Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7428
Gene name
LocationContig_8:99529..101414
Strand-
Gene length (bp)1885
Transcript length (bp)1818
Coding sequence length (bp)1818
Protein length (aa) 606

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P8W3|ACE1_HYPJE Zinc finger transcription factor ace1 OS=Hypocrea jecorina GN=ace1 PE=3 SV=1 496 585 4.0E-12
sp|Q2QGD7|ZXDC_HUMAN Zinc finger protein ZXDC OS=Homo sapiens GN=ZXDC PE=1 SV=2 491 581 1.0E-10
sp|Q8C8V1|ZXDC_MOUSE Zinc finger protein ZXDC OS=Mus musculus GN=Zxdc PE=2 SV=1 493 581 3.0E-10
sp|A2CE44|ZXDB_MOUSE Zinc finger X-linked protein ZXDB OS=Mus musculus GN=Zxdb PE=2 SV=1 494 597 4.0E-09
sp|P98168|ZXDA_HUMAN Zinc finger X-linked protein ZXDA OS=Homo sapiens GN=ZXDA PE=1 SV=2 489 597 8.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P8W3|ACE1_HYPJE Zinc finger transcription factor ace1 OS=Hypocrea jecorina GN=ace1 PE=3 SV=1 496 585 4.0E-12
sp|Q2QGD7|ZXDC_HUMAN Zinc finger protein ZXDC OS=Homo sapiens GN=ZXDC PE=1 SV=2 491 581 1.0E-10
sp|Q8C8V1|ZXDC_MOUSE Zinc finger protein ZXDC OS=Mus musculus GN=Zxdc PE=2 SV=1 493 581 3.0E-10
sp|A2CE44|ZXDB_MOUSE Zinc finger X-linked protein ZXDB OS=Mus musculus GN=Zxdb PE=2 SV=1 494 597 4.0E-09
sp|P98168|ZXDA_HUMAN Zinc finger X-linked protein ZXDA OS=Homo sapiens GN=ZXDA PE=1 SV=2 489 597 8.0E-09
sp|P98169|ZXDB_HUMAN Zinc finger X-linked protein ZXDB OS=Homo sapiens GN=ZXDB PE=2 SV=2 489 597 9.0E-09
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 495 581 8.0E-08
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 495 589 1.0E-07
sp|Q17308|TRA1_CAEBR Sex-determining transformer protein 1 OS=Caenorhabditis briggsae GN=tra-1 PE=1 SV=1 496 591 1.0E-07
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 495 581 1.0E-07
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 495 589 1.0E-07
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 495 589 1.0E-07
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 495 589 1.0E-07
sp|P98169|ZXDB_HUMAN Zinc finger X-linked protein ZXDB OS=Homo sapiens GN=ZXDB PE=2 SV=2 494 580 1.0E-07
sp|P98168|ZXDA_HUMAN Zinc finger X-linked protein ZXDA OS=Homo sapiens GN=ZXDA PE=1 SV=2 494 580 1.0E-07
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 495 581 2.0E-07
sp|Q8C8V1|ZXDC_MOUSE Zinc finger protein ZXDC OS=Mus musculus GN=Zxdc PE=2 SV=1 494 597 3.0E-07
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 495 589 4.0E-07
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 495 589 4.0E-07
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 495 589 4.0E-07
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 468 585 5.0E-07
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 468 585 5.0E-07
sp|Q5AMH6|CAS5_CANAL Cell wall integrity transcriptional regulator CAS5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAS5 PE=3 SV=1 520 591 6.0E-07
sp|Q8BMJ8|SP8_MOUSE Transcription factor Sp8 OS=Mus musculus GN=Sp8 PE=2 SV=1 436 581 7.0E-07
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 468 585 1.0E-06
sp|A2CE44|ZXDB_MOUSE Zinc finger X-linked protein ZXDB OS=Mus musculus GN=Zxdb PE=2 SV=1 494 597 1.0E-06
sp|Q2QGD7|ZXDC_HUMAN Zinc finger protein ZXDC OS=Homo sapiens GN=ZXDC PE=1 SV=2 494 597 2.0E-06
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 495 581 2.0E-06
sp|Q0VA40|SP9_XENTR Transcription factor Sp9 OS=Xenopus tropicalis GN=sp9 PE=2 SV=1 484 586 3.0E-06
sp|P0CG40|SP9_HUMAN Transcription factor Sp9 OS=Homo sapiens GN=SP9 PE=3 SV=1 484 586 3.0E-06
sp|Q64HY3|SP9_MOUSE Transcription factor Sp9 OS=Mus musculus GN=Sp9 PE=1 SV=1 484 586 3.0E-06
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 495 593 3.0E-06
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 495 581 3.0E-06
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 495 593 3.0E-06
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 495 593 4.0E-06
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 495 593 4.0E-06
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 495 593 4.0E-06
sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 495 581 4.0E-06
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 495 581 4.0E-06
sp|P34708|TRA1_CAEEL Sex-determining transformer protein 1 OS=Caenorhabditis elegans GN=tra-1 PE=1 SV=1 496 585 5.0E-06
sp|Q8BKX7|ZN410_MOUSE Zinc finger protein 410 OS=Mus musculus GN=Znf410 PE=2 SV=2 491 594 5.0E-06
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 495 581 6.0E-06
sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 489 585 8.0E-06
sp|Q8IXZ3|SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens GN=SP8 PE=2 SV=3 436 581 8.0E-06
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 484 581 9.0E-06
sp|Q86VK4|ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens GN=ZNF410 PE=1 SV=2 491 594 9.0E-06
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 495 589 9.0E-06
sp|Q7TQ40|ZIC5_MOUSE Zinc finger protein ZIC 5 OS=Mus musculus GN=Zic5 PE=1 SV=1 495 585 9.0E-06
sp|P34694|TF3A_ANAAE Transcription factor IIIA OS=Anaxyrus americanus GN=gtf3a PE=2 SV=1 502 595 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 58 80 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7428
MASHCSSSIVAAVAAHDTTSRAAPCSATTTAHGRRWPVQPAFLESHIARRRLSHGATAGTVVAVVVAVALMVFCL
YPVVVYSLKHRRRGHGQHRDAEAPMALPSAHQPANHRRLSSIDSFKQDGDLSRGHGDAASYREASWTGAMADAAY
TAHDDGSRRPGPESASTPAPLPFYYGEYMPVSEVIDNRSGVLQGTSADYYSPSIPSEAFGMMAASPDAHAAYVAS
SGSRSLRYNVRHMFSRKKLGDHQPRGHDSASLGGPEAPCPTALESQGATPLNQVSTSRGLTEPCSYQLPAAAMPT
ASHTGLPANTQLAPNPLTTRSSILSQSQKRTDTGPNKTPLLPPSHPAPGTVNPMDIMPASTHSERRHQAEYQLSA
SSFALAQQGPSSPPPASHAQSPSVMQNADATSHVGASDDKTPLSANHLSPPIDPESSRHPSYPSDQSTPFPGPGS
TNTSAHNTPSTQIDSLSPESIDSSDFRHSTSPQPAPPSLTSGPVFRCKEPGCNQAFGAPHKLKHHTRYHRREHKC
PFPNCEKGFGTRTHLQRHINDRHDKKKKFHCTVQGCEYSKTGGKAFPRKDNWKRHMTKIHNLEQSQLPEPVEVDQ
VMSGT*
Coding >OphauB2|7428
ATGGCTTCGCATTGTTCCAGTAGCATCGTGGCGGCCGTTGCTGCTCATGACACGACGAGTCGGGCGGCGCCATGC
TCGGCCACGACGACTGCTCATGGCCGGCGCTGGCCGGTGCAGCCTGCCTTTCTGGAATCCCATATTGCCAGGCGC
CGCTTGAGCCATGGAGCCACGGCAGGCACCGTTGTTGCTGTCGTTGTGGCTGTCGCCCTCATGGTCTTTTGCCTC
TATCCAGTAGTTGTGTACAGCCTCAAGCATCGCCGCCGTGGCCATGGGCAGCACAGAGATGCCGAGGCGCCCATG
GCGCTCCCATCTGCCCACCAGCCTGCCAATCACCGGCGACTCTCCTCCATCGACTCTTTCAAGCAAGACGGCGAT
TTGTCTCGCGGCCATGGCGACGCCGCCTCTTATCGAGAAGCTTCATGGACTGGAGCCATGGCCGATGCAGCCTAC
ACTGCCCATGACGATGGGTCGCGACGGCCAGGCCCCGAGTCGGCGTCGACGCCCGCCCCTCTGCCCTTTTACTAT
GGCGAATACATGCCCGTCTCCGAAGTCATTGACAATAGATCTGGAGTGCTTCAAGGAACAAGCGCAGACTATTAT
AGCCCTTCAATTCCGTCTGAAGCCTTTGGCATGATGGCTGCCTCCCCAGACGCCCATGCCGCTTATGTAGCCTCG
TCGGGCTCTCGCAGCTTGCGATACAATGTCAGACACATGTTCAGTCGCAAGAAGCTTGGTGACCACCAGCCCCGT
GGCCACGACTCTGCCAGTCTCGGTGGACCTGAGGCACCATGTCCCACGGCCCTTGAATCTCAGGGCGCAACCCCG
CTGAATCAAGTGTCGACCAGCAGAGGTCTCACAGAGCCTTGTTCGTACCAGCTCCCCGCCGCGGCCATGCCGACA
GCGTCGCACACTGGTTTGCCGGCAAACACTCAGCTGGCGCCAAATCCACTCACCACTCGGTCCAGCATCCTGTCT
CAGTCGCAGAAGCGCACCGACACAGGCCCCAACAAGACGCCCTTGCTACCGCCGTCACACCCTGCCCCAGGCACT
GTCAATCCAATGGATATCATGCCCGCAAGTACCCATTCAGAAAGGCGGCATCAGGCTGAATACCAACTATCGGCA
TCGTCGTTTGCCTTGGCACAGCAGGGTCCAAGTTCCCCGCCGCCTGCTTCCCATGCACAGTCTCCCAGTGTCATG
CAAAATGCAGATGCCACGAGCCATGTTGGTGCCTCAGATGACAAAACACCCCTATCAGCCAATCACTTGAGCCCG
CCGATAGACCCAGAGTCAAGTCGACATCCTAGCTATCCGTCTGATCAGTCTACTCCATTCCCGGGGCCAGGATCG
ACAAACACTTCTGCACACAATACTCCATCAACACAGATAGACAGTCTCTCCCCCGAGAGCATAGATAGTTCTGAT
TTCCGCCACAGCACATCCCCTCAGCCGGCTCCTCCATCACTAACATCTGGCCCCGTCTTCCGCTGCAAGGAGCCT
GGTTGCAACCAAGCATTTGGCGCACCACACAAACTCAAACATCATACAAGATATCATCGCAGAGAACACAAGTGT
CCATTTCCAAACTGTGAAAAGGGCTTTGGTACACGCACTCACTTGCAAAGACATATCAATGACCGACATGACAAG
AAGAAGAAGTTTCATTGCACGGTCCAGGGATGCGAGTACTCCAAAACAGGAGGCAAGGCCTTTCCTCGAAAGGAC
AATTGGAAAAGGCACATGACCAAAATACATAATCTGGAACAGTCACAGCTTCCCGAGCCAGTCGAGGTTGACCAG
GTCATGAGCGGCACATGA
Transcript >OphauB2|7428
ATGGCTTCGCATTGTTCCAGTAGCATCGTGGCGGCCGTTGCTGCTCATGACACGACGAGTCGGGCGGCGCCATGC
TCGGCCACGACGACTGCTCATGGCCGGCGCTGGCCGGTGCAGCCTGCCTTTCTGGAATCCCATATTGCCAGGCGC
CGCTTGAGCCATGGAGCCACGGCAGGCACCGTTGTTGCTGTCGTTGTGGCTGTCGCCCTCATGGTCTTTTGCCTC
TATCCAGTAGTTGTGTACAGCCTCAAGCATCGCCGCCGTGGCCATGGGCAGCACAGAGATGCCGAGGCGCCCATG
GCGCTCCCATCTGCCCACCAGCCTGCCAATCACCGGCGACTCTCCTCCATCGACTCTTTCAAGCAAGACGGCGAT
TTGTCTCGCGGCCATGGCGACGCCGCCTCTTATCGAGAAGCTTCATGGACTGGAGCCATGGCCGATGCAGCCTAC
ACTGCCCATGACGATGGGTCGCGACGGCCAGGCCCCGAGTCGGCGTCGACGCCCGCCCCTCTGCCCTTTTACTAT
GGCGAATACATGCCCGTCTCCGAAGTCATTGACAATAGATCTGGAGTGCTTCAAGGAACAAGCGCAGACTATTAT
AGCCCTTCAATTCCGTCTGAAGCCTTTGGCATGATGGCTGCCTCCCCAGACGCCCATGCCGCTTATGTAGCCTCG
TCGGGCTCTCGCAGCTTGCGATACAATGTCAGACACATGTTCAGTCGCAAGAAGCTTGGTGACCACCAGCCCCGT
GGCCACGACTCTGCCAGTCTCGGTGGACCTGAGGCACCATGTCCCACGGCCCTTGAATCTCAGGGCGCAACCCCG
CTGAATCAAGTGTCGACCAGCAGAGGTCTCACAGAGCCTTGTTCGTACCAGCTCCCCGCCGCGGCCATGCCGACA
GCGTCGCACACTGGTTTGCCGGCAAACACTCAGCTGGCGCCAAATCCACTCACCACTCGGTCCAGCATCCTGTCT
CAGTCGCAGAAGCGCACCGACACAGGCCCCAACAAGACGCCCTTGCTACCGCCGTCACACCCTGCCCCAGGCACT
GTCAATCCAATGGATATCATGCCCGCAAGTACCCATTCAGAAAGGCGGCATCAGGCTGAATACCAACTATCGGCA
TCGTCGTTTGCCTTGGCACAGCAGGGTCCAAGTTCCCCGCCGCCTGCTTCCCATGCACAGTCTCCCAGTGTCATG
CAAAATGCAGATGCCACGAGCCATGTTGGTGCCTCAGATGACAAAACACCCCTATCAGCCAATCACTTGAGCCCG
CCGATAGACCCAGAGTCAAGTCGACATCCTAGCTATCCGTCTGATCAGTCTACTCCATTCCCGGGGCCAGGATCG
ACAAACACTTCTGCACACAATACTCCATCAACACAGATAGACAGTCTCTCCCCCGAGAGCATAGATAGTTCTGAT
TTCCGCCACAGCACATCCCCTCAGCCGGCTCCTCCATCACTAACATCTGGCCCCGTCTTCCGCTGCAAGGAGCCT
GGTTGCAACCAAGCATTTGGCGCACCACACAAACTCAAACATCATACAAGATATCATCGCAGAGAACACAAGTGT
CCATTTCCAAACTGTGAAAAGGGCTTTGGTACACGCACTCACTTGCAAAGACATATCAATGACCGACATGACAAG
AAGAAGAAGTTTCATTGCACGGTCCAGGGATGCGAGTACTCCAAAACAGGAGGCAAGGCCTTTCCTCGAAAGGAC
AATTGGAAAAGGCACATGACCAAAATACATAATCTGGAACAGTCACAGCTTCCCGAGCCAGTCGAGGTTGACCAG
GTCATGAGCGGCACATGA
Gene >OphauB2|7428
ATGGCTTCGCATTGTTCCAGTAGCATCGTGGCGGCCGTTGCTGCTCATGACACGACGAGTCGGGCGGCGCCATGC
TCGGCCACGACGACTGCTCATGGCCGGCGCTGGCCGGTGCAGCCTGCCTTTCTGGAATCCCATATTGCCAGGCGC
CGCTTGAGCCATGGAGCCACGGCAGGCACCGTTGTTGCTGTCGTTGTGGCTGTCGCCCTCATGGTCTTTTGCCTC
TATCCAGTAGTTGTGTACAGCCTCAAGCATCGCCGCCGTGGCCATGGGCAGCACAGAGATGCCGAGGCGCCCATG
GCGCTCCCATCTGCCCACCAGCCTGCCAATCACCGGCGACTCTCCTCCATCGACTCTTTCAAGCAAGACGGCGAT
TTGTCTCGCGGCCATGGCGACGCCGCCTCTTATCGAGAAGCTTCATGGACTGGAGCCATGGCCGATGCAGCCTAC
ACTGCCCATGACGATGGGTCGCGACGGCCAGGCCCCGAGTCGGCGTCGACGCCCGCCCCTCTGCCCTTTTACTAT
GGCGAATACATGCCCGTCTCCGAAGTCATTGACAATAGATCTGGAGTGCTTCAAGGAACAAGCGCAGACTATTAT
AGCCCTTCAATTCCGTCTGAAGCCTTTGGCATGATGGCTGCCTCCCCAGACGCCCATGCCGCTTATGTAGCCTCG
TCGGGCTCTCGCAGCTTGCGATACAATGTCAGACACATGTTCAGTCGCAAGAAGCTTGGTGACCACCAGCCCCGT
GGCCACGACTCTGCCAGTCTCGGTGGACCTGAGGCACCATGTCCCACGGCCCTTGAATCTCAGGGCGCAACCCCG
CTGAATCAAGTGTCGACCAGCAGAGGTCTCACAGAGCCTTGTTCGTACCAGCTCCCCGCCGCGGCCATGCCGACA
GCGTCGCACACTGGTTTGCCGGCAAACACTCAGCTGGCGCCAAATCCACTCACCACTCGGTCCAGCATCCTGTCT
CAGTCGCAGAAGCGCACCGACACAGGCCCCAACAAGACGCCCTTGCTACCGCCGTCACACCCTGCCCCAGGCACT
GTCAATCCAATGGATATCATGCCCGCAAGTACCCATTCAGAAAGGCGGCATCAGGCTGAATACCAACTATCGGCA
TCGTCGTTTGCCTTGGCACAGCAGGGTCCAAGTTCCCCGCCGCCTGCTTCCCATGCACAGTCTCCCAGTGTCATG
CAAAATGCAGATGCCACGAGCCATGTTGGTGCCTCAGATGACAAAACACCCCTATCAGCCAATCACTTGAGCCCG
CCGATAGACCCAGAGTCAAGTCGACATCCTAGCTATCCGTCTGATCAGTCTACTCCATTCCCGGGGCCAGGATCG
ACAAACACTTCTGCACACAATACTCCATCAACACAGATAGACAGTCTCTCCCCCGAGAGCATAGATAGTTCTGAT
TTCCGCCACAGCACATCCCCTCAGCCGGCTCCTCCATCACTAACATCTGGCCCCGTCTTCCGCTGCAAGGAGCCT
GGTTGCAACCAAGCATTTGGCGCACCACACAAACTCAAGTACGTTTCAACCTCCCCTCTTGTTTCCAGCCTCGAG
TCGCCAGCTCACGCTTTTTTGCTTCTTTAGACATCATACAAGATATCATCGCAGAGAACACAAGTGTCCATTTCC
AAACTGTGAAAAGGGCTTTGGTACACGCACTCACTTGCAAAGACATATCAATGACCGACATGACAAGAAGAAGAA
GTTTCATTGCACGGTCCAGGGATGCGAGTACTCCAAAACAGGAGGCAAGGCCTTTCCTCGAAAGGACAATTGGAA
AAGGCACATGACCAAAATACATAATCTGGAACAGTCACAGCTTCCCGAGCCAGTCGAGGTTGACCAGGTCATGAG
CGGCACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail