Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7436
Gene name
LocationContig_8:119652..122627
Strand-
Gene length (bp)2975
Transcript length (bp)2754
Coding sequence length (bp)2754
Protein length (aa) 918

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01602 Adaptin_N Adaptin N terminal region 6.0E-115 22 555
PF08752 COP-gamma_platf Coatomer gamma subunit appendage platform subdomain 1.6E-56 651 799
PF16381 Coatomer_g_Cpla Coatomer subunit gamma-1 C-terminal appendage platform 5.7E-34 802 916
PF13646 HEAT_2 HEAT repeats 4.5E-12 453 552

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9QZE5|COPG1_MOUSE Coatomer subunit gamma-1 OS=Mus musculus GN=Copg1 PE=1 SV=1 3 917 0.0E+00
sp|D4ABY2|COPG2_RAT Coatomer subunit gamma-2 OS=Rattus norvegicus GN=Copg2 PE=3 SV=2 3 752 0.0E+00
sp|Q7PVF6|COPG_ANOGA Coatomer subunit gamma OS=Anopheles gambiae GN=gammaCop PE=3 SV=2 17 917 0.0E+00
sp|P32074|COPG_YEAST Coatomer subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC21 PE=1 SV=2 18 916 0.0E+00
sp|Q29AE5|COPG_DROPS Coatomer subunit gamma OS=Drosophila pseudoobscura pseudoobscura GN=gammaCop PE=3 SV=1 2 917 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9QZE5|COPG1_MOUSE Coatomer subunit gamma-1 OS=Mus musculus GN=Copg1 PE=1 SV=1 3 917 0.0E+00
sp|D4ABY2|COPG2_RAT Coatomer subunit gamma-2 OS=Rattus norvegicus GN=Copg2 PE=3 SV=2 3 752 0.0E+00
sp|Q7PVF6|COPG_ANOGA Coatomer subunit gamma OS=Anopheles gambiae GN=gammaCop PE=3 SV=2 17 917 0.0E+00
sp|P32074|COPG_YEAST Coatomer subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC21 PE=1 SV=2 18 916 0.0E+00
sp|Q29AE5|COPG_DROPS Coatomer subunit gamma OS=Drosophila pseudoobscura pseudoobscura GN=gammaCop PE=3 SV=1 2 917 0.0E+00
sp|Q22498|COPG_CAEEL Probable coatomer subunit gamma OS=Caenorhabditis elegans GN=T14G10.5 PE=3 SV=1 1 916 0.0E+00
sp|Q8I0G5|COPG_DROME Coatomer subunit gamma OS=Drosophila melanogaster GN=gammaCOP PE=2 SV=1 16 917 0.0E+00
sp|Q54HL0|COPG_DICDI Coatomer subunit gamma OS=Dictyostelium discoideum GN=copG PE=1 SV=1 5 915 0.0E+00
sp|Q9Y678|COPG1_HUMAN Coatomer subunit gamma-1 OS=Homo sapiens GN=COPG1 PE=1 SV=1 3 917 0.0E+00
sp|Q4AEF8|COPG1_RAT Coatomer subunit gamma-1 OS=Rattus norvegicus GN=Copg1 PE=2 SV=1 3 917 0.0E+00
sp|P53620|COPG1_BOVIN Coatomer subunit gamma-1 OS=Bos taurus GN=COPG1 PE=1 SV=1 3 917 0.0E+00
sp|P87140|COPG_SCHPO Probable coatomer subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec21 PE=1 SV=1 1 917 0.0E+00
sp|Q6DKD7|COPG2_XENLA Coatomer subunit gamma-2 OS=Xenopus laevis GN=copg2 PE=2 SV=1 3 917 0.0E+00
sp|Q8H852|COPG1_ORYSJ Coatomer subunit gamma-1 OS=Oryza sativa subsp. japonica GN=Os03g0227000 PE=2 SV=2 17 917 0.0E+00
sp|A2VE21|COPG2_BOVIN Coatomer subunit gamma-2 OS=Bos taurus GN=COPG2 PE=2 SV=1 3 917 0.0E+00
sp|Q66JI9|COPG2_XENTR Coatomer subunit gamma-2 OS=Xenopus tropicalis GN=copg2 PE=2 SV=1 3 917 0.0E+00
sp|Q9UBF2|COPG2_HUMAN Coatomer subunit gamma-2 OS=Homo sapiens GN=COPG2 PE=1 SV=1 3 917 0.0E+00
sp|Q9QXK3|COPG2_MOUSE Coatomer subunit gamma-2 OS=Mus musculus GN=Copg2 PE=1 SV=1 3 917 0.0E+00
sp|Q9PUE4|COPG2_DANRE Coatomer subunit gamma-2 OS=Danio rerio GN=copg2 PE=2 SV=2 3 917 0.0E+00
sp|Q9I8E6|COPG2_TAKRU Coatomer subunit gamma-2 OS=Takifugu rubripes GN=copg2 PE=3 SV=1 3 917 0.0E+00
sp|Q6Z382|COPG2_ORYSJ Coatomer subunit gamma-2 OS=Oryza sativa subsp. japonica GN=Os07g0201100 PE=2 SV=1 5 917 0.0E+00
sp|Q0WW26|COPG_ARATH Coatomer subunit gamma OS=Arabidopsis thaliana GN=At4g34450 PE=1 SV=2 5 917 0.0E+00
[Show less]

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0030126 COPI vesicle coat Yes
GO:0030117 membrane coat Yes
GO:0005198 structural molecule activity Yes
GO:0016192 vesicle-mediated transport Yes
GO:0051641 cellular localization No
GO:0046907 intracellular transport No
GO:0070727 cellular macromolecule localization No
GO:0005575 cellular_component No
GO:0045184 establishment of protein localization No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0071702 organic substance transport No
GO:0003674 molecular_function No
GO:0015031 protein transport No
GO:0033036 macromolecule localization No
GO:0030120 vesicle coat No
GO:0051179 localization No
GO:0006810 transport No
GO:0071705 nitrogen compound transport No
GO:0009987 cellular process No
GO:0032991 protein-containing complex No
GO:0098796 membrane protein complex No
GO:0051234 establishment of localization No
GO:0008104 protein localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7436
MSYGKKDEDADLGLVKVDRTQVFQEARLFNSSPIQPRRCRILLTKIALLLYSGERFPTNEATTLFFGISKLFQNK
DASLRQMVHLVIKELASSAEDIIMVTSTIMKDTGGSSDAIYRPNAIRALCRIIDATTVQSIERVMKTAIVDKNPS
VSSAALVSSYHLLPIAKDVVRRWQSETQEAAASTKSSGGFSLGFSSSSGQMPLNNSTMTQYHAVGLLYQMRMHDR
MALVKMVQQFGAAGAVKSPAATVMLVRLAAHLAEEDASLRKPMMQLLDGWLRHKSEMVNFEAAKAICDLRDVTDN
EVAQAVQVLQLFLTSPRAVTKFAALRILHNFASFKPNTVAACNPDIELLISNSNRSIATFAITTLLKTGNEASVD
RLMKQIAGFMSEITDEFKITIIEAIRTLCLKFPNKQAGMLTFLSGILRDEGGYEFKRAVVESMFDLIKFVPDSKE
EALAHLCEFIEDCEFTKLAVRILHLIGLEGPKTSQPTKYIRYIYNRVVLENAIVRAAAVTALSKFGVGQQDPDVK
ASVKVLLTRCLDDVDDEVRDRAALSLKLMGEEDDTARNFVKNENMFSLPVFEHQLVMYVTSDDKSTFDEPFDVGK
IPVVTREQADAEDRTKKLTATAPTLKTPKVGPSKTPTSGAEAAASASAQAQRYAEELMQIPEINEFGSVLKSSPL
VELTEAETEYVVGVIKHIFKEHIVLQYEVKNTLPDTILENVSVVATPSDEEELEEVFIIQAEELPTEKPGKVYVA
FRKVGGPGSTPVATFSNILKFTTKEIDPSTGEPEENGYDDEYEVSEFDINGSDYLVPTFASNFNHLWEQIGASGE
EAEETLQLGGLKSIADATEQLAKALSLQPLEGTDVPVNQSTHTLKLLGKTVGGGRVIANVRLAYSAKTGVTTKIT
VRSEGEGVASMVIASVA*
Coding >OphauB2|7436
ATGAGCTACGGCAAAAAAGACGAGGACGCCGACCTGGGCTTGGTCAAAGTGGATCGCACACAAGTCTTTCAAGAA
GCACGATTGTTCAACAGCTCCCCCATTCAACCGCGACGATGCCGCATACTTCTCACCAAGATTGCCCTCCTGCTC
TACAGCGGCGAAAGGTTTCCCACAAACGAGGCTACCACACTCTTCTTTGGCATCTCCAAGCTCTTCCAAAACAAA
GATGCCAGCCTCAGACAAATGGTCCATCTTGTTATCAAGGAGTTGGCCAGCTCGGCAGAGGACATCATCATGGTT
ACCAGCACCATCATGAAGGATACTGGAGGTAGCAGCGACGCCATATACCGGCCAAATGCCATCCGAGCACTGTGC
CGCATCATTGATGCCACCACGGTTCAATCCATTGAGCGAGTAATGAAGACTGCCATTGTGGATAAGAACCCCTCG
GTGTCTTCGGCAGCCCTTGTTTCCTCATATCATCTCCTTCCAATTGCCAAAGACGTGGTGCGCCGGTGGCAGAGC
GAGACACAAGAGGCCGCCGCCTCGACGAAATCATCAGGCGGATTTTCCCTCGGCTTCTCCTCCTCGAGCGGTCAG
ATGCCCCTCAATAACTCTACAATGACCCAGTACCATGCCGTCGGTTTGCTCTACCAGATGCGCATGCACGATCGC
ATGGCATTGGTCAAGATGGTGCAGCAATTTGGCGCCGCTGGAGCCGTCAAGAGCCCGGCCGCAACCGTCATGCTC
GTACGCCTCGCCGCCCACTTGGCTGAAGAGGATGCATCCCTTCGTAAGCCCATGATGCAGCTACTCGATGGATGG
CTACGGCACAAGAGCGAAATGGTCAATTTCGAGGCTGCCAAAGCCATTTGCGATTTGAGAGATGTCACAGACAAT
GAAGTCGCTCAAGCAGTTCAAGTTCTTCAGCTCTTCCTGACCTCTCCAAGAGCCGTCACAAAGTTTGCCGCATTG
CGTATTCTTCATAATTTTGCCTCATTCAAACCTAATACCGTTGCCGCCTGCAATCCCGACATTGAGCTTCTCATC
TCCAATAGCAATCGTTCCATTGCCACCTTTGCAATTACCACGCTTCTCAAGACGGGCAACGAAGCCAGCGTTGAC
CGACTGATGAAGCAAATTGCAGGCTTCATGTCAGAAATCACTGACGAATTCAAAATTACAATCATTGAGGCTATT
CGCACCTTGTGCCTCAAGTTCCCCAACAAACAAGCTGGCATGCTCACCTTTCTCAGCGGTATTCTACGAGACGAA
GGAGGCTACGAATTCAAGAGAGCTGTCGTGGAGAGCATGTTCGATCTTATCAAGTTTGTTCCAGATTCCAAGGAA
GAAGCTTTGGCCCATCTCTGCGAATTCATTGAAGATTGCGAGTTTACAAAACTGGCCGTACGTATTCTTCACCTT
ATAGGCCTCGAAGGTCCCAAGACGAGTCAGCCGACCAAGTATATCCGCTACATCTATAATCGTGTCGTTCTTGAA
AATGCCATTGTGCGGGCCGCCGCCGTCACCGCCCTATCCAAATTCGGCGTTGGCCAGCAAGATCCGGATGTCAAG
GCCAGTGTCAAGGTTTTGCTCACGCGATGCTTGGATGACGTGGATGACGAGGTCCGCGACCGTGCTGCTTTGAGC
TTGAAACTCATGGGTGAAGAGGACGACACGGCTCGCAATTTCGTCAAGAATGAAAACATGTTTTCTCTCCCTGTC
TTTGAGCATCAATTGGTCATGTACGTTACCTCGGATGACAAGTCGACCTTTGATGAACCATTCGATGTTGGCAAG
ATACCCGTTGTCACCCGTGAACAGGCCGATGCCGAAGACAGGACTAAGAAGCTCACGGCAACGGCACCAACCCTC
AAGACACCCAAAGTAGGCCCAAGCAAGACGCCTACAAGCGGTGCAGAGGCTGCAGCTTCTGCCTCTGCTCAGGCA
CAGCGCTATGCCGAAGAGTTGATGCAAATTCCGGAAATCAACGAATTCGGCAGTGTATTAAAGTCATCACCACTG
GTGGAACTTACGGAAGCCGAGACGGAGTATGTGGTTGGTGTCATTAAACACATCTTCAAGGAGCATATTGTTTTA
CAGTATGAAGTCAAGAATACTCTCCCTGATACCATTTTGGAAAATGTGTCAGTGGTGGCTACTCCATCCGACGAA
GAGGAACTCGAAGAGGTCTTCATCATTCAGGCTGAAGAATTGCCGACAGAGAAGCCAGGAAAGGTTTATGTGGCG
TTCAGAAAAGTTGGCGGACCAGGTTCAACACCCGTCGCCACATTTTCAAATATACTCAAATTCACCACCAAGGAA
ATCGATCCGTCAACTGGCGAGCCCGAAGAGAATGGCTACGACGATGAATACGAAGTTTCAGAGTTTGATATTAAT
GGGAGCGATTATCTCGTACCTACCTTTGCCAGCAATTTTAATCACTTGTGGGAGCAGATTGGGGCGTCTGGAGAA
GAGGCAGAGGAAACGCTACAGCTGGGCGGATTGAAGAGTATCGCAGATGCAACAGAGCAACTAGCAAAGGCGCTG
TCTCTGCAGCCATTAGAGGGTACCGATGTACCGGTAAATCAGAGCACACACACACTCAAGCTGCTGGGCAAGACG
GTTGGCGGAGGCAGAGTCATTGCCAACGTGAGGTTGGCGTATTCGGCAAAGACGGGTGTGACGACCAAGATTACA
GTCAGGAGCGAGGGAGAGGGCGTTGCGTCAATGGTGATTGCGTCTGTGGCGTAG
Transcript >OphauB2|7436
ATGAGCTACGGCAAAAAAGACGAGGACGCCGACCTGGGCTTGGTCAAAGTGGATCGCACACAAGTCTTTCAAGAA
GCACGATTGTTCAACAGCTCCCCCATTCAACCGCGACGATGCCGCATACTTCTCACCAAGATTGCCCTCCTGCTC
TACAGCGGCGAAAGGTTTCCCACAAACGAGGCTACCACACTCTTCTTTGGCATCTCCAAGCTCTTCCAAAACAAA
GATGCCAGCCTCAGACAAATGGTCCATCTTGTTATCAAGGAGTTGGCCAGCTCGGCAGAGGACATCATCATGGTT
ACCAGCACCATCATGAAGGATACTGGAGGTAGCAGCGACGCCATATACCGGCCAAATGCCATCCGAGCACTGTGC
CGCATCATTGATGCCACCACGGTTCAATCCATTGAGCGAGTAATGAAGACTGCCATTGTGGATAAGAACCCCTCG
GTGTCTTCGGCAGCCCTTGTTTCCTCATATCATCTCCTTCCAATTGCCAAAGACGTGGTGCGCCGGTGGCAGAGC
GAGACACAAGAGGCCGCCGCCTCGACGAAATCATCAGGCGGATTTTCCCTCGGCTTCTCCTCCTCGAGCGGTCAG
ATGCCCCTCAATAACTCTACAATGACCCAGTACCATGCCGTCGGTTTGCTCTACCAGATGCGCATGCACGATCGC
ATGGCATTGGTCAAGATGGTGCAGCAATTTGGCGCCGCTGGAGCCGTCAAGAGCCCGGCCGCAACCGTCATGCTC
GTACGCCTCGCCGCCCACTTGGCTGAAGAGGATGCATCCCTTCGTAAGCCCATGATGCAGCTACTCGATGGATGG
CTACGGCACAAGAGCGAAATGGTCAATTTCGAGGCTGCCAAAGCCATTTGCGATTTGAGAGATGTCACAGACAAT
GAAGTCGCTCAAGCAGTTCAAGTTCTTCAGCTCTTCCTGACCTCTCCAAGAGCCGTCACAAAGTTTGCCGCATTG
CGTATTCTTCATAATTTTGCCTCATTCAAACCTAATACCGTTGCCGCCTGCAATCCCGACATTGAGCTTCTCATC
TCCAATAGCAATCGTTCCATTGCCACCTTTGCAATTACCACGCTTCTCAAGACGGGCAACGAAGCCAGCGTTGAC
CGACTGATGAAGCAAATTGCAGGCTTCATGTCAGAAATCACTGACGAATTCAAAATTACAATCATTGAGGCTATT
CGCACCTTGTGCCTCAAGTTCCCCAACAAACAAGCTGGCATGCTCACCTTTCTCAGCGGTATTCTACGAGACGAA
GGAGGCTACGAATTCAAGAGAGCTGTCGTGGAGAGCATGTTCGATCTTATCAAGTTTGTTCCAGATTCCAAGGAA
GAAGCTTTGGCCCATCTCTGCGAATTCATTGAAGATTGCGAGTTTACAAAACTGGCCGTACGTATTCTTCACCTT
ATAGGCCTCGAAGGTCCCAAGACGAGTCAGCCGACCAAGTATATCCGCTACATCTATAATCGTGTCGTTCTTGAA
AATGCCATTGTGCGGGCCGCCGCCGTCACCGCCCTATCCAAATTCGGCGTTGGCCAGCAAGATCCGGATGTCAAG
GCCAGTGTCAAGGTTTTGCTCACGCGATGCTTGGATGACGTGGATGACGAGGTCCGCGACCGTGCTGCTTTGAGC
TTGAAACTCATGGGTGAAGAGGACGACACGGCTCGCAATTTCGTCAAGAATGAAAACATGTTTTCTCTCCCTGTC
TTTGAGCATCAATTGGTCATGTACGTTACCTCGGATGACAAGTCGACCTTTGATGAACCATTCGATGTTGGCAAG
ATACCCGTTGTCACCCGTGAACAGGCCGATGCCGAAGACAGGACTAAGAAGCTCACGGCAACGGCACCAACCCTC
AAGACACCCAAAGTAGGCCCAAGCAAGACGCCTACAAGCGGTGCAGAGGCTGCAGCTTCTGCCTCTGCTCAGGCA
CAGCGCTATGCCGAAGAGTTGATGCAAATTCCGGAAATCAACGAATTCGGCAGTGTATTAAAGTCATCACCACTG
GTGGAACTTACGGAAGCCGAGACGGAGTATGTGGTTGGTGTCATTAAACACATCTTCAAGGAGCATATTGTTTTA
CAGTATGAAGTCAAGAATACTCTCCCTGATACCATTTTGGAAAATGTGTCAGTGGTGGCTACTCCATCCGACGAA
GAGGAACTCGAAGAGGTCTTCATCATTCAGGCTGAAGAATTGCCGACAGAGAAGCCAGGAAAGGTTTATGTGGCG
TTCAGAAAAGTTGGCGGACCAGGTTCAACACCCGTCGCCACATTTTCAAATATACTCAAATTCACCACCAAGGAA
ATCGATCCGTCAACTGGCGAGCCCGAAGAGAATGGCTACGACGATGAATACGAAGTTTCAGAGTTTGATATTAAT
GGGAGCGATTATCTCGTACCTACCTTTGCCAGCAATTTTAATCACTTGTGGGAGCAGATTGGGGCGTCTGGAGAA
GAGGCAGAGGAAACGCTACAGCTGGGCGGATTGAAGAGTATCGCAGATGCAACAGAGCAACTAGCAAAGGCGCTG
TCTCTGCAGCCATTAGAGGGTACCGATGTACCGGTAAATCAGAGCACACACACACTCAAGCTGCTGGGCAAGACG
GTTGGCGGAGGCAGAGTCATTGCCAACGTGAGGTTGGCGTATTCGGCAAAGACGGGTGTGACGACCAAGATTACA
GTCAGGAGCGAGGGAGAGGGCGTTGCGTCAATGGTGATTGCGTCTGTGGCGTAG
Gene >OphauB2|7436
ATGAGCTACGGCAAAAAAGACGAGGACGCCGACCTGGGCTTGGTCAAAGTGGATCGCACACAAGTCTTTCAAGAA
GGTGAGCCGTCTTGCATCAAACGCCACCTGACTGCCCATTGACTTGGCCAACAGCACGATTGTTCAACAGCTCCC
CCATTCAACCGCGACGATGCCGCATACTTCTCACCAAGATTGCCCTCCTGCTCTACAGCGGCGAAAGGTTTCCCA
CAAACGAGGCTACCACACTCTTCTTTGGCATCTCCAAGCTCTTCCAAAACAAAGATGCCAGCCTCAGACAAATGG
TCCATCTTGTTATCAAGGAGTTGGCCAGCTCGGCAGAGGACATCATCATGGTTACCAGCACCATCATGAAGGATA
CTGGAGGTAGCAGCGACGCCATATACCGGCCAAATGCCATCCGAGCACTGTGCCGCATCATTGATGTAATCTCAA
ATCCGCCCCTCTTGCTCCAGCTCTTCTGACAGTACCACAGGCCACCACGGTTCAATCCATTGAGCGAGTAATGAA
GACTGCCATTGTGGATAAGAACCCCTCGGTGTCTTCGGCAGCCCTTGTTTCCTCATATCATCTCCTTCCAATTGC
CAAAGACGTGGTGCGCCGGTGGCAGAGCGAGACACAAGAGGCCGCCGCCTCGACGAAATCATCAGGCGGATTTTC
CCTCGGCTTCTCCTCCTCGAGCGGTCAGATGCCCCTCAATAACTCTACAATGACCCAGTACCATGCCGTCGGTTT
GCTCTACCAGATGCGCATGCACGATCGCATGGCATTGGTCAAGATGGTGCAGCAATTTGGCGCCGCTGGAGCCGT
CAAGAGCCCGGCCGCAACCGTCATGCTCGTACGCCTCGCCGCCCACTTGGCTGAAGAGGATGCATCCCTTCGTAA
GCCCATGATGCAGCTACTCGATGGATGGCTACGGCACAAGAGCGAAATGGTCAATTTCGAGGCTGCCAAAGCCAT
TTGCGATTTGAGAGATGTCACAGACAATGAAGTCGCTCAAGCAGTTCAAGTTCTTCAGCTCTTCCTGACCTCTCC
AAGAGCCGTCACAAAGTTTGCCGCATTGCGTATTCTTCATAATTTTGCCTCATTCAAACCTAATACCGTTGCCGC
CTGCAATCCCGACATTGAGCTTCTCATCTCCAATAGCAATCGTTCCATTGCCACCTTTGCAATTACCACGCTTCT
CAAGACGGGCAACGAAGCCAGCGTTGACCGACTGATGAAGCAAATTGCAGGCTTCATGTCAGAAATCACTGACGA
ATTCAAAATTACAATCATTGAGGCTATTCGCACCTTGTGCCTCAAGTTCCCCAACAAACAAGCTGGCATGCTCAC
CTTTCTCAGCGGTATTCTACGAGACGAAGGAGGCTACGAATTCAAGAGAGCTGTCGTGGAGAGCATGTTCGATCT
TATCAAGTTTGTTCCAGATTCCAAGGAAGAAGCTTTGGCCCATCTCTGCGAATTCATTGAAGATTGCGAGTTTAC
AAAACTGGCCGTACGTATTCTTCACCTTATAGGCCTCGAAGGTCCCAAGACGAGTCAGCCGACCAAGTATATCCG
CTACATCTATAATCGTGTCGTTCTTGAAAATGCCATTGTGCGGGCCGCCGCCGTCACCGCCCTATCCAAATTCGG
CGTTGGCCAGCAAGATCCGGATGTCAAGGCCAGTGTCAAGGTTTTGCTCACGCGATGCTTGGATGACGTGGATGA
CGAGGTCCGCGACCGTGCTGCTTTGAGCTTGAAACTCATGGGTGAAGAGGACGACACGGCTCGCAATTTCGTCAA
GAATGGTTGGTGGCAGCGTTTCCCAGCCAGCCCCCTTGTCGAAAACTGCTAATCATTGGTTTCAGAAAACATGTT
TTCTCTCCCTGTCTTTGAGCATCAATTGGTCATGTACGTTACCTCGGATGACAAGTCGACCTTTGATGAACCATT
CGATGTTGGCAAGATACCCGTTGTCACCCGTGAACAGGCCGATGCCGAAGACAGGACTAAGAAGCTCACGGCAAC
GGCACCAACCCTCAAGACACCCAAAGTAGGCCCAAGCAAGACGCCTACAAGCGGTGCAGAGGCTGCAGCTTCTGC
CTCTGCTCAGGCACAGCGCTATGCCGAAGAGTTGATGCAAATTCCGGAAATCAACGAATTCGGCAGTGTATTAAA
GTCATCACCACTGGTGGAACTTACGGAAGCCGAGACGGAGTATGTGGTTGGTGTCATTAAACACATCTTCAAGGA
GCATATTGTTTTACAGTATGAAGTCAAGAATACTCTCCCTGATACCATTTTGGAAAATGTGTCAGTGGTGGCTAC
TCCATCCGACGAAGAGGAACTCGAAGAGGTCTTCATCATTCAGGCTGAAGAATTGCCGACAGAGAAGCCAGGAAA
GGTTTATGTGGCGTTCAGAAAAGTTGGCGGACCAGGTTCAACACCCGTCGCCACATTTTCAAATATACTCAAATT
CACCACCAAGGAAATCGATCCGTCAACTGGCGAGCCCGAAGAGAATGGCTACGACGATGAATACGAAGTTTCAGA
GTTTGATATTAATGGGAGCGATTATCTCGTACCTACCTTTGCCAGCAATTTTAATCACTTGTGGGAGCAGATTGG
GGCGTCTGGAGAAGAGGCAGAGGAAACGCTACAGCTGGGCGGATTGAAGAGTATCGCAGGTAAGAGACGAGATTA
CAGACTACATCGTGGAAGGGTAGGGGCTCACAGTCATTATAGATGCAACAGAGCAACTAGCAAAGGCGCTGTCTC
TGCAGCCATTAGAGGGTACCGATGTACCGGTAAATCAGAGCACACACACACTCAAGCTGCTGGGCAAGACGGTTG
GCGGAGGCAGAGTCATTGCCAACGTGAGGTTGGCGTATTCGGCAAAGACGGGTGTGACGACCAAGATTACAGTCA
GGAGCGAGGGAGAGGGCGTTGCGTCAATGGTGATTGCGTCTGTGGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail