Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7412
Gene name
LocationContig_8:49654..51428
Strand+
Gene length (bp)1774
Transcript length (bp)1704
Coding sequence length (bp)1704
Protein length (aa) 568

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13000 Acatn Acetyl-coenzyme A transporter 1 1.1E-82 85 295
PF13000 Acatn Acetyl-coenzyme A transporter 1 4.2E-27 292 379
PF13000 Acatn Acetyl-coenzyme A transporter 1 1.6E-51 381 562

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38318|YB70_YEAST Uncharacterized membrane protein YBR220C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR220C PE=1 SV=1 77 564 6.0E-143
sp|Q9USW4|YHZ9_SCHPO Uncharacterized protein C21B10.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21B10.09 PE=4 SV=1 37 565 5.0E-119
sp|O00400|ACATN_HUMAN Acetyl-coenzyme A transporter 1 OS=Homo sapiens GN=SLC33A1 PE=1 SV=1 95 562 7.0E-99
sp|Q99J27|ACATN_MOUSE Acetyl-coenzyme A transporter 1 OS=Mus musculus GN=Slc33a1 PE=1 SV=1 95 562 2.0E-97
sp|Q6AYY8|ACATN_RAT Acetyl-coenzyme A transporter 1 OS=Rattus norvegicus GN=Slc33a1 PE=2 SV=1 95 562 2.0E-97
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38318|YB70_YEAST Uncharacterized membrane protein YBR220C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR220C PE=1 SV=1 77 564 6.0E-143
sp|Q9USW4|YHZ9_SCHPO Uncharacterized protein C21B10.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21B10.09 PE=4 SV=1 37 565 5.0E-119
sp|O00400|ACATN_HUMAN Acetyl-coenzyme A transporter 1 OS=Homo sapiens GN=SLC33A1 PE=1 SV=1 95 562 7.0E-99
sp|Q99J27|ACATN_MOUSE Acetyl-coenzyme A transporter 1 OS=Mus musculus GN=Slc33a1 PE=1 SV=1 95 562 2.0E-97
sp|Q6AYY8|ACATN_RAT Acetyl-coenzyme A transporter 1 OS=Rattus norvegicus GN=Slc33a1 PE=2 SV=1 95 562 2.0E-97
sp|P38317|YB69_YEAST Uncharacterized protein YBR219C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR219C PE=4 SV=1 452 563 3.0E-13
sp|P0AE16|AMPG_ECOLI Protein AmpG OS=Escherichia coli (strain K12) GN=ampG PE=1 SV=1 80 256 4.0E-06
sp|P0AE17|AMPG_ECO57 Protein AmpG OS=Escherichia coli O157:H7 GN=ampG PE=3 SV=1 80 256 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0008521 acetyl-CoA transmembrane transporter activity Yes
GO:0005346 purine ribonucleotide transmembrane transporter activity No
GO:0015605 organophosphate ester transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0015216 purine nucleotide transmembrane transporter activity No
GO:0008514 organic anion transmembrane transporter activity No
GO:0071077 adenosine 3',5'-bisphosphate transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0000295 adenine nucleotide transmembrane transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0015075 ion transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0015215 nucleotide transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:1901505 carbohydrate derivative transmembrane transporter activity No
GO:1901682 sulfur compound transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0008509 anion transmembrane transporter activity No
GO:0015932 nucleobase-containing compound transmembrane transporter activity No
GO:0042887 amide transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 84 106 22
2 153 172 19
3 185 207 22
4 227 246 19
5 267 289 22
6 309 331 22
7 351 373 22
8 383 405 22
9 412 434 22
10 449 471 22
11 527 546 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7412
MGARARRPQSLDSNSRTPRSAKDKNSNGKMSSGVEMRRKIVGPDVNLAANHMARESFSLDQPVPKTATESSQGFF
DLPRQDQRSFLLLVLLYFLQGIPMGLAMGSVPFLLKNHLSYGQIGTFSLASYPYSLKLFWSPFVDAVWSPKIGRR
KTWIVPIQFVSGFGMLWLGSHVEQMMETMGQPRGPTVWGFMLWWFFLVLMCATQDIAVDGWALTLLSPANVSYAS
TAQTVGLTAGHFMSYTVFLALNANDFANKWIRTVPSDQGLVSLGGYLTFWGWMYIIVTVGLGLLKHEEKSQNEDG
VWDVYKIMWGILKLKNVQTIIIVHLIAKIGFQANDGVTNLKLLDKGFGKDNMALTVLIDFPFEIGLGYYAGMWSQ
KYTPMRLWCWGFVGRLAAAMMAQLTVAIFPSNGVTMWYLLVVIAEHVFSTFTNTIMFVAVSAFHAKVSDPVIGGT
YMTLLATVSNLGGTFPRYFVLKLVDAFTVATCHANALADSSSLKGPLVTEAFSCAVQSEKERCENGGGQCVMVRD
GYYAVNMLCVAFGAATFAWYIRPRVMQLQSLPLKAWRLSAAR*
Coding >OphauB2|7412
ATGGGTGCCCGAGCCAGACGGCCGCAGTCGCTCGACAGCAACAGTCGGACCCCTCGCTCTGCCAAAGACAAGAAT
TCTAATGGCAAGATGAGCAGCGGTGTCGAAATGCGTCGCAAAATCGTCGGCCCCGACGTAAACTTGGCGGCCAAC
CACATGGCACGCGAAAGCTTTTCTCTCGATCAGCCCGTGCCCAAGACGGCGACTGAGAGCAGCCAAGGCTTCTTT
GATTTGCCGCGGCAAGACCAACGGAGCTTTCTCCTCTTGGTGCTGTTATACTTTCTACAAGGAATTCCCATGGGC
TTGGCCATGGGCTCGGTTCCTTTTTTACTCAAGAATCACTTGTCGTACGGCCAAATCGGGACATTTAGCCTGGCG
TCGTATCCTTACTCGCTCAAGCTCTTTTGGAGCCCCTTTGTCGATGCCGTGTGGAGCCCCAAGATTGGGCGGCGC
AAGACATGGATCGTGCCGATACAGTTTGTATCCGGATTTGGCATGCTCTGGCTGGGCTCGCACGTTGAGCAGATG
ATGGAGACAATGGGCCAGCCTCGAGGTCCTACAGTGTGGGGCTTCATGCTCTGGTGGTTCTTCTTGGTCTTGATG
TGCGCGACGCAGGACATTGCTGTCGACGGCTGGGCCCTGACGCTATTGAGTCCTGCCAATGTGTCTTATGCTTCG
ACGGCGCAGACAGTCGGGCTGACGGCTGGCCACTTCATGTCGTATACCGTCTTTCTTGCGCTCAATGCAAACGAC
TTTGCCAACAAGTGGATTCGGACGGTGCCTTCGGACCAAGGCCTTGTTTCGCTTGGCGGATACTTGACCTTTTGG
GGCTGGATGTACATCATCGTCACCGTGGGGCTTGGCCTGCTCAAGCATGAAGAAAAGTCACAAAACGAAGACGGC
GTGTGGGACGTGTACAAGATCATGTGGGGAATACTCAAGTTGAAAAACGTGCAGACGATTATAATTGTGCATCTC
ATTGCCAAGATTGGCTTCCAGGCCAATGACGGGGTGACGAACCTCAAGCTGCTAGACAAGGGCTTTGGCAAGGAC
AACATGGCGCTTACGGTGCTCATAGACTTTCCCTTTGAGATTGGACTGGGCTATTATGCAGGCATGTGGTCGCAA
AAGTACACTCCGATGCGGCTGTGGTGCTGGGGCTTTGTTGGGCGGCTGGCGGCAGCCATGATGGCACAGCTGACG
GTGGCGATTTTCCCAAGCAACGGGGTAACCATGTGGTATCTGCTGGTTGTGATTGCCGAGCACGTCTTTTCAACC
TTTACCAACACAATCATGTTTGTTGCCGTGTCGGCCTTTCACGCCAAGGTGTCGGATCCGGTCATTGGCGGCACT
TATATGACGCTGCTAGCTACCGTTTCGAACCTGGGCGGCACGTTTCCTAGATATTTTGTGCTGAAGCTGGTGGAT
GCCTTTACGGTGGCGACGTGCCATGCCAACGCACTGGCCGACAGCAGCAGCCTCAAGGGACCGCTCGTGACGGAA
GCCTTTTCGTGCGCGGTGCAGTCGGAAAAGGAGCGATGCGAGAATGGCGGGGGGCAGTGCGTCATGGTGCGGGAT
GGCTACTACGCCGTCAACATGCTGTGCGTGGCTTTTGGCGCGGCAACCTTTGCGTGGTATATCAGGCCGCGGGTG
ATGCAGTTGCAGAGCCTGCCTTTGAAGGCGTGGAGGCTGTCGGCGGCGAGGTAG
Transcript >OphauB2|7412
ATGGGTGCCCGAGCCAGACGGCCGCAGTCGCTCGACAGCAACAGTCGGACCCCTCGCTCTGCCAAAGACAAGAAT
TCTAATGGCAAGATGAGCAGCGGTGTCGAAATGCGTCGCAAAATCGTCGGCCCCGACGTAAACTTGGCGGCCAAC
CACATGGCACGCGAAAGCTTTTCTCTCGATCAGCCCGTGCCCAAGACGGCGACTGAGAGCAGCCAAGGCTTCTTT
GATTTGCCGCGGCAAGACCAACGGAGCTTTCTCCTCTTGGTGCTGTTATACTTTCTACAAGGAATTCCCATGGGC
TTGGCCATGGGCTCGGTTCCTTTTTTACTCAAGAATCACTTGTCGTACGGCCAAATCGGGACATTTAGCCTGGCG
TCGTATCCTTACTCGCTCAAGCTCTTTTGGAGCCCCTTTGTCGATGCCGTGTGGAGCCCCAAGATTGGGCGGCGC
AAGACATGGATCGTGCCGATACAGTTTGTATCCGGATTTGGCATGCTCTGGCTGGGCTCGCACGTTGAGCAGATG
ATGGAGACAATGGGCCAGCCTCGAGGTCCTACAGTGTGGGGCTTCATGCTCTGGTGGTTCTTCTTGGTCTTGATG
TGCGCGACGCAGGACATTGCTGTCGACGGCTGGGCCCTGACGCTATTGAGTCCTGCCAATGTGTCTTATGCTTCG
ACGGCGCAGACAGTCGGGCTGACGGCTGGCCACTTCATGTCGTATACCGTCTTTCTTGCGCTCAATGCAAACGAC
TTTGCCAACAAGTGGATTCGGACGGTGCCTTCGGACCAAGGCCTTGTTTCGCTTGGCGGATACTTGACCTTTTGG
GGCTGGATGTACATCATCGTCACCGTGGGGCTTGGCCTGCTCAAGCATGAAGAAAAGTCACAAAACGAAGACGGC
GTGTGGGACGTGTACAAGATCATGTGGGGAATACTCAAGTTGAAAAACGTGCAGACGATTATAATTGTGCATCTC
ATTGCCAAGATTGGCTTCCAGGCCAATGACGGGGTGACGAACCTCAAGCTGCTAGACAAGGGCTTTGGCAAGGAC
AACATGGCGCTTACGGTGCTCATAGACTTTCCCTTTGAGATTGGACTGGGCTATTATGCAGGCATGTGGTCGCAA
AAGTACACTCCGATGCGGCTGTGGTGCTGGGGCTTTGTTGGGCGGCTGGCGGCAGCCATGATGGCACAGCTGACG
GTGGCGATTTTCCCAAGCAACGGGGTAACCATGTGGTATCTGCTGGTTGTGATTGCCGAGCACGTCTTTTCAACC
TTTACCAACACAATCATGTTTGTTGCCGTGTCGGCCTTTCACGCCAAGGTGTCGGATCCGGTCATTGGCGGCACT
TATATGACGCTGCTAGCTACCGTTTCGAACCTGGGCGGCACGTTTCCTAGATATTTTGTGCTGAAGCTGGTGGAT
GCCTTTACGGTGGCGACGTGCCATGCCAACGCACTGGCCGACAGCAGCAGCCTCAAGGGACCGCTCGTGACGGAA
GCCTTTTCGTGCGCGGTGCAGTCGGAAAAGGAGCGATGCGAGAATGGCGGGGGGCAGTGCGTCATGGTGCGGGAT
GGCTACTACGCCGTCAACATGCTGTGCGTGGCTTTTGGCGCGGCAACCTTTGCGTGGTATATCAGGCCGCGGGTG
ATGCAGTTGCAGAGCCTGCCTTTGAAGGCGTGGAGGCTGTCGGCGGCGAGGTAG
Gene >OphauB2|7412
ATGGGTGCCCGAGCCAGACGGCCGCAGTCGCTCGACAGCAACAGTCGGACCCCTCGCTCTGCCAAAGACAAGAAT
TCTAATGGCAAGATGAGCAGCGGTGTCGAAATGCGTCGCAAAATCGTCGGCCCCGACGTAAACTTGGCGGCCAAC
CACATGGCACGCGAAAGCTTTTCTCTCGATCAGCCCGTGCCCAAGACGGCGACTGAGAGCAGCCAAGGCTTCTTT
GATTTGCCGCGGCAAGACCAACGGAGCTTTCTCCTCTTGGTGCTGTTATACTTTCTACAAGGAATTCCCATGGGC
TTGGCCATGGGCTCGGTTCCTTTTTTACTCAAGAATCACTTGTCGTACGGCCAAATCGGGACATTTAGCCTGGCG
TCGTATCCTTACTCGCTCAAGCTCTTTTGGAGCCCCTTTGTCGATGCCGTGTGGAGCCCCAAGATTGGGCGGCGC
AAGACATGGATCGTGCCGATACAGTTTGTATCCGGATTTGGCATGCTCTGGCTGGGCTCGCACGTTGAGCAGATG
ATGGAGACAATGGGCCAGCCTCGAGGTCCTACAGTGTGGGGCTTCATGCTCTGGTGGTTCTTCTTGGTCTTGATG
TGCGCGACGCAGGACATTGCTGTCGACGGCTGGGCCCTGACGCTATTGAGTCCTGCCAATGTGTCTTATGCTTCG
ACGGCGCAGACAGTCGGGCTGACGGCTGGCCACTTCATGTCGTATACCGTCTTTCTTGCGCTCAATGCAAACGAC
TTTGCCAACAAGTGGATTCGGACGGTGCCTTCGGACCAAGGCCTTGTTTCGCTTGGCGGATACTTGACCTTTTGG
GGCTGGATGTACATCATCGTCACCGTGGGGCTTGGCCTGCTCAAGCATGAAGAAAAGTCACAAAACGAAGACGGC
GTGTGGGACGTGTACAAGATCATGTGGGGAATACTCAAGTTGAAAAACGTGCAGACGATTATAATTGTGCATCTC
ATTGCCAAGATTGGCTTCCAGGCCAATGACGGGGTGACGAACCTCAAGCTGCTAGACAAGGGCTTTGGCAAGGAC
AACATGGCGCTTACGGTGCTCATAGACTTTCCCTTTGAGATTGGACTGGGCTATTATGCAGGCATGTGGTCGCAA
AAGTACACTCCGATGCGGCTGTGGTGCTGGGGCTTTGTTGGGCGGCTGGCGGCAGCCATGATGGCACAGCTGACG
GTGGCGATTTTCCCAAGCAACGGGGTAACCATGTGGTATCTGCTGGTTGTGATTGCCGAGCACGTCTTTTCAACC
TTTACCAACACAATCATGTTTGTTGCCGTGTCGGCCTTTCACGCCAAGGTGTCGGATCCGGTCATTGGCGGCACT
TATATGACGCTGCTAGCTACGTGAGTGGAGCTGGTTGATTTCTGGCATGGCATCAAGAGGAAGAGCTAACGTAAG
AAACAACACAAAAAGCGTTTCGAACCTGGGCGGCACGTTTCCTAGATATTTTGTGCTGAAGCTGGTGGATGCCTT
TACGGTGGCGACGTGCCATGCCAACGCACTGGCCGACAGCAGCAGCCTCAAGGGACCGCTCGTGACGGAAGCCTT
TTCGTGCGCGGTGCAGTCGGAAAAGGAGCGATGCGAGAATGGCGGGGGGCAGTGCGTCATGGTGCGGGATGGCTA
CTACGCCGTCAACATGCTGTGCGTGGCTTTTGGCGCGGCAACCTTTGCGTGGTATATCAGGCCGCGGGTGATGCA
GTTGCAGAGCCTGCCTTTGAAGGCGTGGAGGCTGTCGGCGGCGAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail