Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7427
Gene name
LocationContig_8:98323..99130
Strand+
Gene length (bp)807
Transcript length (bp)738
Coding sequence length (bp)738
Protein length (aa) 246

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain 2.2E-15 20 66
PF15985 KH_6 KH domain 5.0E-15 156 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08285|RRP40_YEAST Exosome complex component RRP40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP40 PE=1 SV=2 5 240 2.0E-41
sp|O13903|RRP40_SCHPO Exosome complex component rrp40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp40 PE=3 SV=1 7 242 1.0E-36
sp|Q7KWX9|EXOS3_DICDI Putative exosome complex component rrp40 OS=Dictyostelium discoideum GN=exosc3 PE=3 SV=1 7 223 3.0E-29
sp|Q9NQT5|EXOS3_HUMAN Exosome complex component RRP40 OS=Homo sapiens GN=EXOSC3 PE=1 SV=3 30 205 2.0E-20
sp|Q3T0E1|EXOS3_BOVIN Exosome complex component RRP40 OS=Bos taurus GN=EXOSC3 PE=2 SV=1 30 243 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08285|RRP40_YEAST Exosome complex component RRP40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP40 PE=1 SV=2 5 240 2.0E-41
sp|O13903|RRP40_SCHPO Exosome complex component rrp40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp40 PE=3 SV=1 7 242 1.0E-36
sp|Q7KWX9|EXOS3_DICDI Putative exosome complex component rrp40 OS=Dictyostelium discoideum GN=exosc3 PE=3 SV=1 7 223 3.0E-29
sp|Q9NQT5|EXOS3_HUMAN Exosome complex component RRP40 OS=Homo sapiens GN=EXOSC3 PE=1 SV=3 30 205 2.0E-20
sp|Q3T0E1|EXOS3_BOVIN Exosome complex component RRP40 OS=Bos taurus GN=EXOSC3 PE=2 SV=1 30 243 2.0E-20
sp|Q7TQK4|EXOS3_MOUSE Exosome complex component RRP40 OS=Mus musculus GN=Exosc3 PE=1 SV=3 30 224 4.0E-20
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7427
MASDSIFVLPGDPIDGSILPCHPTKALRLGPGLRHVPPKQILPTLAGQLLVDKHKNAMRVETSRGRYIPRAGELV
IGTISKSVADAYQVLISPYTAPVSLNHLSFELATRKTRPVLLAGALVYARVSVAHKHMDAEVECVSATTGKSDGL
GPLTGGMLFDISLGMARRLLIPKPAQHAKLVVLDELAANGLQFDTATGRNGKFWVGSHSAATVIAVGRAIQDTDV
NNLSIDAQRKLVRLLIKNTG*
Coding >OphauB2|7427
ATGGCTTCCGACTCCATCTTTGTCCTTCCCGGAGACCCCATTGATGGCTCAATTCTCCCATGTCACCCCACAAAG
GCTCTGCGTCTGGGCCCCGGGCTGCGCCATGTGCCTCCAAAGCAGATCCTCCCCACGCTCGCTGGCCAGCTCCTT
GTCGACAAGCACAAGAATGCAATGCGTGTCGAGACGTCACGGGGACGATATATTCCCCGAGCGGGCGAACTCGTC
ATAGGCACCATTTCCAAGAGTGTGGCCGACGCCTATCAGGTGCTCATCTCGCCCTACACGGCTCCCGTCAGCCTC
AACCACTTGTCCTTTGAACTGGCCACGCGCAAGACGCGCCCTGTTCTCCTTGCCGGCGCCCTTGTCTATGCGCGT
GTCAGCGTGGCCCACAAGCACATGGACGCCGAAGTCGAATGCGTCTCTGCAACAACTGGAAAGTCGGATGGCCTG
GGCCCCCTCACTGGCGGCATGCTCTTCGACATCTCGCTGGGAATGGCACGTCGCCTCTTGATACCCAAGCCGGCT
CAGCATGCCAAGCTTGTTGTCCTCGATGAATTGGCAGCCAACGGACTCCAGTTTGACACCGCCACCGGCCGAAAT
GGAAAATTCTGGGTTGGAAGCCATAGCGCAGCTACTGTCATTGCCGTGGGAAGAGCCATACAAGATACCGACGTC
AATAATCTCAGCATTGACGCCCAGAGAAAATTGGTCAGGCTTCTAATCAAAAATACCGGTTAA
Transcript >OphauB2|7427
ATGGCTTCCGACTCCATCTTTGTCCTTCCCGGAGACCCCATTGATGGCTCAATTCTCCCATGTCACCCCACAAAG
GCTCTGCGTCTGGGCCCCGGGCTGCGCCATGTGCCTCCAAAGCAGATCCTCCCCACGCTCGCTGGCCAGCTCCTT
GTCGACAAGCACAAGAATGCAATGCGTGTCGAGACGTCACGGGGACGATATATTCCCCGAGCGGGCGAACTCGTC
ATAGGCACCATTTCCAAGAGTGTGGCCGACGCCTATCAGGTGCTCATCTCGCCCTACACGGCTCCCGTCAGCCTC
AACCACTTGTCCTTTGAACTGGCCACGCGCAAGACGCGCCCTGTTCTCCTTGCCGGCGCCCTTGTCTATGCGCGT
GTCAGCGTGGCCCACAAGCACATGGACGCCGAAGTCGAATGCGTCTCTGCAACAACTGGAAAGTCGGATGGCCTG
GGCCCCCTCACTGGCGGCATGCTCTTCGACATCTCGCTGGGAATGGCACGTCGCCTCTTGATACCCAAGCCGGCT
CAGCATGCCAAGCTTGTTGTCCTCGATGAATTGGCAGCCAACGGACTCCAGTTTGACACCGCCACCGGCCGAAAT
GGAAAATTCTGGGTTGGAAGCCATAGCGCAGCTACTGTCATTGCCGTGGGAAGAGCCATACAAGATACCGACGTC
AATAATCTCAGCATTGACGCCCAGAGAAAATTGGTCAGGCTTCTAATCAAAAATACCGGTTAA
Gene >OphauB2|7427
ATGGCTTCCGACTCCATCTTTGTCCTTCCCGGAGACCCCATTGATGGCTCAATTCTCCCATGTCACCCCACAAAG
GCTCTGCGTCTGGGCCCCGGGCTGCGCCATGTGCCTCCAAAGCAGATCCTCCCCACGCTCGCTGGCCAGCTCCTT
GTCGACAAGCACAAGAATGCAATGCGTGTCGAGACGTCACGGGGACGAGTAGGCGCCCCCTTGGCGTGCGCTGTG
GCTGCAATGAGGCATAGGTAGGATGCTGACGAGCAAACACAGTATATTCCCCGAGCGGGCGAACTCGTCATAGGC
ACCATTTCCAAGAGTGTGGCCGACGCCTATCAGGTGCTCATCTCGCCCTACACGGCTCCCGTCAGCCTCAACCAC
TTGTCCTTTGAACTGGCCACGCGCAAGACGCGCCCTGTTCTCCTTGCCGGCGCCCTTGTCTATGCGCGTGTCAGC
GTGGCCCACAAGCACATGGACGCCGAAGTCGAATGCGTCTCTGCAACAACTGGAAAGTCGGATGGCCTGGGCCCC
CTCACTGGCGGCATGCTCTTCGACATCTCGCTGGGAATGGCACGTCGCCTCTTGATACCCAAGCCGGCTCAGCAT
GCCAAGCTTGTTGTCCTCGATGAATTGGCAGCCAACGGACTCCAGTTTGACACCGCCACCGGCCGAAATGGAAAA
TTCTGGGTTGGAAGCCATAGCGCAGCTACTGTCATTGCCGTGGGAAGAGCCATACAAGATACCGACGTCAATAAT
CTCAGCATTGACGCCCAGAGAAAATTGGTCAGGCTTCTAATCAAAAATACCGGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail