sp|A8XV37|CO145_CAEBR Putative cuticle collagen 145 OS=Caenorhabditis briggsae GN=col-145 PE=3 SV=1 796 878 5.0E-07
sp|O35348|COLQ_MOUSE Acetylcholinesterase collagenic tail peptide OS=Mus musculus GN=Colq PE=2 SV=2 823 949 5.0E-07
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 944 1012 5.0E-07
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 900 955 5.0E-07
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 780 854 5.0E-07
sp|Q1PBC5|SFTPD_MACMU Pulmonary surfactant-associated protein D OS=Macaca mulatta GN=SFTPD PE=2 SV=1 872 1032 5.0E-07
sp|Q1PBC5|SFTPD_MACMU Pulmonary surfactant-associated protein D OS=Macaca mulatta GN=SFTPD PE=2 SV=1 767 948 5.0E-07
sp|P23805|CONG_BOVIN Conglutinin OS=Bos taurus GN=CGN1 PE=1 SV=2 795 967 5.0E-07
sp|Q8MHZ9|CL46_BOVIN Collectin-46 OS=Bos taurus GN=CL46 PE=2 SV=1 772 967 5.0E-07
sp|P17140|CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans GN=let-2 PE=1 SV=2 610 726 6.0E-07
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 629 714 6.0E-07
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 601 725 6.0E-07
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 543 725 6.0E-07
sp|Q8BLX7|COGA1_MOUSE Collagen alpha-1(XVI) chain OS=Mus musculus GN=Col16a1 PE=1 SV=2 874 1055 6.0E-07
sp|Q64739|COBA2_MOUSE Collagen alpha-2(XI) chain OS=Mus musculus GN=Col11a2 PE=2 SV=3 556 726 6.0E-07
sp|P13942|COBA2_HUMAN Collagen alpha-2(XI) chain OS=Homo sapiens GN=COL11A2 PE=1 SV=5 556 725 6.0E-07
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 563 725 6.0E-07
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 557 726 6.0E-07
sp|Q60467|CO5A1_CRILO Collagen alpha-1(V) chain OS=Cricetulus longicaudatus GN=COL5A1 PE=2 SV=1 555 680 6.0E-07
sp|Q9JI03|CO5A1_RAT Collagen alpha-1(V) chain OS=Rattus norvegicus GN=Col5a1 PE=1 SV=1 555 680 6.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 859 922 6.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 575 632 6.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 608 671 6.0E-07
sp|P27951|BAG_STRAG IgA FC receptor OS=Streptococcus agalactiae GN=bag PE=1 SV=1 877 1004 6.0E-07
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 926 994 6.0E-07
sp|P34688|DPY7_CAEEL Cuticle collagen dpy-7 OS=Caenorhabditis elegans GN=dpy-7 PE=1 SV=1 618 716 6.0E-07
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 818 874 6.0E-07
sp|C0HJN4|CO1A2_ORYAF Collagen alpha-2(I) chain (Fragments) OS=Orycteropus afer GN=COL1A2 PE=1 SV=1 779 1043 6.0E-07
sp|P02747|C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens GN=C1QC PE=1 SV=3 853 944 6.0E-07
sp|Q70XJ9|LEVS_LACSN Levansucrase OS=Lactobacillus sanfranciscensis GN=levS PE=1 SV=1 783 894 6.0E-07
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 621 711 7.0E-07
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 581 699 7.0E-07
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 916 1056 7.0E-07
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 555 707 7.0E-07
sp|P12106|CO9A1_CHICK Collagen alpha-1(IX) chain OS=Gallus gallus GN=COL9A1 PE=1 SV=4 569 725 7.0E-07
sp|B4YNE6|V6_SPTNK Collagen-like protein V6 OS=Sputnik virophage GN=ORF6 PE=3 SV=1 544 626 7.0E-07
sp|O88207|CO5A1_MOUSE Collagen alpha-1(V) chain OS=Mus musculus GN=Col5a1 PE=1 SV=2 555 680 7.0E-07
sp|Q9Y215|COLQ_HUMAN Acetylcholinesterase collagenic tail peptide OS=Homo sapiens GN=COLQ PE=1 SV=2 557 684 7.0E-07
sp|P18503|CAS4_EPHMU Short-chain collagen C4 (Fragment) OS=Ephydatia muelleri PE=2 SV=1 931 1021 7.0E-07
sp|P27951|BAG_STRAG IgA FC receptor OS=Streptococcus agalactiae GN=bag PE=1 SV=1 801 931 7.0E-07
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 809 877 7.0E-07
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 814 1058 8.0E-07
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 563 722 8.0E-07
sp|Q28247|CO4A5_CANLF Collagen alpha-5(IV) chain OS=Canis lupus familiaris GN=COL4A5 PE=2 SV=2 647 726 8.0E-07
sp|Q8BLX7|COGA1_MOUSE Collagen alpha-1(XVI) chain OS=Mus musculus GN=Col16a1 PE=1 SV=2 794 916 8.0E-07
sp|Q9QZS0|CO4A3_MOUSE Collagen alpha-3(IV) chain OS=Mus musculus GN=Col4a3 PE=1 SV=2 835 941 8.0E-07
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 555 722 8.0E-07
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 651 872 8.0E-07
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 557 722 8.0E-07
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 929 995 8.0E-07
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 831 895 8.0E-07
sp|Q1PBC5|SFTPD_MACMU Pulmonary surfactant-associated protein D OS=Macaca mulatta GN=SFTPD PE=2 SV=1 794 972 8.0E-07
sp|P30204|MSRE_MOUSE Macrophage scavenger receptor types I and II OS=Mus musculus GN=Msr1 PE=1 SV=3 840 910 8.0E-07
sp|Q70XJ9|LEVS_LACSN Levansucrase OS=Lactobacillus sanfranciscensis GN=levS PE=1 SV=1 928 1044 8.0E-07
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 541 725 9.0E-07
sp|Q02788|CO6A2_MOUSE Collagen alpha-2(VI) chain OS=Mus musculus GN=Col6a2 PE=1 SV=3 967 1054 9.0E-07
sp|Q6P4Z2|CO2A1_XENTR Collagen alpha-1(II) chain OS=Xenopus tropicalis GN=col2a1 PE=2 SV=1 556 710 9.0E-07
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 581 723 9.0E-07
sp|Q91717|CO2A1_XENLA Collagen alpha-1(II) chain OS=Xenopus laevis GN=col2a1 PE=2 SV=2 555 726 9.0E-07
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 557 725 9.0E-07
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 557 710 9.0E-07
sp|P16884|NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus GN=Nefh PE=1 SV=4 555 722 9.0E-07
sp|Q9N281|COHA1_CANLF Collagen alpha-1(XVII) chain OS=Canis lupus familiaris GN=COL17A1 PE=2 SV=2 560 681 9.0E-07
sp|Q07092|COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens GN=COL16A1 PE=1 SV=2 829 1056 9.0E-07
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 835 1056 9.0E-07
sp|Q2UY09|COSA1_HUMAN Collagen alpha-1(XXVIII) chain OS=Homo sapiens GN=COL28A1 PE=2 SV=2 534 719 9.0E-07
sp|Q6XPR3|RPTN_HUMAN Repetin OS=Homo sapiens GN=RPTN PE=1 SV=1 799 1056 9.0E-07
sp|C0HJP6|CO1A2_MACSX Collagen alpha-2(I) chain (Fragments) OS=Macrauchenia sp. GN=COL1A2 PE=1 SV=1 790 1058 9.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 961 1018 9.0E-07
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 835 898 9.0E-07
sp|P27951|BAG_STRAG IgA FC receptor OS=Streptococcus agalactiae GN=bag PE=1 SV=1 904 1024 9.0E-07
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 809 875 9.0E-07
sp|P27177|PRIO_CHICK Major prion protein homolog OS=Gallus gallus GN=PRNP PE=1 SV=2 865 922 9.0E-07
sp|P27177|PRIO_CHICK Major prion protein homolog OS=Gallus gallus GN=PRNP PE=1 SV=2 907 964 9.0E-07
sp|P34688|DPY7_CAEEL Cuticle collagen dpy-7 OS=Caenorhabditis elegans GN=dpy-7 PE=1 SV=1 899 992 9.0E-07
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 633 689 9.0E-07
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 927 982 9.0E-07
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 634 687 9.0E-07
sp|Q1PBC5|SFTPD_MACMU Pulmonary surfactant-associated protein D OS=Macaca mulatta GN=SFTPD PE=2 SV=1 877 1059 9.0E-07
sp|P98086|C1QA_MOUSE Complement C1q subcomponent subunit A OS=Mus musculus GN=C1qa PE=1 SV=2 650 726 9.0E-07
sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 889 1059 1.0E-06
sp|P08572|CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens GN=COL4A2 PE=1 SV=4 552 726 1.0E-06
sp|A0MSJ1|CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio GN=col27a1b PE=2 SV=1 555 698 1.0E-06
sp|Q80ZF0|CORA1_RAT Collagen alpha-1(XXVII) chain OS=Rattus norvegicus GN=Col27a1 PE=2 SV=1 555 722 1.0E-06
sp|P02466|CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus GN=Col1a2 PE=1 SV=3 555 710 1.0E-06
sp|A6H584|CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus GN=Col6a5 PE=1 SV=4 557 726 1.0E-06
sp|Q8IZC6|CORA1_HUMAN Collagen alpha-1(XXVII) chain OS=Homo sapiens GN=COL27A1 PE=1 SV=1 566 725 1.0E-06
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 940 1063 1.0E-06
sp|P23206|COAA1_BOVIN Collagen alpha-1(X) chain OS=Bos taurus GN=COL10A1 PE=2 SV=1 552 654 1.0E-06
sp|Q28247|CO4A5_CANLF Collagen alpha-5(IV) chain OS=Canis lupus familiaris GN=COL4A5 PE=2 SV=2 791 938 1.0E-06
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 859 983 1.0E-06
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 850 941 1.0E-06
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 579 678 1.0E-06
sp|P05539|CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus GN=Col2a1 PE=1 SV=2 552 726 1.0E-06
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 545 695 1.0E-06
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 557 726 1.0E-06
sp|A6NHN0|OTOL1_HUMAN Otolin-1 OS=Homo sapiens GN=OTOL1 PE=3 SV=1 543 687 1.0E-06
sp|P12106|CO9A1_CHICK Collagen alpha-1(IX) chain OS=Gallus gallus GN=COL9A1 PE=1 SV=4 556 713 1.0E-06
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 555 710 1.0E-06
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 786 1043 1.0E-06
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 785 934 1.0E-06
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 782 992 1.0E-06
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 557 725 1.0E-06
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 802 1054 1.0E-06
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 560 722 1.0E-06
sp|P16884|NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus GN=Nefh PE=1 SV=4 559 721 1.0E-06
sp|Q61245|COBA1_MOUSE Collagen alpha-1(XI) chain OS=Mus musculus GN=Col11a1 PE=1 SV=2 555 714 1.0E-06
sp|Q03692|COAA1_HUMAN Collagen alpha-1(X) chain OS=Homo sapiens GN=COL10A1 PE=1 SV=2 552 725 1.0E-06
sp|P35799|DPY2_CAEEL Cuticle collagen dpy-2 OS=Caenorhabditis elegans GN=dpy-2 PE=1 SV=1 926 1051 1.0E-06
sp|P35247|SFTPD_HUMAN Pulmonary surfactant-associated protein D OS=Homo sapiens GN=SFTPD PE=1 SV=3 599 725 1.0E-06
sp|Q9R1N9|CODA1_MOUSE Collagen alpha-1(XIII) chain OS=Mus musculus GN=Col13a1 PE=2 SV=1 799 1063 1.0E-06
sp|Q9Y215|COLQ_HUMAN Acetylcholinesterase collagenic tail peptide OS=Homo sapiens GN=COLQ PE=1 SV=2 578 704 1.0E-06
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 596 653 1.0E-06
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 786 841 1.0E-06
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 973 1030 1.0E-06
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 847 904 1.0E-06
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 638 701 1.0E-06
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 569 626 1.0E-06
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 844 901 1.0E-06
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 593 650 1.0E-06
sp|P12114|SQT1_CAEEL Cuticle collagen sqt-1 OS=Caenorhabditis elegans GN=sqt-1 PE=3 SV=2 781 914 1.0E-06
sp|A8XV36|COL10_CAEBR Cuticle collagen 10 OS=Caenorhabditis briggsae GN=col-10 PE=3 SV=1 644 716 1.0E-06
sp|O35167|COLQ_RAT Acetylcholinesterase collagenic tail peptide OS=Rattus norvegicus GN=Colq PE=2 SV=1 625 723 1.0E-06
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 977 1043 1.0E-06
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 606 672 1.0E-06
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 944 1010 1.0E-06
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 941 1007 1.0E-06
sp|P27177|PRIO_CHICK Major prion protein homolog OS=Gallus gallus GN=PRNP PE=1 SV=2 961 1018 1.0E-06
sp|P27177|PRIO_CHICK Major prion protein homolog OS=Gallus gallus GN=PRNP PE=1 SV=2 820 877 1.0E-06
sp|P27177|PRIO_CHICK Major prion protein homolog OS=Gallus gallus GN=PRNP PE=1 SV=2 871 928 1.0E-06
sp|P27177|PRIO_CHICK Major prion protein homolog OS=Gallus gallus GN=PRNP PE=1 SV=2 946 1003 1.0E-06
sp|C0HJP8|CO1A2_TOXSP Collagen alpha-2(I) chain (Fragments) OS=Toxodon sp. GN=COL1A2 PE=1 SV=1 847 1056 1.0E-06
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 585 653 1.0E-06
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 977 1045 1.0E-06
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 929 997 1.0E-06
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 821 886 1.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 864 919 1.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 651 707 1.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 609 665 1.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 911 967 1.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 652 705 1.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 897 950 1.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 810 862 1.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 562 615 1.0E-06
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 977 1043 1.0E-06
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 929 995 1.0E-06
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 941 1007 1.0E-06
sp|Q6UXY8|TMC5_HUMAN Transmembrane channel-like protein 5 OS=Homo sapiens GN=TMC5 PE=2 SV=3 787 993 1.0E-06
sp|Q1PBC5|SFTPD_MACMU Pulmonary surfactant-associated protein D OS=Macaca mulatta GN=SFTPD PE=2 SV=1 818 996 1.0E-06
sp|P16053|NFM_CHICK Neurofilament medium polypeptide OS=Gallus gallus GN=NEFM PE=2 SV=2 553 643 1.0E-06
sp|P16053|NFM_CHICK Neurofilament medium polypeptide OS=Gallus gallus GN=NEFM PE=2 SV=2 561 655 1.0E-06
sp|C0HJP7|CO1A1_TOXSP Collagen alpha-1(I) chain (Fragments) OS=Toxodon sp. GN=COL1A1 PE=1 SV=1 811 1052 1.0E-06
sp|P98086|C1QA_MOUSE Complement C1q subcomponent subunit A OS=Mus musculus GN=C1qa PE=1 SV=2 774 866 1.0E-06
sp|P23805|CONG_BOVIN Conglutinin OS=Bos taurus GN=CGN1 PE=1 SV=2 870 1042 1.0E-06
sp|Q70XJ9|LEVS_LACSN Levansucrase OS=Lactobacillus sanfranciscensis GN=levS PE=1 SV=1 830 942 1.0E-06
sp|P31722|C1QC_RAT Complement C1q subcomponent subunit C OS=Rattus norvegicus GN=C1qc PE=1 SV=2 893 959 1.0E-06
sp|Q80WL1|GLDN_RAT Gliomedin OS=Rattus norvegicus GN=Gldn PE=1 SV=1 656 719 1.0E-06
sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 599 716 2.0E-06
sp|B8V7R6|COA_ACRMI Collagen alpha chain (Fragment) OS=Acropora millepora PE=1 SV=1 545 720 2.0E-06
sp|P30754|CAFF_RIFPA Fibril-forming collagen alpha chain (Fragment) OS=Riftia pachyptila PE=1 SV=2 543 726 2.0E-06
sp|P12111|CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens GN=COL6A3 PE=1 SV=5 587 690 2.0E-06
sp|Q28247|CO4A5_CANLF Collagen alpha-5(IV) chain OS=Canis lupus familiaris GN=COL4A5 PE=2 SV=2 865 949 2.0E-06
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 626 717 2.0E-06
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 556 726 2.0E-06
sp|Q04857|CO6A1_MOUSE Collagen alpha-1(VI) chain OS=Mus musculus GN=Col6a1 PE=1 SV=1 570 707 2.0E-06
sp|P02458|CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens GN=COL2A1 PE=1 SV=3 556 726 2.0E-06
sp|Q8BLX7|COGA1_MOUSE Collagen alpha-1(XVI) chain OS=Mus musculus GN=Col16a1 PE=1 SV=2 793 908 2.0E-06
sp|Q0VF58|COJA1_MOUSE Collagen alpha-1(XIX) chain OS=Mus musculus GN=Col19a1 PE=2 SV=2 603 844 2.0E-06
sp|Q9QZS0|CO4A3_MOUSE Collagen alpha-3(IV) chain OS=Mus musculus GN=Col4a3 PE=1 SV=2 581 699 2.0E-06
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 611 704 2.0E-06
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 555 726 2.0E-06
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 599 692 2.0E-06
sp|A6NE01|F186A_HUMAN Protein FAM186A OS=Homo sapiens GN=FAM186A PE=2 SV=3 781 1045 2.0E-06
sp|P12107|COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens GN=COL11A1 PE=1 SV=4 555 883 2.0E-06
sp|P12107|COBA1_HUMAN Collagen alpha-1(XI) chain OS=Homo sapiens GN=COL11A1 PE=1 SV=4 566 726 2.0E-06
sp|Q14993|COJA1_HUMAN Collagen alpha-1(XIX) chain OS=Homo sapiens GN=COL19A1 PE=1 SV=3 806 1009 2.0E-06
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 599 690 2.0E-06
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 785 934 2.0E-06
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 599 690 2.0E-06
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 557 725 2.0E-06
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 599 690 2.0E-06
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 651 872 2.0E-06
sp|P16884|NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus GN=Nefh PE=1 SV=4 553 726 2.0E-06
sp|P34340|COL90_CAEEL Putative cuticle collagen 90 OS=Caenorhabditis elegans GN=col-90 PE=3 SV=1 942 1058 2.0E-06
sp|Q5TAT6|CODA1_HUMAN Collagen alpha-1(XIII) chain OS=Homo sapiens GN=COL13A1 PE=1 SV=1 786 1013 2.0E-06
sp|A6QPB3|COHA1_BOVIN Collagen alpha-1(XVII) chain OS=Bos taurus GN=COL17A1 PE=2 SV=1 786 869 2.0E-06
sp|Q28083|COBA1_BOVIN Collagen alpha-1(XI) chain (Fragment) OS=Bos taurus GN=COL11A1 PE=1 SV=1 563 719 2.0E-06
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 916 1055 2.0E-06
sp|P04258|CO3A1_BOVIN Collagen alpha-1(III) chain OS=Bos taurus GN=COL3A1 PE=1 SV=1 763 953 2.0E-06
sp|Q6XPR3|RPTN_HUMAN Repetin OS=Homo sapiens GN=RPTN PE=1 SV=1 785 1021 2.0E-06
sp|Q21184|CO155_CAEEL Putative cuticle collagen 155 OS=Caenorhabditis elegans GN=col-155 PE=3 SV=3 783 892 2.0E-06
sp|Q9Y215|COLQ_HUMAN Acetylcholinesterase collagenic tail peptide OS=Homo sapiens GN=COLQ PE=1 SV=2 889 1015 2.0E-06
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 587 644 2.0E-06
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 572 629 2.0E-06
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 793 850 2.0E-06
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 937 994 2.0E-06
sp|P35248|SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus GN=Sftpd PE=1 SV=1 555 721 2.0E-06
sp|P27951|BAG_STRAG IgA FC receptor OS=Streptococcus agalactiae GN=bag PE=1 SV=1 862 989 2.0E-06
sp|P27951|BAG_STRAG IgA FC receptor OS=Streptococcus agalactiae GN=bag PE=1 SV=1 555 668 2.0E-06
sp|P27951|BAG_STRAG IgA FC receptor OS=Streptococcus agalactiae GN=bag PE=1 SV=1 928 1048 2.0E-06
sp|A8XV37|CO145_CAEBR Putative cuticle collagen 145 OS=Caenorhabditis briggsae GN=col-145 PE=3 SV=1 617 713 2.0E-06
sp|A8XV37|CO145_CAEBR Putative cuticle collagen 145 OS=Caenorhabditis briggsae GN=col-145 PE=3 SV=1 779 863 2.0E-06
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 821 886 2.0E-06
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 624 690 2.0E-06
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 980 1045 2.0E-06
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 627 693 2.0E-06
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 887 953 2.0E-06
sp|P27177|PRIO_CHICK Major prion protein homolog OS=Gallus gallus GN=PRNP PE=1 SV=2 886 943 2.0E-06
sp|C0HJP8|CO1A2_TOXSP Collagen alpha-2(I) chain (Fragments) OS=Toxodon sp. GN=COL1A2 PE=1 SV=1 674 1054 2.0E-06
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 851 919 2.0E-06
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 989 1066 2.0E-06
sp|P34688|DPY7_CAEEL Cuticle collagen dpy-7 OS=Caenorhabditis elegans GN=dpy-7 PE=1 SV=1 575 662 2.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 562 617 2.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 800 856 2.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 965 1021 2.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 610 662 2.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 885 938 2.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 954 1007 2.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 873 925 2.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 951 1004 2.0E-06
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 980 1045 2.0E-06
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 585 651 2.0E-06
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 651 717 2.0E-06
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 831 895 2.0E-06
sp|P35246|SFTPD_BOVIN Pulmonary surfactant-associated protein D OS=Bos taurus GN=SFTPD PE=1 SV=2 802 970 2.0E-06
sp|P35246|SFTPD_BOVIN Pulmonary surfactant-associated protein D OS=Bos taurus GN=SFTPD PE=1 SV=2 844 1013 2.0E-06
sp|P35246|SFTPD_BOVIN Pulmonary surfactant-associated protein D OS=Bos taurus GN=SFTPD PE=1 SV=2 841 998 2.0E-06
sp|Q16998|LWA_ACTEQ LWamide neuropeptides (Fragment) OS=Actinia equina PE=2 SV=1 609 723 2.0E-06
sp|P98086|C1QA_MOUSE Complement C1q subcomponent subunit A OS=Mus musculus GN=C1qa PE=1 SV=2 931 1025 2.0E-06
sp|P30204|MSRE_MOUSE Macrophage scavenger receptor types I and II OS=Mus musculus GN=Msr1 PE=1 SV=3 559 629 2.0E-06
sp|P30204|MSRE_MOUSE Macrophage scavenger receptor types I and II OS=Mus musculus GN=Msr1 PE=1 SV=3 930 1000 2.0E-06
sp|P30204|MSRE_MOUSE Macrophage scavenger receptor types I and II OS=Mus musculus GN=Msr1 PE=1 SV=3 625 695 2.0E-06
sp|Q2LK94|COL11_CHICK Collectin-11 OS=Gallus gallus GN=COLEC11 PE=2 SV=1 658 716 2.0E-06
sp|Q90584|COHA1_CHICK Collagen alpha-1(XVII) chain OS=Gallus gallus GN=COL17A1 PE=2 SV=2 826 944 2.0E-06
sp|P23805|CONG_BOVIN Conglutinin OS=Bos taurus GN=CGN1 PE=1 SV=2 842 1015 2.0E-06
sp|P02747|C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens GN=C1QC PE=1 SV=3 964 1049 2.0E-06
sp|P02747|C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens GN=C1QC PE=1 SV=3 623 705 2.0E-06
sp|P31722|C1QC_RAT Complement C1q subcomponent subunit C OS=Rattus norvegicus GN=C1qc PE=1 SV=2 800 866 2.0E-06
sp|Q8IWL2|SFTA1_HUMAN Pulmonary surfactant-associated protein A1 OS=Homo sapiens GN=SFTPA1 PE=1 SV=2 540 633 2.0E-06
sp|Q17460|COL10_CAEEL Cuticle collagen 10 OS=Caenorhabditis elegans GN=col-10 PE=2 SV=1 811 889 2.0E-06
sp|Q810Y4|CONA1_RAT Collagen alpha-1(XXIII) chain OS=Rattus norvegicus GN=Col23a1 PE=1 SV=1 880 1055 2.0E-06
sp|Q05707|COEA1_HUMAN Collagen alpha-1(XIV) chain OS=Homo sapiens GN=COL14A1 PE=1 SV=3 865 1042 2.0E-06
sp|Q8BMF8|GLDN_MOUSE Gliomedin OS=Mus musculus GN=Gldn PE=1 SV=1 812 877 2.0E-06
sp|Q14031|CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens GN=COL4A6 PE=1 SV=3 546 690 3.0E-06
sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=1 SV=4 786 959 3.0E-06
sp|Q63870|CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus GN=Col7a1 PE=1 SV=3 590 722 3.0E-06
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 557 716 3.0E-06
sp|Q01955|CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens GN=COL4A3 PE=1 SV=3 572 661 3.0E-06
sp|Q04857|CO6A1_MOUSE Collagen alpha-1(VI) chain OS=Mus musculus GN=Col6a1 PE=1 SV=1 555 689 3.0E-06
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 545 693 3.0E-06
sp|P53420|CO4A4_HUMAN Collagen alpha-4(IV) chain OS=Homo sapiens GN=COL4A4 PE=1 SV=3 803 1055 3.0E-06
sp|P11087|CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus GN=Col1a1 PE=1 SV=4 602 698 3.0E-06
sp|P98085|COLE_LEPMA Inner ear-specific collagen OS=Lepomis macrochirus PE=2 SV=1 953 1059 3.0E-06
sp|P20909|COBA1_RAT Collagen alpha-1(XI) chain OS=Rattus norvegicus GN=Col11a1 PE=1 SV=2 794 1043 3.0E-06
sp|P83371|OTOL1_ONCKE Otolin-1 OS=Oncorhynchus keta GN=otol1 PE=1 SV=1 973 1059 3.0E-06
sp|P39060|COIA1_HUMAN Collagen alpha-1(XVIII) chain OS=Homo sapiens GN=COL18A1 PE=1 SV=5 785 992 3.0E-06
sp|B7Z0K8|COLL1_DROME Collagen alpha chain CG42342 OS=Drosophila melanogaster GN=CG42342 PE=2 SV=1 629 726 3.0E-06
sp|Q28084|CO4A3_BOVIN Collagen alpha-3(IV) chain (Fragment) OS=Bos taurus GN=COL4A3 PE=1 SV=1 552 699 3.0E-06
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 635 692 3.0E-06
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 593 656 3.0E-06
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 934 991 3.0E-06
sp|Q0II24|C1QT9_BOVIN Complement C1q and tumor necrosis factor-related protein 9 OS=Bos taurus GN=C1QTNF9 PE=2 SV=1 829 997 3.0E-06
sp|P27951|BAG_STRAG IgA FC receptor OS=Streptococcus agalactiae GN=bag PE=1 SV=1 786 911 3.0E-06
sp|O35167|COLQ_RAT Acetylcholinesterase collagenic tail peptide OS=Rattus norvegicus GN=Colq PE=2 SV=1 604 702 3.0E-06
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 989 1066 3.0E-06
sp|P27177|PRIO_CHICK Major prion protein homolog OS=Gallus gallus GN=PRNP PE=1 SV=2 587 644 3.0E-06
sp|C0HJP8|CO1A2_TOXSP Collagen alpha-2(I) chain (Fragments) OS=Toxodon sp. GN=COL1A2 PE=1 SV=1 556 666 3.0E-06
sp|C0HJP8|CO1A2_TOXSP Collagen alpha-2(I) chain (Fragments) OS=Toxodon sp. GN=COL1A2 PE=1 SV=1 794 1058 3.0E-06
sp|O35348|COLQ_MOUSE Acetylcholinesterase collagenic tail peptide OS=Mus musculus GN=Colq PE=2 SV=2 604 702 3.0E-06
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 606 674 3.0E-06
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 561 629 3.0E-06
sp|P34688|DPY7_CAEEL Cuticle collagen dpy-7 OS=Caenorhabditis elegans GN=dpy-7 PE=1 SV=1 587 686 3.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 834 889 3.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 900 953 3.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 918 971 3.0E-06
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 851 917 3.0E-06
sp|P35246|SFTPD_BOVIN Pulmonary surfactant-associated protein D OS=Bos taurus GN=SFTPD PE=1 SV=2 865 1015 3.0E-06
sp|P35246|SFTPD_BOVIN Pulmonary surfactant-associated protein D OS=Bos taurus GN=SFTPD PE=1 SV=2 818 988 3.0E-06
sp|Q1PBC5|SFTPD_MACMU Pulmonary surfactant-associated protein D OS=Macaca mulatta GN=SFTPD PE=2 SV=1 869 1047 3.0E-06
sp|P98086|C1QA_MOUSE Complement C1q subcomponent subunit A OS=Mus musculus GN=C1qa PE=1 SV=2 871 953 3.0E-06
sp|Q2LK94|COL11_CHICK Collectin-11 OS=Gallus gallus GN=COLEC11 PE=2 SV=1 909 968 3.0E-06
sp|Q2LK94|COL11_CHICK Collectin-11 OS=Gallus gallus GN=COLEC11 PE=2 SV=1 823 898 3.0E-06
sp|P23805|CONG_BOVIN Conglutinin OS=Bos taurus GN=CGN1 PE=1 SV=2 839 1013 3.0E-06
sp|P23805|CONG_BOVIN Conglutinin OS=Bos taurus GN=CGN1 PE=1 SV=2 857 1031 3.0E-06
sp|P02747|C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens GN=C1QC PE=1 SV=3 940 1025 3.0E-06
sp|P02747|C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens GN=C1QC PE=1 SV=3 925 995 3.0E-06
sp|P02747|C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens GN=C1QC PE=1 SV=3 802 875 3.0E-06
sp|P02747|C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens GN=C1QC PE=1 SV=3 603 672 3.0E-06
sp|Q80WL1|GLDN_RAT Gliomedin OS=Rattus norvegicus GN=Gldn PE=1 SV=1 812 877 3.0E-06
sp|Q8BMF8|GLDN_MOUSE Gliomedin OS=Mus musculus GN=Gldn PE=1 SV=1 854 919 3.0E-06
sp|Q6ZMJ2|SCAR5_HUMAN Scavenger receptor class A member 5 OS=Homo sapiens GN=SCARA5 PE=2 SV=1 775 856 3.0E-06
sp|P39059|COFA1_HUMAN Collagen alpha-1(XV) chain OS=Homo sapiens GN=COL15A1 PE=1 SV=2 789 994 3.0E-06
sp|Q17RW2|COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens GN=COL24A1 PE=1 SV=2 971 1058 4.0E-06
sp|P53420|CO4A4_HUMAN Collagen alpha-4(IV) chain OS=Homo sapiens GN=COL4A4 PE=1 SV=3 580 964 4.0E-06
sp|P02454|CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus GN=Col1a1 PE=1 SV=5 786 1043 4.0E-06
sp|P08123|CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens GN=COL1A2 PE=1 SV=7 779 1016 4.0E-06
sp|Q2UY09|COSA1_HUMAN Collagen alpha-1(XXVIII) chain OS=Homo sapiens GN=COL28A1 PE=2 SV=2 563 665 4.0E-06
sp|P04258|CO3A1_BOVIN Collagen alpha-1(III) chain OS=Bos taurus GN=COL3A1 PE=1 SV=1 557 720 4.0E-06
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 635 726 4.0E-06
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 604 690 4.0E-06
sp|Q28084|CO4A3_BOVIN Collagen alpha-3(IV) chain (Fragment) OS=Bos taurus GN=COL4A3 PE=1 SV=1 955 1059 4.0E-06
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 931 988 4.0E-06
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 572 635 4.0E-06
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 802 859 4.0E-06
sp|Q01456|OAM_ASCSU Ovarian abundant message protein OS=Ascaris suum GN=OAM PE=2 SV=1 782 924 4.0E-06
sp|P27951|BAG_STRAG IgA FC receptor OS=Streptococcus agalactiae GN=bag PE=1 SV=1 802 922 4.0E-06
sp|O35167|COLQ_RAT Acetylcholinesterase collagenic tail peptide OS=Rattus norvegicus GN=Colq PE=2 SV=1 828 926 4.0E-06
sp|O35167|COLQ_RAT Acetylcholinesterase collagenic tail peptide OS=Rattus norvegicus GN=Colq PE=2 SV=1 892 1019 4.0E-06
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 579 687 4.0E-06
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 884 950 4.0E-06
sp|O35348|COLQ_MOUSE Acetylcholinesterase collagenic tail peptide OS=Mus musculus GN=Colq PE=2 SV=2 828 926 4.0E-06
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 624 693 4.0E-06
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 887 955 4.0E-06
sp|P34688|DPY7_CAEEL Cuticle collagen dpy-7 OS=Caenorhabditis elegans GN=dpy-7 PE=1 SV=1 920 1007 4.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 897 952 4.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 957 1012 4.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 672 726 4.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 783 841 4.0E-06
sp|Q3AZB7|IF2_SYNS9 Translation initiation factor IF-2 OS=Synechococcus sp. (strain CC9902) GN=infB PE=3 SV=1 552 694 4.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 607 660 4.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 622 674 4.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 864 917 4.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 834 886 4.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 855 907 4.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 785 838 4.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 852 904 4.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 912 965 4.0E-06
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 887 953 4.0E-06
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 627 693 4.0E-06
sp|P16053|NFM_CHICK Neurofilament medium polypeptide OS=Gallus gallus GN=NEFM PE=2 SV=2 786 876 4.0E-06
sp|Q16998|LWA_ACTEQ LWamide neuropeptides (Fragment) OS=Actinia equina PE=2 SV=1 902 1029 4.0E-06
sp|Q16998|LWA_ACTEQ LWamide neuropeptides (Fragment) OS=Actinia equina PE=2 SV=1 835 969 4.0E-06
sp|P98086|C1QA_MOUSE Complement C1q subcomponent subunit A OS=Mus musculus GN=C1qa PE=1 SV=2 892 968 4.0E-06
sp|Q2LK94|COL11_CHICK Collectin-11 OS=Gallus gallus GN=COLEC11 PE=2 SV=1 816 874 4.0E-06
sp|P23805|CONG_BOVIN Conglutinin OS=Bos taurus GN=CGN1 PE=1 SV=2 815 991 4.0E-06
sp|P02747|C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens GN=C1QC PE=1 SV=3 922 1010 4.0E-06
sp|P02747|C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens GN=C1QC PE=1 SV=3 895 971 4.0E-06
sp|Q80WL1|GLDN_RAT Gliomedin OS=Rattus norvegicus GN=Gldn PE=1 SV=1 854 919 4.0E-06
sp|Q8K299|SCAR5_MOUSE Scavenger receptor class A member 5 OS=Mus musculus GN=Scara5 PE=1 SV=1 785 856 4.0E-06
sp|Q8K4G2|CONA1_MOUSE Collagen alpha-1(XXIII) chain OS=Mus musculus GN=Col23a1 PE=2 SV=2 805 1013 4.0E-06
sp|P53420|CO4A4_HUMAN Collagen alpha-4(IV) chain OS=Homo sapiens GN=COL4A4 PE=1 SV=3 561 934 5.0E-06
sp|P12106|CO9A1_CHICK Collagen alpha-1(IX) chain OS=Gallus gallus GN=COL9A1 PE=1 SV=4 555 689 5.0E-06
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 566 657 5.0E-06
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 566 657 5.0E-06
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 566 657 5.0E-06
sp|B2RNN3|C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens GN=C1QTNF9B PE=1 SV=1 983 1059 5.0E-06
sp|C0HJN8|CO1A2_TAPTE Collagen alpha-2(I) chain (Fragments) OS=Tapirus terrestris GN=COL1A2 PE=1 SV=1 545 965 5.0E-06
sp|O93484|CO1A2_ONCMY Collagen alpha-2(I) chain OS=Oncorhynchus mykiss GN=col1a2 PE=2 SV=2 584 720 5.0E-06
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 868 925 5.0E-06
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 632 695 5.0E-06
sp|Q0II24|C1QT9_BOVIN Complement C1q and tumor necrosis factor-related protein 9 OS=Bos taurus GN=C1QTNF9 PE=2 SV=1 786 953 5.0E-06
sp|Q0II24|C1QT9_BOVIN Complement C1q and tumor necrosis factor-related protein 9 OS=Bos taurus GN=C1QTNF9 PE=2 SV=1 540 717 5.0E-06
sp|P27951|BAG_STRAG IgA FC receptor OS=Streptococcus agalactiae GN=bag PE=1 SV=1 588 725 5.0E-06
sp|P27951|BAG_STRAG IgA FC receptor OS=Streptococcus agalactiae GN=bag PE=1 SV=1 601 726 5.0E-06
sp|P27951|BAG_STRAG IgA FC receptor OS=Streptococcus agalactiae GN=bag PE=1 SV=1 942 1056 5.0E-06
sp|P27177|PRIO_CHICK Major prion protein homolog OS=Gallus gallus GN=PRNP PE=1 SV=2 904 961 5.0E-06
sp|P27177|PRIO_CHICK Major prion protein homolog OS=Gallus gallus GN=PRNP PE=1 SV=2 928 985 5.0E-06
sp|P27177|PRIO_CHICK Major prion protein homolog OS=Gallus gallus GN=PRNP PE=1 SV=2 862 919 5.0E-06
sp|C0HJP8|CO1A2_TOXSP Collagen alpha-2(I) chain (Fragments) OS=Toxodon sp. GN=COL1A2 PE=1 SV=1 797 1035 5.0E-06
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 941 1009 5.0E-06
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 905 973 5.0E-06
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 884 952 5.0E-06
sp|P34688|DPY7_CAEEL Cuticle collagen dpy-7 OS=Caenorhabditis elegans GN=dpy-7 PE=1 SV=1 570 659 5.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 812 868 5.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 789 844 5.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 810 865 5.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 621 677 5.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 906 961 5.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 837 890 5.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 801 854 5.0E-06
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 944 1010 5.0E-06
sp|Q16998|LWA_ACTEQ LWamide neuropeptides (Fragment) OS=Actinia equina PE=2 SV=1 594 711 5.0E-06
sp|P98086|C1QA_MOUSE Complement C1q subcomponent subunit A OS=Mus musculus GN=C1qa PE=1 SV=2 534 630 5.0E-06
sp|P30204|MSRE_MOUSE Macrophage scavenger receptor types I and II OS=Mus musculus GN=Msr1 PE=1 SV=3 867 937 5.0E-06
sp|Q2LK94|COL11_CHICK Collectin-11 OS=Gallus gallus GN=COLEC11 PE=2 SV=1 882 940 5.0E-06
sp|Q2LK94|COL11_CHICK Collectin-11 OS=Gallus gallus GN=COLEC11 PE=2 SV=1 616 674 5.0E-06
sp|P02747|C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens GN=C1QC PE=1 SV=3 892 973 5.0E-06
sp|Q17460|COL10_CAEEL Cuticle collagen 10 OS=Caenorhabditis elegans GN=col-10 PE=2 SV=1 805 878 5.0E-06
sp|Q17460|COL10_CAEEL Cuticle collagen 10 OS=Caenorhabditis elegans GN=col-10 PE=2 SV=1 785 871 5.0E-06
sp|Q3AHW1|IF2_SYNSC Translation initiation factor IF-2 OS=Synechococcus sp. (strain CC9605) GN=infB PE=3 SV=1 552 694 5.0E-06
sp|P25940|CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens GN=COL5A3 PE=1 SV=3 800 1049 6.0E-06
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 786 916 6.0E-06
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 569 726 6.0E-06
sp|P29400|CO4A5_HUMAN Collagen alpha-5(IV) chain OS=Homo sapiens GN=COL4A5 PE=1 SV=2 626 725 6.0E-06
sp|P02452|CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens GN=COL1A1 PE=1 SV=5 567 726 6.0E-06
sp|P0C862|C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens GN=C1QTNF9 PE=1 SV=1 983 1059 6.0E-06
sp|Q07092|COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens GN=COL16A1 PE=1 SV=2 787 926 6.0E-06
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 799 1048 6.0E-06
sp|P31721|C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus GN=C1qb PE=1 SV=2 796 853 6.0E-06
sp|A8XV37|CO145_CAEBR Putative cuticle collagen 145 OS=Caenorhabditis briggsae GN=col-145 PE=3 SV=1 605 702 6.0E-06
sp|O35167|COLQ_RAT Acetylcholinesterase collagenic tail peptide OS=Rattus norvegicus GN=Colq PE=2 SV=1 811 937 6.0E-06
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 561 627 6.0E-06
sp|O35348|COLQ_MOUSE Acetylcholinesterase collagenic tail peptide OS=Mus musculus GN=Colq PE=2 SV=2 892 1019 6.0E-06
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 627 695 6.0E-06
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 788 856 6.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 989 1045 6.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 854 910 6.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 568 623 6.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 777 838 6.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 556 609 6.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 643 695 6.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 831 883 6.0E-06
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 561 627 6.0E-06
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 609 674 6.0E-06
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 911 976 6.0E-06
sp|P35246|SFTPD_BOVIN Pulmonary surfactant-associated protein D OS=Bos taurus GN=SFTPD PE=1 SV=2 558 713 6.0E-06
sp|P35246|SFTPD_BOVIN Pulmonary surfactant-associated protein D OS=Bos taurus GN=SFTPD PE=1 SV=2 781 959 6.0E-06
sp|Q16998|LWA_ACTEQ LWamide neuropeptides (Fragment) OS=Actinia equina PE=2 SV=1 812 939 6.0E-06
sp|P30204|MSRE_MOUSE Macrophage scavenger receptor types I and II OS=Mus musculus GN=Msr1 PE=1 SV=3 792 862 6.0E-06
sp|Q2LK94|COL11_CHICK Collectin-11 OS=Gallus gallus GN=COLEC11 PE=2 SV=1 789 848 6.0E-06
sp|Q8MHZ9|CL46_BOVIN Collectin-46 OS=Bos taurus GN=CL46 PE=2 SV=1 893 1059 6.0E-06
sp|P02747|C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens GN=C1QC PE=1 SV=3 635 717 6.0E-06
sp|P31720|C1QA_RAT Complement C1q subcomponent subunit A OS=Rattus norvegicus GN=C1qa PE=1 SV=2 970 1046 6.0E-06
sp|Q02388|CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens GN=COL7A1 PE=1 SV=2 910 1016 7.0E-06
sp|Q01149|CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus GN=Col1a2 PE=1 SV=2 555 707 7.0E-06
sp|P28481|CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus GN=Col2a1 PE=1 SV=2 575 725 7.0E-06
sp|Q9YIB4|CO1A1_CYNPY Collagen alpha-1(I) chain OS=Cynops pyrrhogaster GN=COL1A1 PE=2 SV=1 783 965 7.0E-06
sp|Q32S24|COBA2_BOVIN Collagen alpha-2(XI) chain OS=Bos taurus GN=COL11A2 PE=3 SV=1 559 726 7.0E-06
sp|P02453|CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus GN=COL1A1 PE=1 SV=3 567 726 7.0E-06
sp|Q60467|CO5A1_CRILO Collagen alpha-1(V) chain OS=Cricetulus longicaudatus GN=COL5A1 PE=2 SV=1 566 913 7.0E-06
sp|Q21184|CO155_CAEEL Putative cuticle collagen 155 OS=Caenorhabditis elegans GN=col-155 PE=3 SV=3 939 1055 7.0E-06
sp|P27951|BAG_STRAG IgA FC receptor OS=Streptococcus agalactiae GN=bag PE=1 SV=1 855 973 7.0E-06
sp|O35348|COLQ_MOUSE Acetylcholinesterase collagenic tail peptide OS=Mus musculus GN=Colq PE=2 SV=2 584 696 7.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 941 997 7.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 558 614 7.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 978 1033 7.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 828 881 7.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 957 1010 7.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 819 872 7.0E-06
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 809 875 7.0E-06
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 821 886 7.0E-06
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 863 928 7.0E-06
sp|P16053|NFM_CHICK Neurofilament medium polypeptide OS=Gallus gallus GN=NEFM PE=2 SV=2 591 688 7.0E-06
sp|P30204|MSRE_MOUSE Macrophage scavenger receptor types I and II OS=Mus musculus GN=Msr1 PE=1 SV=3 652 722 7.0E-06
sp|P30204|MSRE_MOUSE Macrophage scavenger receptor types I and II OS=Mus musculus GN=Msr1 PE=1 SV=3 876 946 7.0E-06
sp|Q2LK94|COL11_CHICK Collectin-11 OS=Gallus gallus GN=COLEC11 PE=2 SV=1 906 964 7.0E-06
sp|Q2LK94|COL11_CHICK Collectin-11 OS=Gallus gallus GN=COLEC11 PE=2 SV=1 801 859 7.0E-06
sp|Q2LK94|COL11_CHICK Collectin-11 OS=Gallus gallus GN=COLEC11 PE=2 SV=1 963 1021 7.0E-06
sp|Q8MHZ9|CL46_BOVIN Collectin-46 OS=Bos taurus GN=CL46 PE=2 SV=1 872 1042 7.0E-06
sp|P02747|C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens GN=C1QC PE=1 SV=3 847 917 7.0E-06
sp|P31722|C1QC_RAT Complement C1q subcomponent subunit C OS=Rattus norvegicus GN=C1qc PE=1 SV=2 824 889 7.0E-06
sp|Q05707|COEA1_HUMAN Collagen alpha-1(XIV) chain OS=Homo sapiens GN=COL14A1 PE=1 SV=3 787 959 7.0E-06
sp|P55787|CO4A4_RABIT Collagen alpha-4(IV) chain (Fragment) OS=Oryctolagus cuniculus GN=COL4A4 PE=2 SV=1 907 1004 7.0E-06
sp|P21758|MSRE_BOVIN Macrophage scavenger receptor types I and II OS=Bos taurus GN=MSR1 PE=1 SV=1 827 910 7.0E-06
sp|Q3U962|CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus GN=Col5a2 PE=1 SV=1 556 725 8.0E-06
sp|P02459|CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus GN=COL2A1 PE=1 SV=4 555 698 8.0E-06
sp|A6NE01|F186A_HUMAN Protein FAM186A OS=Homo sapiens GN=FAM186A PE=2 SV=3 869 1057 8.0E-06
sp|P02465|CO1A2_BOVIN Collagen alpha-2(I) chain OS=Bos taurus GN=COL1A2 PE=1 SV=2 555 713 8.0E-06
sp|Q9XSJ7|CO1A1_CANLF Collagen alpha-1(I) chain OS=Canis lupus familiaris GN=COL1A1 PE=1 SV=1 567 726 8.0E-06
sp|P18856|CAF1_EPHMU Collagen EMF1-alpha (Fragment) OS=Ephydatia muelleri GN=COLF1 PE=3 SV=2 611 726 8.0E-06
sp|P02467|CO1A2_CHICK Collagen alpha-2(I) chain (Fragments) OS=Gallus gallus GN=COL1A2 PE=1 SV=2 572 704 8.0E-06
sp|Q2UY09|COSA1_HUMAN Collagen alpha-1(XXVIII) chain OS=Homo sapiens GN=COL28A1 PE=2 SV=2 557 723 8.0E-06
sp|Q0II24|C1QT9_BOVIN Complement C1q and tumor necrosis factor-related protein 9 OS=Bos taurus GN=C1QTNF9 PE=2 SV=1 790 958 8.0E-06
sp|P27951|BAG_STRAG IgA FC receptor OS=Streptococcus agalactiae GN=bag PE=1 SV=1 856 979 8.0E-06
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 663 726 8.0E-06
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 829 893 8.0E-06
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 863 928 8.0E-06
sp|O35348|COLQ_MOUSE Acetylcholinesterase collagenic tail peptide OS=Mus musculus GN=Colq PE=2 SV=2 811 937 8.0E-06
sp|Q60994|ADIPO_MOUSE Adiponectin OS=Mus musculus GN=Adipoq PE=1 SV=2 863 928 8.0E-06
sp|Q2KIV9|C1QB_BOVIN Complement C1q subcomponent subunit B OS=Bos taurus GN=C1QB PE=1 SV=1 603 662 8.0E-06
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 822 875 8.0E-06
sp|P35246|SFTPD_BOVIN Pulmonary surfactant-associated protein D OS=Bos taurus GN=SFTPD PE=1 SV=2 832 1001 8.0E-06
sp|P30204|MSRE_MOUSE Macrophage scavenger receptor types I and II OS=Mus musculus GN=Msr1 PE=1 SV=3 909 979 8.0E-06
sp|Q2LK94|COL11_CHICK Collectin-11 OS=Gallus gallus GN=COLEC11 PE=2 SV=1 868 943 8.0E-06
sp|P02747|C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens GN=C1QC PE=1 SV=3 593 678 8.0E-06
sp|P02747|C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens GN=C1QC PE=1 SV=3 826 911 8.0E-06
sp|Q70XJ9|LEVS_LACSN Levansucrase OS=Lactobacillus sanfranciscensis GN=levS PE=1 SV=1 578 683 8.0E-06
sp|Q05707|COEA1_HUMAN Collagen alpha-1(XIV) chain OS=Homo sapiens GN=COL14A1 PE=1 SV=3 578 671 8.0E-06
sp|Q8K4G2|CONA1_MOUSE Collagen alpha-1(XXIII) chain OS=Mus musculus GN=Col23a1 PE=2 SV=2 569 720 8.0E-06
sp|Q17459|CO145_CAEEL Putative cuticle collagen 145 OS=Caenorhabditis elegans GN=col-145 PE=3 SV=2 785 839 8.0E-06
sp|Q9QZR9|CO4A4_MOUSE Collagen alpha-4(IV) chain OS=Mus musculus GN=Col4a4 PE=2 SV=1 806 1057 9.0E-06
sp|P12105|CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus GN=COL3A1 PE=2 SV=2 843 1056 9.0E-06
sp|C0HJP0|CO1A2_EQUSP Collagen alpha-2(I) chain (Fragments) OS=Equus sp. GN=COL1A2 PE=1 SV=1 848 1054 9.0E-06
sp|P85154|CO1A2_MAMAE Collagen alpha-2(I) chain OS=Mammut americanum PE=1 SV=3 590 678 9.0E-06
sp|P20908|CO5A1_HUMAN Collagen alpha-1(V) chain OS=Homo sapiens GN=COL5A1 PE=1 SV=3 785 928 9.0E-06
sp|Q3Y5Z3|ADIPO_BOVIN Adiponectin OS=Bos taurus GN=ADIPOQ PE=1 SV=1 908 971 9.0E-06
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 884 950 9.0E-06
sp|Q15848|ADIPO_HUMAN Adiponectin OS=Homo sapiens GN=ADIPOQ PE=1 SV=1 818 883 9.0E-06
sp|P16053|NFM_CHICK Neurofilament medium polypeptide OS=Gallus gallus GN=NEFM PE=2 SV=2 852 945 9.0E-06
sp|Q16998|LWA_ACTEQ LWamide neuropeptides (Fragment) OS=Actinia equina PE=2 SV=1 558 691 9.0E-06
sp|Q16998|LWA_ACTEQ LWamide neuropeptides (Fragment) OS=Actinia equina PE=2 SV=1 557 666 9.0E-06
sp|P98086|C1QA_MOUSE Complement C1q subcomponent subunit A OS=Mus musculus GN=C1qa PE=1 SV=2 608 684 9.0E-06
sp|P30204|MSRE_MOUSE Macrophage scavenger receptor types I and II OS=Mus musculus GN=Msr1 PE=1 SV=3 963 1033 9.0E-06
sp|P30204|MSRE_MOUSE Macrophage scavenger receptor types I and II OS=Mus musculus GN=Msr1 PE=1 SV=3 580 650 9.0E-06
sp|P30204|MSRE_MOUSE Macrophage scavenger receptor types I and II OS=Mus musculus GN=Msr1 PE=1 SV=3 810 880 9.0E-06
sp|P30204|MSRE_MOUSE Macrophage scavenger receptor types I and II OS=Mus musculus GN=Msr1 PE=1 SV=3 616 686 9.0E-06
sp|Q2LK94|COL11_CHICK Collectin-11 OS=Gallus gallus GN=COLEC11 PE=2 SV=1 930 988 9.0E-06
sp|Q2LK94|COL11_CHICK Collectin-11 OS=Gallus gallus GN=COLEC11 PE=2 SV=1 931 1007 9.0E-06
sp|P02747|C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens GN=C1QC PE=1 SV=3 617 699 9.0E-06
sp|P02747|C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens GN=C1QC PE=1 SV=3 901 989 9.0E-06
sp|P31722|C1QC_RAT Complement C1q subcomponent subunit C OS=Rattus norvegicus GN=C1qc PE=1 SV=2 621 686 9.0E-06
sp|Q02105|C1QC_MOUSE Complement C1q subcomponent subunit C OS=Mus musculus GN=C1qc PE=1 SV=2 925 986 9.0E-06
sp|A8G6Z5|IF2_PROM2 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9215) GN=infB PE=3 SV=1 799 917 9.0E-06
sp|P20849|CO9A1_HUMAN Collagen alpha-1(IX) chain OS=Homo sapiens GN=COL9A1 PE=1 SV=3 915 1056 1.0E-05
sp|P12106|CO9A1_CHICK Collagen alpha-1(IX) chain OS=Gallus gallus GN=COL9A1 PE=1 SV=4 578 725 1.0E-05
sp|P27951|BAG_STRAG IgA FC receptor OS=Streptococcus agalactiae GN=bag PE=1 SV=1 886 1006 1.0E-05
sp|O35167|COLQ_RAT Acetylcholinesterase collagenic tail peptide OS=Rattus norvegicus GN=Colq PE=2 SV=1 904 1031 1.0E-05
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 604 656 1.0E-05
sp|P02746|C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens GN=C1QB PE=1 SV=3 649 701 1.0E-05
sp|P35246|SFTPD_BOVIN Pulmonary surfactant-associated protein D OS=Bos taurus GN=SFTPD PE=1 SV=2 851 1022 1.0E-05
sp|P30204|MSRE_MOUSE Macrophage scavenger receptor types I and II OS=Mus musculus GN=Msr1 PE=1 SV=3 586 656 1.0E-05
sp|P02747|C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens GN=C1QC PE=1 SV=3 557 639 1.0E-05
sp|A8G6Z5|IF2_PROM2 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9215) GN=infB PE=3 SV=1 570 672 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7444
MKYALALLAASASLDQAQATFFFGKKWQNAPMYNTPGQMDNYYCNEKQKSGWDWKGLPDGQVSNYDGLSLKGFSV
MSGGSASKRDLRNRDLLDKFITGESSPDMNESPSIESPDNTFSIDSFDMSTEFDTRMEFHYEMEDGSICKTTQDS
STDISTIVNSQCGGAKKVTFIHPDEPQQNNEKRTLGKLGKGKKKKFWKKKCKTKIHKVKWHCKKKVKKPTTKPTV
TQPATTQPGTTVTQPGTTEPGTTVTQPGTTVTQPGTTVSEPGTTVTQPGTTVSQPGTTVTQPGTTVSQPGTTDTV
TQPGTTVSQPGTTDTVTQPGTTVSQPGTTVSQPGTTDTVTQPGTTVSQPGTTVSQPGTTDTVTQPGTTDTVTQPG
TTGTITQPGTTVTTCIITSATTIPSCGPQIPECSGVPTGSSTVVTKTVPASGTDCSVTQPPDQTSPPGVTQTTCV
ITSATTIPSCGPQIPECSGVPTGSSTVITKTVPASGTDCSVTQPPDQTSPPGVTQTTCVITSATTIPSCGPQIPE
CSGVPTGSSTVVTKTVPASGTDCENVPTPTPGQPGTPGTPGTPGTPGQPGTPGQPGTPGQPGEPGTPGQPGTPGQ
PGNPGTPGQPGTPGQPGTPGQPGTPGQPGTPGQPGTPGQPGTPGQPGEPGQPGTPGTPGQPGTPGQPGEPGKPGT
PGQPGTPGTPGQPGEPGQPGTPGQPGTPGQPGTPGQPGEPGQPGTPGTPGQXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXWPAWYAWSTWRAWQARPALLALPPGTPGTPGQPGEPGKPGTPGQPGTPGQPGTPGQPGTPGQP
GEPGKPGTPGQPGTPGTPGQPGEPGQPGQPGTPGQPGTPGTPGQPGEPGKPGTPGQPGTPGTPGQPGEPGTPGTP
GQPGTPGTPGQPGEPGKPGTPGQPGTPGTPGTPGQPGEPGQPGQPGTPGQPGEPGTPGTPGTPGQPGEPGKPGTP
GTPGTPGQPGTPGQPGEPGKPGTPGTPGQPGEPGKPGTPGQPGTPGTPGQPGEPGTPGTPGTPGQPGEPGTPGQP
GTPGTPAWHPWHSRYSWRTR*
Coding >OphauB2|7444
ATGAAGTACGCGCTTGCCCTCCTGGCGGCCTCGGCCAGCCTCGATCAGGCACAGGCAACTTTCTTTTTTGGGAAA
AAATGGCAAAACGCGCCAATGTACAACACGCCTGGTCAAATGGACAACTACTACTGTAATGAAAAACAAAAGTCG
GGATGGGACTGGAAGGGCTTGCCCGATGGTCAGGTTTCTAATTACGACGGTCTATCTCTAAAAGGCTTCTCCGTC
ATGAGTGGCGGGTCGGCAAGCAAGCGGGACCTCCGCAACCGCGATCTTTTGGACAAGTTTATCACGGGTGAAAGT
AGCCCTGATATGAACGAGTCGCCTTCAATCGAGAGCCCGGACAACACGTTTTCTATCGACAGTTTTGACATGTCG
ACCGAGTTCGACACGCGAATGGAGTTCCACTATGAGATGGAGGATGGCAGCATTTGCAAGACGACGCAAGATTCG
AGTACCGACATCAGCACCATTGTCAACTCTCAGTGCGGTGGCGCCAAGAAGGTGACCTTCATCCACCCTGACGAA
CCCCAGCAGAACAATGAGAAGAGGACCTTGGGAAAGCTTGGCAAGGGCAAGAAGAAGAAGTTCTGGAAGAAGAAG
TGCAAGACCAAGATCCACAAGGTCAAGTGGCACTGCAAGAAGAAGGTCAAGAAGCCCACAACCAAGCCCACTGTC
ACTCAGCCGGCAACCACTCAGCCAGGCACCACTGTCACTCAGCCTGGAACCACTGAACCAGGCACCACTGTCACT
CAGCCCGGAACCACTGTCACTCAGCCAGGCACCACTGTCTCAGAGCCCGGCACTACTGTCACTCAGCCAGGCACC
ACTGTCTCGCAGCCAGGCACCACTGTCACTCAGCCCGGAACGACGGTATCGCAGCCCGGCACCACAGACACCGTC
ACTCAACCCGGCACTACCGTCTCCCAGCCCGGCACCACAGACACCGTCACTCAGCCCGGCACTACCGTCTCCCAG
CCTGGCACTACCGTCTCCCAGCCCGGCACCACAGACACCGTCACTCAGCCCGGCACCACTGTTTCGCAGCCTGGC
ACGACGGTCTCTCAGCCCGGCACCACAGACACCGTCACTCAGCCTGGCACGACGGATACCGTTACTCAACCTGGC
ACTACTGGCACCATCACTCAGCCCGGAACTACTGTCACCACTTGCATCATCACGTCGGCTACCACGATCCCAAGC
TGTGGTCCCCAGATCCCCGAGTGCTCTGGTGTCCCCACTGGCAGCTCTACTGTCGTTACCAAGACGGTGCCTGCT
TCTGGAACCGACTGCTCAGTCACTCAGCCACCTGACCAGACCTCGCCGCCAGGTGTCACTCAGACTACTTGTGTC
ATCACGTCGGCTACAACGATCCCAAGCTGCGGTCCTCAGATCCCCGAGTGCTCTGGTGTCCCCACTGGCAGCTCT
ACTGTGATTACCAAGACGGTGCCTGCTTCTGGAACCGACTGCTCAGTCACTCAGCCACCTGACCAGACCTCGCCT
CCAGGTGTCACTCAGACTACTTGTGTCATCACATCGGCTACCACAATCCCAAGCTGCGGTCCTCAGATCCCCGAG
TGCTCTGGTGTCCCCACTGGCAGCTCTACTGTCGTTACCAAGACGGTGCCAGCTAGCGGAACCGATTGCGAGAAT
GTTCCTACGCCGACTCCTGGCCAGCCCGGTACCCCTGGCACTCCTGGCACTCCTGGCACTCCTGGCCAGCCCGGC
ACTCCTGGTCAGCCCGGCACTCCTGGTCAACCTGGCGAGCCCGGCACTCCTGGTCAGCCCGGCACTCCTGGCCAG
CCCGGAAACCCTGGCACTCCTGGCCAGCCCGGCACTCCTGGTCAACCCGGCACTCCTGGTCAACCCGGCACTCCT
GGGCAGCCCGGCACTCCTGGTCAGCCCGGCACTCCTGGTCAGCCCGGCACTCCTGGCCAGCCTGGCGAGCCTGGA
CAGCCCGGTACTCCCGGTACTCCTGGCCAACCCGGCACTCCTGGTCAGCCTGGTGAGCCTGGCAAGCCCGGTACT
CCTGGCCAACCTGGTACTCCTGGCACGCCTGGCCAGCCCGGCGAGCCTGGTCAGCCCGGCACTCCTGGTCAGCCT
GGCACTCCTGGTCAGCCTGGCACTCCTGGCCAGCCTGGCGAGCCTGGACAGCCCGGTACTCCTGGCACTCCTGGC
CAGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCTGGCCAGCCTGGTACGCCTGGTCAACCTGGCGAGCCTGG
CAAGCCCGCCCGGCACTCCTGGCACTCCCGCCCGGCACTCCTGGCACTCCTGGTCAACCCGGCGAGCCTGGCAAG
CCCGGTACTCCTGGCCAGCCTGGCACTCCTGGCCAGCCCGGCACTCCTGGCCAACCCGGCACTCCTGGTCAGCCT
GGTGAGCCTGGCAAGCCCGGTACTCCTGGCCAACCAGGCACTCCTGGCACGCCTGGCCAGCCCGGCGAGCCTGGT
CAGCCTGGTCAACCCGGTACTCCTGGTCAGCCCGGTACTCCCGGCACTCCTGGCCAGCCTGGTGAGCCTGGCAAG
CCCGGTACTCCTGGTCAGCCCGGTACTCCCGGCACTCCTGGCCAGCCTGGTGAGCCTGGCACTCCCGGTACTCCT
GGCCAACCTGGCACGCCTGGCACGCCTGGCCAACCCGGCGAGCCTGGCAAGCCCGGTACTCCTGGCCAGCCCGGT
ACTCCTGGCACTCCCGGTACGCCTGGTCAACCCGGCGAGCCCGGCCAGCCCGGCCAGCCCGGCACCCCTGGTCAG
CCTGGCGAGCCCGGTACTCCTGGCACTCCCGGTACTCCTGGTCAGCCTGGCGAGCCTGGCAAGCCCGGTACTCCT
GGCACTCCCGGTACGCCTGGTCAACCCGGTACGCCTGGTCAGCCCGGCGAGCCCGGCAAGCCCGGTACTCCTGGC
ACTCCTGGCCAGCCTGGCGAGCCTGGCAAGCCGGGTACGCCTGGACAGCCCGGCACTCCTGGCACTCCTGGCCAG
CCTGGTGAGCCTGGCACTCCTGGCACTCCCGGTACACCTGGCCAACCCGGTGAGCCTGGCACTCCTGGCCAGCCC
GGTACGCCTGGCACTCCCGCCTGGCACCCCTGGCACTCCCGGTACTCCTGGAGAACCCGGTAA
Transcript >OphauB2|7444
ATGAAGTACGCGCTTGCCCTCCTGGCGGCCTCGGCCAGCCTCGATCAGGCACAGGCAACTTTCTTTTTTGGGAAA
AAATGGCAAAACGCGCCAATGTACAACACGCCTGGTCAAATGGACAACTACTACTGTAATGAAAAACAAAAGTCG
GGATGGGACTGGAAGGGCTTGCCCGATGGTCAGGTTTCTAATTACGACGGTCTATCTCTAAAAGGCTTCTCCGTC
ATGAGTGGCGGGTCGGCAAGCAAGCGGGACCTCCGCAACCGCGATCTTTTGGACAAGTTTATCACGGGTGAAAGT
AGCCCTGATATGAACGAGTCGCCTTCAATCGAGAGCCCGGACAACACGTTTTCTATCGACAGTTTTGACATGTCG
ACCGAGTTCGACACGCGAATGGAGTTCCACTATGAGATGGAGGATGGCAGCATTTGCAAGACGACGCAAGATTCG
AGTACCGACATCAGCACCATTGTCAACTCTCAGTGCGGTGGCGCCAAGAAGGTGACCTTCATCCACCCTGACGAA
CCCCAGCAGAACAATGAGAAGAGGACCTTGGGAAAGCTTGGCAAGGGCAAGAAGAAGAAGTTCTGGAAGAAGAAG
TGCAAGACCAAGATCCACAAGGTCAAGTGGCACTGCAAGAAGAAGGTCAAGAAGCCCACAACCAAGCCCACTGTC
ACTCAGCCGGCAACCACTCAGCCAGGCACCACTGTCACTCAGCCTGGAACCACTGAACCAGGCACCACTGTCACT
CAGCCCGGAACCACTGTCACTCAGCCAGGCACCACTGTCTCAGAGCCCGGCACTACTGTCACTCAGCCAGGCACC
ACTGTCTCGCAGCCAGGCACCACTGTCACTCAGCCCGGAACGACGGTATCGCAGCCCGGCACCACAGACACCGTC
ACTCAACCCGGCACTACCGTCTCCCAGCCCGGCACCACAGACACCGTCACTCAGCCCGGCACTACCGTCTCCCAG
CCTGGCACTACCGTCTCCCAGCCCGGCACCACAGACACCGTCACTCAGCCCGGCACCACTGTTTCGCAGCCTGGC
ACGACGGTCTCTCAGCCCGGCACCACAGACACCGTCACTCAGCCTGGCACGACGGATACCGTTACTCAACCTGGC
ACTACTGGCACCATCACTCAGCCCGGAACTACTGTCACCACTTGCATCATCACGTCGGCTACCACGATCCCAAGC
TGTGGTCCCCAGATCCCCGAGTGCTCTGGTGTCCCCACTGGCAGCTCTACTGTCGTTACCAAGACGGTGCCTGCT
TCTGGAACCGACTGCTCAGTCACTCAGCCACCTGACCAGACCTCGCCGCCAGGTGTCACTCAGACTACTTGTGTC
ATCACGTCGGCTACAACGATCCCAAGCTGCGGTCCTCAGATCCCCGAGTGCTCTGGTGTCCCCACTGGCAGCTCT
ACTGTGATTACCAAGACGGTGCCTGCTTCTGGAACCGACTGCTCAGTCACTCAGCCACCTGACCAGACCTCGCCT
CCAGGTGTCACTCAGACTACTTGTGTCATCACATCGGCTACCACAATCCCAAGCTGCGGTCCTCAGATCCCCGAG
TGCTCTGGTGTCCCCACTGGCAGCTCTACTGTCGTTACCAAGACGGTGCCAGCTAGCGGAACCGATTGCGAGAAT
GTTCCTACGCCGACTCCTGGCCAGCCCGGTACCCCTGGCACTCCTGGCACTCCTGGCACTCCTGGCCAGCCCGGC
ACTCCTGGTCAGCCCGGCACTCCTGGTCAACCTGGCGAGCCCGGCACTCCTGGTCAGCCCGGCACTCCTGGCCAG
CCCGGAAACCCTGGCACTCCTGGCCAGCCCGGCACTCCTGGTCAACCCGGCACTCCTGGTCAACCCGGCACTCCT
GGGCAGCCCGGCACTCCTGGTCAGCCCGGCACTCCTGGTCAGCCCGGCACTCCTGGCCAGCCTGGCGAGCCTGGA
CAGCCCGGTACTCCCGGTACTCCTGGCCAACCCGGCACTCCTGGTCAGCCTGGTGAGCCTGGCAAGCCCGGTACT
CCTGGCCAACCTGGTACTCCTGGCACGCCTGGCCAGCCCGGCGAGCCTGGTCAGCCCGGCACTCCTGGTCAGCCT
GGCACTCCTGGTCAGCCTGGCACTCCTGGCCAGCCTGGCGAGCCTGGACAGCCCGGTACTCCTGGCACTCCTGGC
CAGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCTGGCCAGCCTGGTACGCCTGGTCAACCTGGCGAGCCTGG
CAAGCCCGCCCGGCACTCCTGGCACTCCCGCCCGGCACTCCTGGCACTCCTGGTCAACCCGGCGAGCCTGGCAAG
CCCGGTACTCCTGGCCAGCCTGGCACTCCTGGCCAGCCCGGCACTCCTGGCCAACCCGGCACTCCTGGTCAGCCT
GGTGAGCCTGGCAAGCCCGGTACTCCTGGCCAACCAGGCACTCCTGGCACGCCTGGCCAGCCCGGCGAGCCTGGT
CAGCCTGGTCAACCCGGTACTCCTGGTCAGCCCGGTACTCCCGGCACTCCTGGCCAGCCTGGTGAGCCTGGCAAG
CCCGGTACTCCTGGTCAGCCCGGTACTCCCGGCACTCCTGGCCAGCCTGGTGAGCCTGGCACTCCCGGTACTCCT
GGCCAACCTGGCACGCCTGGCACGCCTGGCCAACCCGGCGAGCCTGGCAAGCCCGGTACTCCTGGCCAGCCCGGT
ACTCCTGGCACTCCCGGTACGCCTGGTCAACCCGGCGAGCCCGGCCAGCCCGGCCAGCCCGGCACCCCTGGTCAG
CCTGGCGAGCCCGGTACTCCTGGCACTCCCGGTACTCCTGGTCAGCCTGGCGAGCCTGGCAAGCCCGGTACTCCT
GGCACTCCCGGTACGCCTGGTCAACCCGGTACGCCTGGTCAGCCCGGCGAGCCCGGCAAGCCCGGTACTCCTGGC
ACTCCTGGCCAGCCTGGCGAGCCTGGCAAGCCGGGTACGCCTGGACAGCCCGGCACTCCTGGCACTCCTGGCCAG
CCTGGTGAGCCTGGCACTCCTGGCACTCCCGGTACACCTGGCCAACCCGGTGAGCCTGGCACTCCTGGCCAGCCC
GGTACGCCTGGCACTCCCGCCTGGCACCCCTGGCACTCCCGGTACTCCTGGAGAACCCGGTAA
Gene >OphauB2|7444
ATGAAGTACGCGCTTGCCCTCCTGGCGGCCTCGGCCAGCCTCGATCAGGCACAGGCAACTGTGAGTTATTCCGGC
TTGTTTTTGCATACTTGGGCAACATGTGCTGACATGTAATTTCTATCAAGTTCTTTTTTGGGAAAAAATGGCAAA
ACGCGCCAATGTACAACACGCCTGGTCAAATGGACAACTACTACTGTAATGAAAAACAAAAGTCGGGATGGGACT
GGAAGGGCTTGCCCGATGGTCAGGTTTCTAATTACGACGGTCTATCTCTAAAAGGCTTCTCCGTCATGAGTGGCG
GGTCGGCAAGCAAGCGGGACCTCCGCAACCGCGATCTTTTGGACAAGTTTATCACGGGTGAAAGTAGCCCTGATA
TGAACGAGTCGCCTTCAATCGAGAGCCCGGACAACACGTTTTCTATCGACAGTTTTGACATGTCGACCGAGTTCG
ACACGCGAATGGAGTTCCACTATGAGATGGAGGATGGCAGCATTTGCAAGACGACGCAAGATTCGAGTACCGACA
TCAGCACCATTGTCAACTCTCAGTGCGGTGGCGCCAAGAAGGTGACCTTCATCCACCCTGACGAACCCCAGCAGA
ACAATGAGAAGAGGACCTTGGGAAAGCTTGGCAAGGGCAAGAAGAAGAAGTTCTGGAAGAAGAAGTGCAAGACCA
AGATCCACAAGGTCAAGTGGCACTGCAAGAAGAAGGTCAAGAAGCCCACAACCAAGCCCACTGTCACTCAGCCGG
CAACCACTCAGCCAGGCACCACTGTCACTCAGCCTGGAACCACTGAACCAGGCACCACTGTCACTCAGCCCGGAA
CCACTGTCACTCAGCCAGGCACCACTGTCTCAGAGCCCGGCACTACTGTCACTCAGCCAGGCACCACTGTCTCGC
AGCCAGGCACCACTGTCACTCAGCCCGGAACGACGGTATCGCAGCCCGGCACCACAGACACCGTCACTCAACCCG
GCACTACCGTCTCCCAGCCCGGCACCACAGACACCGTCACTCAGCCCGGCACTACCGTCTCCCAGCCTGGCACTA
CCGTCTCCCAGCCCGGCACCACAGACACCGTCACTCAGCCCGGCACCACTGTTTCGCAGCCTGGCACGACGGTCT
CTCAGCCCGGCACCACAGACACCGTCACTCAGCCTGGCACGACGGATACCGTTACTCAACCTGGCACTACTGGCA
CCATCACTCAGCCCGGAACTACTGTCACCACTTGCATCATCACGTCGGCTACCACGATCCCAAGCTGTGGTCCCC
AGATCCCCGAGTGCTCTGGTGTCCCCACTGGCAGCTCTACTGTCGTTACCAAGACGGTGCCTGCTTCTGGAACCG
ACTGCTCAGTCACTCAGCCACCTGACCAGACCTCGCCGCCAGGTGTCACTCAGACTACTTGTGTCATCACGTCGG
CTACAACGATCCCAAGCTGCGGTCCTCAGATCCCCGAGTGCTCTGGTGTCCCCACTGGCAGCTCTACTGTGATTA
CCAAGACGGTGCCTGCTTCTGGAACCGACTGCTCAGTCACTCAGCCACCTGACCAGACCTCGCCTCCAGGTGTCA
CTCAGACTACTTGTGTCATCACATCGGCTACCACAATCCCAAGCTGCGGTCCTCAGATCCCCGAGTGCTCTGGTG
TCCCCACTGGCAGCTCTACTGTCGTTACCAAGACGGTGCCAGCTAGCGGAACCGATTGCGAGAATGTTCCTACGC
CGACTCCTGGCCAGCCCGGTACCCCTGGCACTCCTGGCACTCCTGGCACTCCTGGCCAGCCCGGCACTCCTGGTC
AGCCCGGCACTCCTGGTCAACCTGGCGAGCCCGGCACTCCTGGTCAGCCCGGCACTCCTGGCCAGCCCGGAAACC
CTGGCACTCCTGGCCAGCCCGGCACTCCTGGTCAACCCGGCACTCCTGGTCAACCCGGCACTCCTGGGCAGCCCG
GCACTCCTGGTCAGCCCGGCACTCCTGGTCAGCCCGGCACTCCTGGCCAGCCTGGCGAGCCTGGACAGCCCGGTA
CTCCCGGTACTCCTGGCCAACCCGGCACTCCTGGTCAGCCTGGTGAGCCTGGCAAGCCCGGTACTCCTGGCCAAC
CTGGTACTCCTGGCACGCCTGGCCAGCCCGGCGAGCCTGGTCAGCCCGGCACTCCTGGTCAGCCTGGCACTCCTG
GTCAGCCTGGCACTCCTGGCCAGCCTGGCGAGCCTGGACAGCCCGGTACTCCTGGCACTCCTGGCCAGCNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNCCTGGCCAGCCTGGTACGCCTGGTCAACCTGGCGAGCCTGGCAAGCCCGGT
ACTCCTGGCCAACCTGGCACGCCTGGTACGCCTGGTCAACCTGGCGAGCCTGGCCAGCCCGGCACTCCTGGCACT
CCCGGTACGCCTGGTCAACCCGGCGAGCCTGGTCAGCCCGGCCAGCCCGGTACCCCTGGCACCCCCGGTCAGCCC
GGCACTCCTGGCACTCCTGGTCAACCCGGCGAGCCTGGCAAGCCCGGTACTCCTGGCCAGCCTGGCACTCCTGGC
CAGCCCGGCACTCCTGGCCAACCCGGCACTCCTGGTCAGCCTGGTGAGCCTGGCAAGCCCGGTACTCCTGGCCAA
CCAGGCACTCCTGGCACGCCTGGCCAGCCCGGCGAGCCTGGTCAGCCTGGTCAACCCGGTACTCCTGGTCAGCCC
GGTACTCCCGGCACTCCTGGCCAGCCTGGTGAGCCTGGCAAGCCCGGTACTCCTGGTCAGCCCGGTACTCCCGGC
ACTCCTGGCCAGCCTGGTGAGCCTGGCACTCCCGGTACTCCTGGCCAACCTGGCACGCCTGGCACGCCTGGCCAA
CCCGGCGAGCCTGGCAAGCCCGGTACTCCTGGCCAGCCCGGTACTCCTGGCACTCCCGGTACGCCTGGTCAACCC
GGCGAGCCCGGCCAGCCCGGCCAGCCCGGCACCCCTGGTCAGCCTGGCGAGCCCGGTACTCCTGGCACTCCCGGT
ACTCCTGGTCAGCCTGGCGAGCCTGGCAAGCCCGGTACTCCTGGCACTCCCGGTACGCCTGGTCAACCCGGTACG
CCTGGTCAGCCCGGCGAGCCCGGCAAGCCCGGTACTCCTGGCACTCCTGGCCAGCCTGGCGAGCCTGGCAAGCCG
GGTACGCCTGGACAGCCCGGCACTCCTGGCACTCCTGGCCAGCCTGGTGAGCCTGGCACTCCTGGCACTCCCGGT
ACACCTGGCCAACCCGGTGAGCCTGGCACTCCTGGCCAGCCCGGTACGCCTGGCACTCCCGGTACTCCTGGAGAA
CCCGGAAAGCCTGGCGAGCCTGGCACTCCCGGCACTCCTGGCCAGCCTGGCACCCCTGGCACTCCCGGTACTCCT
GGAGAACCCGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail