Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7400
Gene name
LocationContig_8:21187..21569
Strand-
Gene length (bp)382
Transcript length (bp)258
Coding sequence length (bp)258
Protein length (aa) 86

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07189 SF3b10 Splicing factor 3B subunit 10 (SF3b10) 2.6E-38 3 80

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P58728|SF3BB_ARATH Uncharacterized protein At4g14342 OS=Arabidopsis thaliana GN=At4g14342 PE=3 SV=1 2 83 7.0E-30
sp|Q9LW64|SF3BA_ARATH Uncharacterized protein At3g23325 OS=Arabidopsis thaliana GN=At3g23325 PE=3 SV=1 2 85 8.0E-30
sp|Q9P7R6|YHV5_SCHPO Uncharacterized protein C211.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC211.05 PE=3 SV=1 1 81 3.0E-29
sp|Q9BWJ5|SF3B5_HUMAN Splicing factor 3B subunit 5 OS=Homo sapiens GN=SF3B5 PE=1 SV=1 1 82 4.0E-28
sp|Q56K13|SF3B5_BOVIN Splicing factor 3B subunit 5 OS=Bos taurus GN=SF3B5 PE=3 SV=1 1 82 4.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P58728|SF3BB_ARATH Uncharacterized protein At4g14342 OS=Arabidopsis thaliana GN=At4g14342 PE=3 SV=1 2 83 7.0E-30
sp|Q9LW64|SF3BA_ARATH Uncharacterized protein At3g23325 OS=Arabidopsis thaliana GN=At3g23325 PE=3 SV=1 2 85 8.0E-30
sp|Q9P7R6|YHV5_SCHPO Uncharacterized protein C211.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC211.05 PE=3 SV=1 1 81 3.0E-29
sp|Q9BWJ5|SF3B5_HUMAN Splicing factor 3B subunit 5 OS=Homo sapiens GN=SF3B5 PE=1 SV=1 1 82 4.0E-28
sp|Q56K13|SF3B5_BOVIN Splicing factor 3B subunit 5 OS=Bos taurus GN=SF3B5 PE=3 SV=1 1 82 4.0E-28
sp|Q9VHI4|SF3B5_DROME Probable splicing factor 3B subunit 5 OS=Drosophila melanogaster GN=CG11985 PE=1 SV=1 1 85 8.0E-28
sp|Q923D4|SF3B5_MOUSE Splicing factor 3B subunit 5 OS=Mus musculus GN=Sf3b5 PE=1 SV=1 1 82 1.0E-26
sp|Q55BF5|SF3B5_DICDI Splicing factor 3B subunit 5 OS=Dictyostelium discoideum GN=sf3b5 PE=3 SV=1 1 80 2.0E-23
sp|P0C074|YSF3_YEAST RDS3 complex subunit 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSF3 PE=1 SV=1 1 72 5.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7400
MADKLRNQQELERLQAKYVGTGHPDTTSWEWKTNIQRDTFASIVGHRPLLSYVSIAENEPITKVRAQLIRKMVQP
CGPPPPREGD*
Coding >OphauB2|7400
ATGGCCGATAAGCTGCGGAACCAGCAAGAACTCGAACGCTTGCAGGCCAAATACGTTGGAACAGGTCATCCCGAC
ACTACAAGCTGGGAATGGAAGACCAACATCCAGCGCGACACGTTTGCCTCCATTGTGGGCCATCGGCCCCTTCTA
AGTTACGTCTCCATTGCTGAAAACGAGCCCATTACCAAAGTGCGTGCTCAGCTTATTCGAAAAATGGTCCAACCT
TGCGGTCCTCCGCCGCCTCGAGAAGGGGATTGA
Transcript >OphauB2|7400
ATGGCCGATAAGCTGCGGAACCAGCAAGAACTCGAACGCTTGCAGGCCAAATACGTTGGAACAGGTCATCCCGAC
ACTACAAGCTGGGAATGGAAGACCAACATCCAGCGCGACACGTTTGCCTCCATTGTGGGCCATCGGCCCCTTCTA
AGTTACGTCTCCATTGCTGAAAACGAGCCCATTACCAAAGTGCGTGCTCAGCTTATTCGAAAAATGGTCCAACCT
TGCGGTCCTCCGCCGCCTCGAGAAGGGGATTGA
Gene >OphauB2|7400
ATGGTCCGTCTTATACTCCTTTCTCTGAAGCGACTTCCTATATTGACGCTTGCCTGTTAGGCCGATAAGCTGCGG
AACCAGCAAGAACTCGAACGCTTGCAGGCCAAATACGTTGGAACAGGTCATCCCGACACTACAAGCTGGGAATGG
AAGACCAACATCCAGCGCGACACGTTTGCCTCCATTGTGGGCCATCGGCCCCTTCTAAGTTACGTCTCCATTGCT
GAAAACGAGCCCATTACCAAAGTGCGTGCTCAGCTTATTCGAGTACGTGCTTGCATAGGATATCTATTGTCGCTC
TCTGTATGCTGCCCACCAGCTGATTACCTCATAGAAAATGGTCCAACCTTGCGGTCCTCCGCCGCCTCGAGAAGG
GGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail