Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7440
Gene name
LocationContig_8:129276..130590
Strand+
Gene length (bp)1314
Transcript length (bp)990
Coding sequence length (bp)990
Protein length (aa) 330

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 5.3E-16 118 237
PF10340 Say1_Mug180 Steryl acetyl hydrolase 2.8E-06 117 208

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P24484|LIP2_MORS1 Lipase 2 OS=Moraxella sp. (strain TA144) GN=lip2 PE=1 SV=1 111 214 6.0E-08

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 17 39 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7440
MTDAAKIGLSVGETGSLVFTLLFVAPARLLAYWVTYTWFALRHRLKLRFYLTCAVARVLLTSFSGRQIQALLPST
RQTYEAWMRNQGLEARVEPLAVEAAPESALLWIGDKQRATTAVLFFHGGGYVVPASRGHLELCWRAFVQPSQGRV
AVGLLQYSLSPGAKFPVQLRQAAAGLGALLDAGFSPRNIVFGGDSAGGNMALQLMSHLLHPVDAAARRFSLAEPL
AGVFLVSPANDMLSASMVSRLGLEHFGPHTENLAAIGPFTPQWFQDLHHMLAKLDPALDVRVDLPDDEAHDFILV
EGINRTTGPATRRMSDWLSSLRTLAAARP*
Coding >OphauB2|7440
ATGACCGACGCAGCCAAGATAGGCCTCTCGGTGGGCGAGACGGGCAGTCTCGTCTTTACGCTCTTGTTTGTCGCT
CCGGCCAGACTGCTGGCTTACTGGGTCACCTACACTTGGTTTGCGCTGCGGCACCGACTCAAGCTCCGCTTCTAC
CTGACGTGCGCCGTGGCCCGCGTCTTGCTCACCAGCTTTTCCGGGCGGCAGATCCAGGCGCTGCTCCCGTCGACC
CGCCAGACGTACGAGGCGTGGATGCGCAATCAGGGCCTCGAGGCGCGAGTGGAGCCGCTGGCCGTCGAGGCAGCC
CCCGAGTCGGCGCTGCTGTGGATAGGCGACAAGCAGCGCGCCACAACGGCCGTGCTCTTCTTCCACGGCGGCGGC
TACGTCGTGCCGGCCAGCCGCGGCCACCTGGAGCTCTGCTGGCGCGCCTTTGTCCAGCCCAGCCAGGGCCGCGTG
GCCGTTGGGCTGCTGCAGTACTCGCTCAGCCCCGGCGCCAAGTTTCCCGTCCAGCTGCGCCAGGCCGCCGCCGGG
CTGGGCGCCCTGCTGGATGCCGGCTTCTCGCCCCGCAACATTGTCTTTGGCGGCGACTCGGCCGGCGGCAACATG
GCCTTGCAGCTCATGAGCCACTTGCTGCATCCCGTCGACGCCGCTGCCCGCCGCTTCAGCCTGGCCGAGCCGCTG
GCCGGCGTCTTCCTCGTCTCGCCGGCCAACGACATGCTCTCCGCCTCCATGGTCTCCCGTCTGGGCCTCGAGCAC
TTTGGCCCGCACACTGAAAATCTCGCCGCCATTGGCCCTTTTACCCCGCAGTGGTTCCAGGACCTGCATCACATG
CTGGCAAAGCTCGACCCTGCCCTTGACGTCAGAGTTGACTTGCCTGACGACGAGGCCCATGACTTTATCCTCGTT
GAAGGCATCAACCGCACAACTGGGCCCGCCACTAGGCGCATGTCCGACTGGCTGTCCAGTCTCCGTACTCTTGCT
GCGGCTCGGCCGTAA
Transcript >OphauB2|7440
ATGACCGACGCAGCCAAGATAGGCCTCTCGGTGGGCGAGACGGGCAGTCTCGTCTTTACGCTCTTGTTTGTCGCT
CCGGCCAGACTGCTGGCTTACTGGGTCACCTACACTTGGTTTGCGCTGCGGCACCGACTCAAGCTCCGCTTCTAC
CTGACGTGCGCCGTGGCCCGCGTCTTGCTCACCAGCTTTTCCGGGCGGCAGATCCAGGCGCTGCTCCCGTCGACC
CGCCAGACGTACGAGGCGTGGATGCGCAATCAGGGCCTCGAGGCGCGAGTGGAGCCGCTGGCCGTCGAGGCAGCC
CCCGAGTCGGCGCTGCTGTGGATAGGCGACAAGCAGCGCGCCACAACGGCCGTGCTCTTCTTCCACGGCGGCGGC
TACGTCGTGCCGGCCAGCCGCGGCCACCTGGAGCTCTGCTGGCGCGCCTTTGTCCAGCCCAGCCAGGGCCGCGTG
GCCGTTGGGCTGCTGCAGTACTCGCTCAGCCCCGGCGCCAAGTTTCCCGTCCAGCTGCGCCAGGCCGCCGCCGGG
CTGGGCGCCCTGCTGGATGCCGGCTTCTCGCCCCGCAACATTGTCTTTGGCGGCGACTCGGCCGGCGGCAACATG
GCCTTGCAGCTCATGAGCCACTTGCTGCATCCCGTCGACGCCGCTGCCCGCCGCTTCAGCCTGGCCGAGCCGCTG
GCCGGCGTCTTCCTCGTCTCGCCGGCCAACGACATGCTCTCCGCCTCCATGGTCTCCCGTCTGGGCCTCGAGCAC
TTTGGCCCGCACACTGAAAATCTCGCCGCCATTGGCCCTTTTACCCCGCAGTGGTTCCAGGACCTGCATCACATG
CTGGCAAAGCTCGACCCTGCCCTTGACGTCAGAGTTGACTTGCCTGACGACGAGGCCCATGACTTTATCCTCGTT
GAAGGCATCAACCGCACAACTGGGCCCGCCACTAGGCGCATGTCCGACTGGCTGTCCAGTCTCCGTACTCTTGCT
GCGGCTCGGCCGTAA
Gene >OphauB2|7440
ATGGTATGCCTCCCACCCGGCCTTGGGGGGTTTCTCTCTCTCCTCTTTGGGCCTTGGAGCTTTGGGCCTTGGGGC
TTTTCTCTCTCCCCTCTTTGGGCCTTGGGGCCTCTTCAATGGCAGAGACTGGCAGGCTGACATGGCAGCCGCTGG
CTAGACCGACGCAGCCAAGATAGGCCTCTCGGTGGGCGAGACGGGCAGTCTCGTCTTTACGCTCTTGTTTGTCGG
TACGCACACGGGCATGGCTATTCGCAGAGGGCAAACAACTGACGCGGCAAAACAGCTCCGGCCAGACTGCTGGCT
TACTGGGTCACCTACACTTGGTTTGCGCTGCGGCACCGACTCAAGCTCCGCTTCTACCTGACGTGCGCCGTGGCC
CGCGTCTTGCTCACCAGCTTTTCCGGGCGGCAGATCCAGGCGCTGCTCCCGTCGACCCGCCAGACGTACGAGGCG
TGGATGCGCAATCAGGGCCTCGAGGCGCGAGTGGAGCCGCTGGCCGTCGAGGCAGCCCCCGAGTCGGCGCTGCTG
TGGATAGGCGACAAGCAGCGCGCCACAACGGCCGTGCTCTTCTTCCACGGCGGCGGCTACGTCGTGCCGGCCAGC
CGCGGCCACCTGGAGCTCTGCTGGCGCGCCTTTGTCCAGCCCAGCCAGGGCCGCGTGGCCGTTGGGCTGCTGCAG
TACTCGCTCAGCCCCGGCGCCAAGTTTCCCGTCCAGCTGCGCCAGGCCGCCGCCGGGCTGGGCGCCCTGCTGGAT
GCCGGCTTCTCGCCCCGCAACATTGTCTTTGGCGGCGACTCGGCCGGCGGCAACATGGCCTTGCAGCTCATGAGC
CACTTGCTGCATCCCGTCGACGCCGCTGCCCGCCGCTTCAGCCTGGCCGAGCCGCTGGCCGGCGTCTTCCTCGTC
TCGCCGTGGGTCGCCCGCAGCACCCAGTCGTGGTCCTATGTCCAAAACAGGGCCAACGACATGCTCTCCGCCTCC
ATGGTCTCCCGTCTGGGCCTCGAGCACTTTGGCCCGCACACTGAAAATCTCGCCGCCATTGGCCCTTTTACCCCG
CAGTGGTTCCAGGACCTGCATCACGTGACCACCCGCCTCTACCTGAGCGGCGGCAGGCGAGAAGTATTTGCCGCC
CACTTGCTTGATCTGGCCCAGATGCTGGCAAAGCTCGACCCTGCCCTTGACGTCAGAGTTGACTTGCCTGACGAC
GAGGCCCATGACTTTATCCTCGTTGAAGGCATCAACCGCACAACTGGGCCCGCCACTAGGCGCATGTCCGACTGG
CTGTCCAGTCTCCGTACTCTTGCTGCGGCTCGGCCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail