Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7409
Gene name
LocationContig_8:44318..44987
Strand+
Gene length (bp)669
Transcript length (bp)669
Coding sequence length (bp)669
Protein length (aa) 223

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09811 Yae1_N Essential protein Yae1, N terminal 2.2E-14 59 97

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4RK96|YAE1_MAGO7 Uncharacterized protein YAE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=YAE1 PE=3 SV=1 24 188 1.0E-45
sp|A6RL85|YAE1_BOTFB Uncharacterized protein yae1 OS=Botryotinia fuckeliana (strain B05.10) GN=yae1 PE=3 SV=1 24 222 5.0E-35
sp|A7EB95|YAE1_SCLS1 Uncharacterized protein yae1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=yae1 PE=3 SV=1 22 192 5.0E-35
sp|Q0V5P6|YAE1_PHANO Uncharacterized protein YAE1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=YAE1 PE=3 SV=1 24 198 9.0E-25
sp|A2QF59|YAE1_ASPNC Uncharacterized protein yae1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=yae1 PE=3 SV=1 23 120 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4RK96|YAE1_MAGO7 Uncharacterized protein YAE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=YAE1 PE=3 SV=1 24 188 1.0E-45
sp|A6RL85|YAE1_BOTFB Uncharacterized protein yae1 OS=Botryotinia fuckeliana (strain B05.10) GN=yae1 PE=3 SV=1 24 222 5.0E-35
sp|A7EB95|YAE1_SCLS1 Uncharacterized protein yae1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=yae1 PE=3 SV=1 22 192 5.0E-35
sp|Q0V5P6|YAE1_PHANO Uncharacterized protein YAE1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=YAE1 PE=3 SV=1 24 198 9.0E-25
sp|A2QF59|YAE1_ASPNC Uncharacterized protein yae1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=yae1 PE=3 SV=1 23 120 1.0E-17
sp|Q4WWW5|YAE1_ASPFU Uncharacterized protein yae1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=yae1 PE=3 SV=1 24 114 3.0E-16
sp|A1CJJ9|YAE1_ASPCL Uncharacterized protein yae1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=yae1 PE=3 SV=1 21 101 6.0E-15
sp|Q6C531|YAE1_YARLI Uncharacterized protein YAE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YAE1 PE=3 SV=1 45 179 7.0E-15
sp|Q1DQS5|YAE1_COCIM Uncharacterized protein YAE1 OS=Coccidioides immitis (strain RS) GN=YAE1 PE=3 SV=1 26 103 9.0E-15
sp|A1D7X8|YAE1_NEOFI Uncharacterized protein yae1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=yae1 PE=3 SV=1 25 114 1.0E-14
sp|Q0CX45|YAE1_ASPTN Uncharacterized protein yae1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=yae1 PE=3 SV=1 24 106 4.0E-14
sp|P47118|YAE1_YEAST Uncharacterized protein YAE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAE1 PE=1 SV=1 27 170 6.0E-13
sp|A6ZQ26|YAE1_YEAS7 Uncharacterized protein YAE1 OS=Saccharomyces cerevisiae (strain YJM789) GN=YAE1 PE=3 SV=1 27 178 1.0E-12
sp|Q6FUV0|YAE1_CANGA Uncharacterized protein YAE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YAE1 PE=3 SV=1 24 183 5.0E-12
sp|A7TE16|YAE1_VANPO Uncharacterized protein YAE1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=YAE1 PE=3 SV=1 24 175 3.0E-10
sp|Q6BL68|YAE1_DEBHA Uncharacterized protein YAE1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YAE1 PE=3 SV=2 42 174 8.0E-07
sp|Q753A3|YAE1_ASHGO Uncharacterized protein YAE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YAE1 PE=3 SV=2 47 100 1.0E-06
sp|Q9NRH1|YAED1_HUMAN Yae1 domain-containing protein 1 OS=Homo sapiens GN=YAE1D1 PE=2 SV=1 28 101 1.0E-06
sp|Q6CV86|YAE1_KLULA Uncharacterized protein YAE1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YAE1 PE=3 SV=1 34 142 2.0E-06
sp|Q9P840|YAE1_CANAL Uncharacterized protein YAE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YAE1 PE=3 SV=1 55 170 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7409
MAQDGLAPRAGGGGGGDANQNLLDALDDVFETDSDAPDHHGESHPSDMRRLQAEHATAGYREGIAQGKAATIQEG
FDQGFSLGATIGLRAGQLLGILQGIVEAVQSLEDQDAVQVRTLLAEARNELRQEAIYDTAYWEPDGQWKYQVHAE
AGAEPLFSDVADAHPLIQKWKLAVDSQARLWGLNEAIFDGEESNQDDQDAQGPLLETGSQEATAAAKAVLDW*
Coding >OphauB2|7409
ATGGCGCAAGATGGCTTGGCTCCTCGAGCCGGTGGTGGCGGTGGCGGTGATGCAAATCAAAATTTGCTTGACGCT
CTTGACGATGTCTTTGAGACAGACTCTGACGCGCCAGACCACCACGGCGAATCTCATCCCTCAGACATGAGACGA
CTGCAGGCAGAGCACGCGACGGCAGGTTACCGCGAGGGCATTGCCCAAGGCAAAGCAGCCACCATACAAGAAGGA
TTCGACCAGGGCTTCAGCCTGGGAGCCACCATTGGCCTGCGAGCTGGCCAGCTCCTGGGAATCCTCCAAGGCATC
GTGGAAGCTGTGCAGAGCCTTGAGGATCAAGACGCTGTTCAAGTACGCACTTTGCTGGCTGAGGCGCGGAATGAG
CTTCGCCAAGAAGCCATCTATGATACAGCTTACTGGGAGCCGGATGGGCAATGGAAGTACCAAGTCCATGCTGAA
GCGGGCGCTGAGCCCCTTTTCTCCGACGTCGCAGACGCTCATCCCTTGATCCAAAAATGGAAACTTGCCGTCGAC
AGCCAAGCCAGACTGTGGGGATTAAACGAGGCCATTTTTGACGGCGAGGAGAGCAACCAAGATGATCAAGACGCC
CAGGGCCCGCTATTGGAGACTGGAAGCCAAGAAGCAACGGCTGCTGCAAAGGCGGTTCTGGATTGGTGA
Transcript >OphauB2|7409
ATGGCGCAAGATGGCTTGGCTCCTCGAGCCGGTGGTGGCGGTGGCGGTGATGCAAATCAAAATTTGCTTGACGCT
CTTGACGATGTCTTTGAGACAGACTCTGACGCGCCAGACCACCACGGCGAATCTCATCCCTCAGACATGAGACGA
CTGCAGGCAGAGCACGCGACGGCAGGTTACCGCGAGGGCATTGCCCAAGGCAAAGCAGCCACCATACAAGAAGGA
TTCGACCAGGGCTTCAGCCTGGGAGCCACCATTGGCCTGCGAGCTGGCCAGCTCCTGGGAATCCTCCAAGGCATC
GTGGAAGCTGTGCAGAGCCTTGAGGATCAAGACGCTGTTCAAGTACGCACTTTGCTGGCTGAGGCGCGGAATGAG
CTTCGCCAAGAAGCCATCTATGATACAGCTTACTGGGAGCCGGATGGGCAATGGAAGTACCAAGTCCATGCTGAA
GCGGGCGCTGAGCCCCTTTTCTCCGACGTCGCAGACGCTCATCCCTTGATCCAAAAATGGAAACTTGCCGTCGAC
AGCCAAGCCAGACTGTGGGGATTAAACGAGGCCATTTTTGACGGCGAGGAGAGCAACCAAGATGATCAAGACGCC
CAGGGCCCGCTATTGGAGACTGGAAGCCAAGAAGCAACGGCTGCTGCAAAGGCGGTTCTGGATTGGTGA
Gene >OphauB2|7409
ATGGCGCAAGATGGCTTGGCTCCTCGAGCCGGTGGTGGCGGTGGCGGTGATGCAAATCAAAATTTGCTTGACGCT
CTTGACGATGTCTTTGAGACAGACTCTGACGCGCCAGACCACCACGGCGAATCTCATCCCTCAGACATGAGACGA
CTGCAGGCAGAGCACGCGACGGCAGGTTACCGCGAGGGCATTGCCCAAGGCAAAGCAGCCACCATACAAGAAGGA
TTCGACCAGGGCTTCAGCCTGGGAGCCACCATTGGCCTGCGAGCTGGCCAGCTCCTGGGAATCCTCCAAGGCATC
GTGGAAGCTGTGCAGAGCCTTGAGGATCAAGACGCTGTTCAAGTACGCACTTTGCTGGCTGAGGCGCGGAATGAG
CTTCGCCAAGAAGCCATCTATGATACAGCTTACTGGGAGCCGGATGGGCAATGGAAGTACCAAGTCCATGCTGAA
GCGGGCGCTGAGCCCCTTTTCTCCGACGTCGCAGACGCTCATCCCTTGATCCAAAAATGGAAACTTGCCGTCGAC
AGCCAAGCCAGACTGTGGGGATTAAACGAGGCCATTTTTGACGGCGAGGAGAGCAACCAAGATGATCAAGACGCC
CAGGGCCCGCTATTGGAGACTGGAAGCCAAGAAGCAACGGCTGCTGCAAAGGCGGTTCTGGATTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail