Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7396
Gene name
LocationContig_8:6222..12511
Strand-
Gene length (bp)6289
Transcript length (bp)5784
Coding sequence length (bp)5784
Protein length (aa) 1928

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12726 SEN1_N SEN1 N terminal 5.9E-181 88 841
PF13087 AAA_12 AAA domain 9.9E-50 1524 1697
PF13086 AAA_11 AAA domain 2.4E-09 1319 1361
PF13086 AAA_11 AAA domain 6.0E-30 1404 1511

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00416|SEN1_YEAST Helicase SEN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN1 PE=1 SV=2 1393 1718 1.0E-83
sp|O94387|YGSA_SCHPO Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.10c PE=3 SV=1 1387 1716 8.0E-80
sp|Q92355|SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen1 PE=1 SV=1 1346 1717 7.0E-70
sp|Q86AS0|Y4399_DICDI Probable helicase DDB_G0274399 OS=Dictyostelium discoideum GN=DDB_G0274399 PE=3 SV=1 1448 1714 4.0E-60
sp|B6SFA4|MAA3_ARATH Probable helicase MAGATAMA 3 OS=Arabidopsis thaliana GN=MAA3 PE=2 SV=1 1428 1716 1.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00416|SEN1_YEAST Helicase SEN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN1 PE=1 SV=2 1393 1718 1.0E-83
sp|O94387|YGSA_SCHPO Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.10c PE=3 SV=1 1387 1716 8.0E-80
sp|Q92355|SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen1 PE=1 SV=1 1346 1717 7.0E-70
sp|Q86AS0|Y4399_DICDI Probable helicase DDB_G0274399 OS=Dictyostelium discoideum GN=DDB_G0274399 PE=3 SV=1 1448 1714 4.0E-60
sp|B6SFA4|MAA3_ARATH Probable helicase MAGATAMA 3 OS=Arabidopsis thaliana GN=MAA3 PE=2 SV=1 1428 1716 1.0E-59
sp|Q9HEH1|RENT1_NEUCR Regulator of nonsense transcripts 1 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=2E4.130 PE=3 SV=1 1139 1733 1.0E-53
sp|Q9FJR0|RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2 1136 1733 7.0E-49
sp|Q9VYS3|RENT1_DROME Regulator of nonsense transcripts 1 homolog OS=Drosophila melanogaster GN=Upf1 PE=1 SV=2 1318 1727 2.0E-48
sp|O76512|RENT1_CAEEL Regulator of nonsense transcripts 1 OS=Caenorhabditis elegans GN=smg-2 PE=1 SV=1 1093 1735 8.0E-48
sp|Q54I89|RENT1_DICDI Regulator of nonsense transcripts 1 OS=Dictyostelium discoideum GN=upf1 PE=3 SV=1 1336 1757 1.0E-47
sp|P30771|NAM7_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM7 PE=1 SV=1 1139 1724 2.0E-47
sp|Q92900|RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens GN=UPF1 PE=1 SV=2 1139 1734 1.0E-46
sp|Q9EPU0|RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus GN=Upf1 PE=1 SV=2 1139 1734 3.0E-46
sp|Q09820|RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=upf1 PE=3 SV=2 1319 1727 4.0E-46
sp|Q00416|SEN1_YEAST Helicase SEN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN1 PE=1 SV=2 72 1362 1.0E-43
sp|A2AKX3|SETX_MOUSE Probable helicase senataxin OS=Mus musculus GN=Setx PE=1 SV=1 1375 1716 9.0E-43
sp|Q7Z333|SETX_HUMAN Probable helicase senataxin OS=Homo sapiens GN=SETX PE=1 SV=4 1448 1716 3.0E-42
sp|Q98TR3|RENT1_TAKRU Putative regulator of nonsense transcripts 1 OS=Takifugu rubripes GN=rent1 PE=3 SV=1 1139 1734 2.0E-36
sp|Q0VGT4|ZGRF1_MOUSE Protein ZGRF1 OS=Mus musculus GN=Zgrf1 PE=1 SV=2 1465 1716 3.0E-35
sp|Q86YA3|ZGRF1_HUMAN Protein ZGRF1 OS=Homo sapiens GN=ZGRF1 PE=2 SV=3 1465 1716 1.0E-34
sp|Q57568|Y104_METJA Uncharacterized ATP-dependent helicase MJ0104 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0104 PE=3 SV=1 1207 1715 1.0E-33
sp|O94387|YGSA_SCHPO Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.10c PE=3 SV=1 1074 1360 5.0E-32
sp|Q60560|SMBP2_MESAU DNA-binding protein SMUBP-2 OS=Mesocricetus auratus GN=IGHMBP2 PE=1 SV=1 1267 1710 8.0E-31
sp|P38935|SMBP2_HUMAN DNA-binding protein SMUBP-2 OS=Homo sapiens GN=IGHMBP2 PE=1 SV=3 1267 1710 8.0E-31
sp|O94247|HCS1_SCHPO DNA polymerase alpha-associated DNA helicase A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hcs1 PE=3 SV=1 1318 1700 1.0E-30
sp|P40694|SMBP2_MOUSE DNA-binding protein SMUBP-2 OS=Mus musculus GN=Ighmbp2 PE=1 SV=1 1267 1710 6.0E-30
sp|Q92355|SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen1 PE=1 SV=1 1046 1359 1.0E-29
sp|P34243|HCS1_YEAST DNA polymerase alpha-associated DNA helicase A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCS1 PE=1 SV=1 1220 1700 3.0E-29
sp|Q9EQN5|SMBP2_RAT DNA-binding protein SMUBP-2 OS=Rattus norvegicus GN=Ighmbp2 PE=1 SV=1 1313 1710 4.0E-29
sp|P32644|ECM32_YEAST Putative ATP-dependent RNA helicase ECM32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM32 PE=1 SV=1 1319 1710 3.0E-28
sp|E1BMP7|DNA2_BOVIN DNA replication ATP-dependent helicase/nuclease DNA2 OS=Bos taurus GN=DNA2 PE=3 SV=3 1319 1717 2.0E-26
sp|D3ZG52|DNA2_RAT DNA replication ATP-dependent helicase/nuclease DNA2 OS=Rattus norvegicus GN=Dna2 PE=3 SV=1 1319 1700 2.0E-26
sp|P51530|DNA2_HUMAN DNA replication ATP-dependent helicase/nuclease DNA2 OS=Homo sapiens GN=DNA2 PE=1 SV=3 1319 1700 8.0E-26
sp|Q9BYK8|HELZ2_HUMAN Helicase with zinc finger domain 2 OS=Homo sapiens GN=HELZ2 PE=1 SV=6 1230 1731 2.0E-25
sp|Q6ZQJ5|DNA2_MOUSE DNA replication ATP-dependent helicase/nuclease DNA2 OS=Mus musculus GN=Dna2 PE=1 SV=2 1319 1700 7.0E-25
sp|Q5ZKG3|DNA2_CHICK DNA replication ATP-dependent helicase/nuclease DNA2 OS=Gallus gallus GN=DNA2 PE=2 SV=2 1319 1715 1.0E-24
sp|Q8QHA5|DNA2_XENLA DNA replication ATP-dependent helicase/nuclease DNA2 OS=Xenopus laevis GN=dna2 PE=1 SV=1 1319 1695 1.0E-24
sp|Q8GYD9|SDE3_ARATH Probable RNA helicase SDE3 OS=Arabidopsis thaliana GN=SDE3 PE=1 SV=1 1338 1740 3.0E-24
sp|Q1LXK4|M10B1_DANRE Putative helicase mov-10-B.1 OS=Danio rerio GN=mov10b.1 PE=2 SV=2 1207 1727 2.0E-23
sp|P38859|DNA2_YEAST DNA replication ATP-dependent helicase/nuclease DNA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNA2 PE=1 SV=1 1297 1695 2.0E-22
sp|E9QAM5|HELZ2_MOUSE Helicase with zinc finger domain 2 OS=Mus musculus GN=Helz2 PE=1 SV=1 1315 1730 8.0E-22
sp|Q1LXK5|M10B2_DANRE Putative helicase mov-10-B.2 OS=Danio rerio GN=mov10b.2 PE=3 SV=1 1338 1729 5.0E-20
sp|Q6J5K9|ARMI_DROME Probable RNA helicase armi OS=Drosophila melanogaster GN=armi PE=1 SV=4 1319 1724 6.0E-19
sp|Q99MV5|M10L1_MOUSE Putative helicase Mov10l1 OS=Mus musculus GN=Mov10l1 PE=1 SV=1 1319 1724 1.0E-18
sp|Q9P2E3|ZNFX1_HUMAN NFX1-type zinc finger-containing protein 1 OS=Homo sapiens GN=ZNFX1 PE=2 SV=2 1466 1750 1.0E-18
sp|Q9BXT6|M10L1_HUMAN Putative helicase Mov10l1 OS=Homo sapiens GN=MOV10L1 PE=2 SV=1 1319 1743 1.0E-18
sp|Q9HCE1|MOV10_HUMAN Putative helicase MOV-10 OS=Homo sapiens GN=MOV10 PE=1 SV=2 1338 1720 4.0E-18
sp|P23249|MOV10_MOUSE Putative helicase MOV-10 OS=Mus musculus GN=Mov10 PE=1 SV=2 1338 1737 9.0E-18
sp|Q8R151|ZNFX1_MOUSE NFX1-type zinc finger-containing protein 1 OS=Mus musculus GN=Znfx1 PE=1 SV=3 1466 1711 1.0E-17
sp|Q6DFV5|HELZ_MOUSE Probable helicase with zinc finger domain OS=Mus musculus GN=Helz PE=1 SV=2 1317 1710 9.0E-17
sp|P42694|HELZ_HUMAN Probable helicase with zinc finger domain OS=Homo sapiens GN=HELZ PE=1 SV=2 1317 1710 1.0E-16
sp|Q6NYU2|HELZ_DANRE Probable helicase with zinc finger domain OS=Danio rerio GN=helz PE=2 SV=1 1317 1710 1.0E-16
sp|Q5ZKD7|MOV10_CHICK Putative helicase MOV-10 OS=Gallus gallus GN=MOV10 PE=2 SV=1 1338 1710 4.0E-16
sp|Q9BYK8|HELZ2_HUMAN Helicase with zinc finger domain 2 OS=Homo sapiens GN=HELZ2 PE=1 SV=6 1320 1716 1.0E-14
sp|Q0V8H6|MOV10_BOVIN Putative helicase MOV-10 OS=Bos taurus GN=MOV10 PE=2 SV=1 1338 1720 4.0E-14
sp|E9QAM5|HELZ2_MOUSE Helicase with zinc finger domain 2 OS=Mus musculus GN=Helz2 PE=1 SV=1 1338 1713 1.0E-13
sp|F6QXW0|DNA2_XENTR DNA replication ATP-dependent helicase/nuclease DNA2 OS=Xenopus tropicalis GN=dna2 PE=3 SV=1 1319 1695 1.0E-13
sp|B6SFA4|MAA3_ARATH Probable helicase MAGATAMA 3 OS=Arabidopsis thaliana GN=MAA3 PE=2 SV=1 1107 1359 3.0E-13
sp|Q09449|YQ12_CAEEL Uncharacterized ATP-dependent helicase C05C10.2 OS=Caenorhabditis elegans GN=C05C10.2 PE=3 SV=1 1471 1711 7.0E-13
sp|O74465|HRR1_SCHPO Helicase required for RNAi-mediated heterochromatin assembly 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrr1 PE=1 SV=2 1418 1703 7.0E-10
sp|Q86AS0|Y4399_DICDI Probable helicase DDB_G0274399 OS=Dictyostelium discoideum GN=DDB_G0274399 PE=3 SV=1 1268 1464 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004386 helicase activity Yes
GO:0003824 catalytic activity No
GO:0140657 ATP-dependent activity No
GO:0003674 molecular_function No
GO:0140640 catalytic activity, acting on a nucleic acid No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7396
MAEINEELALWFEKYKKIAPGCHLLCAKVNDQDDEDYKSPNEPSSHLSTSEKQKRIAQGDERIETTYWNSLIFGF
SKEDAGKWLDDFTRQLELSLEQCSECVLNWHMKRSKYIRKFTERWDEETATHFEGILERLDIARIDKNLAWIKDY
MEKIEARGIVFKKSQLGENLTRVLITVYEALCCVAYIATPEQRKLFQYVFMRMQGKSYLKLGAKDPLPGMTFFLF
DAKFEDRFKWAMENWKCIPNDSMTDEQFDWAVSAGLVKGINEISKIDPLQATSEAYLEIQSFWQGIECILPALTG
SLVLSRLRSLQVRPGSPDLYDLLFRHIQFCRSEGVLVVAIRVLSALLVKSPKAIWDVVGDARPNVITDLLFGSPV
YKVLLQQSLQDCWYGPEHGPNHMVPFSTCWIQPWLQSLNRDRMYDACEVLMHTLFETLAKDTSIGEAGQAACIRA
GFDALSFTIKSFLVSKTSIAPPTTHLYASAAFNLVVKHRDLILANMRAPRQSHEGPEGWTTFKLADAAKAVLDAA
MRLEMSLISEEYMACLDVKDIQSTVTRSSQAYWECIIEMLDMSRDRVGLAKDILSCLEPLISIEQIRPTKKSNKL
DASSQRFNTLLQGVSTALGKILVRVSEFDSAELDTLFADRCSFQALIGLSVNSEPDLAEAAVEVLKTWTSELSRD
SALEYMTQHHTEQTLSCMIWTMDRIVKEPWPWGSIRPLRNTSSAVLRGLADPSLGVLRTSSVDGKLGATILRWWH
EQWRFISMSCTHLEFWSSYISNTIMTDFCREIMELAEQLIAEDGLLASTTAQGRSEQEAMIRILRPAKDNFQGME
NMIRLKDRYLVDVTVRVLCKILSRLKDNHLDINAHSRRLIIDACVMGPTGKYERLTNLLDHQRAELLQALGYEED
IEVVKVGAAPGGVAKEKAKKQSKLDAWSKSGLTETSVSATRPRGSNRDDVLELSRSADSSIVKQIARRQAQGKAS
SLKASPKVPDVKAINALKESRQREKAERARRDAEAIARARQLRGENVGDGGKLTKSEIMVNSDDESEQDGDEDDE
EEDMDDQLAALSTGGQAGLDEEQKRRQLALQGQLRRPVKKIRQVRSAKDMRARLVPSMERLHNTVLSWDLFHQGN
EPPNGPVASKVEGKYSDPKSYQATFFPLLAWEAWRSFVTSKEETTSGAFSMKIVSRATVDSFVEATFAVPFSESR
ERGFGEGDILLVSQDEKPLANGEAKHCLGRVHRMTHKKELVEITYQVSSRGNALTQELRPGAVVHGIKITNMTTI
EREYAALESLQHYDLMEEILKAEASPILSYGEQKVKETMGTWDLNKAQALAVLGANENDGFTLIQGPPGTGKTKT
IVAMVGALLSEQLKQAGALKLLGGDVTLDELADREQLHQEAGRIREELKMLRPRLEETRGGEERGAHNSLWRQFE
ELKRQQMQVGKQIEASRDSGNSVLCATLSGSGHEMLRKLDVEFERVIIDEAAQCVELSALIPLKYGCCRCILVGD
PKQLPPTVLSQSAARFGYDQSLFYRMHPAISAFASREFYEGQLRDGPGMASLRRRPWHQSQLLAPYRFFHVAGAE
TRGRRGQSLVNTHELAAALQLYHCFASNYGECDVPGTIGIITPYKAQLAELKARFKARYGDGIVDKIEFNTTDAF
QGRECEIIILSCVRASPTGGIGFMTDIRRMNVGLTRAKSSLWILGDARALVQGEFWRKLLHDAQARRCYTTGDIV
ALLRQPLQQATDAEGDVSMGGTSLPLPPVNDDDAAHKPLDGQVLPPSQVLPPSQVLPPSQVLPAHCASRPLENLQ
PPKRLVQDLQPPKRLLENHLQPPKRPLENPPPAAAQPAAKKLAQHKPRGLSAKFAPKAPRPPAAPQDPSALAVLG
LTPPERPRALTPPLPNQPSSNLPAAGNVVQQRDGPLVRKKKAKPSVFLPKKR*
Coding >OphauB2|7396
ATGGCAGAGATCAACGAAGAGTTGGCCCTGTGGTTCGAAAAGTACAAAAAGATAGCGCCCGGGTGTCATCTGCTT
TGCGCCAAGGTTAACGACCAAGACGACGAAGACTACAAGTCACCCAACGAGCCTTCGTCTCATCTGTCCACCTCT
GAGAAGCAGAAGCGAATTGCTCAAGGCGACGAGCGCATTGAAACGACTTACTGGAACAGCCTCATCTTTGGCTTC
AGTAAGGAAGATGCTGGCAAGTGGCTCGACGACTTTACGCGGCAGCTCGAACTGTCCCTCGAGCAGTGCTCCGAG
TGCGTGCTCAATTGGCACATGAAGCGCAGCAAGTACATACGCAAATTCACCGAGCGGTGGGATGAAGAAACAGCA
ACCCATTTTGAGGGCATCCTTGAGCGGCTTGATATTGCCCGCATAGACAAGAACCTTGCCTGGATTAAAGATTAC
ATGGAAAAAATCGAGGCCAGAGGCATCGTCTTCAAAAAATCTCAGCTCGGAGAGAATCTAACAAGGGTGCTCATC
ACAGTCTACGAGGCCCTGTGTTGTGTTGCCTATATTGCCACCCCAGAGCAGCGAAAGCTCTTCCAATATGTCTTT
ATGCGCATGCAGGGCAAAAGCTACCTCAAGCTTGGGGCCAAAGATCCCTTGCCCGGCATGACGTTTTTTCTCTTT
GATGCAAAGTTTGAGGACCGCTTCAAATGGGCCATGGAGAACTGGAAGTGCATTCCCAATGACTCCATGACGGAT
GAGCAGTTTGACTGGGCAGTCAGTGCCGGCCTGGTCAAAGGTATCAACGAAATCAGCAAGATCGATCCTTTGCAA
GCCACGAGCGAGGCCTATCTGGAAATTCAGTCATTTTGGCAAGGTATCGAGTGCATTCTGCCAGCCCTGACTGGC
AGTCTCGTTCTCAGCCGCTTGCGAAGCCTCCAAGTGCGTCCTGGCAGTCCTGACCTATACGACTTGCTCTTTCGC
CATATACAATTTTGTCGCTCAGAGGGCGTCTTGGTAGTAGCCATTCGAGTTCTGTCGGCCTTGCTCGTAAAGTCG
CCCAAGGCCATCTGGGACGTGGTGGGAGACGCAAGACCAAACGTGATTACAGATTTGCTCTTTGGGAGCCCAGTT
TACAAGGTGCTGCTCCAGCAATCACTCCAGGACTGTTGGTATGGCCCCGAGCACGGCCCCAATCACATGGTGCCC
TTTTCCACTTGCTGGATCCAACCCTGGCTGCAGTCGTTGAATCGTGACCGCATGTACGACGCTTGCGAGGTCTTG
ATGCATACTTTGTTCGAGACGCTTGCCAAGGACACGTCGATTGGCGAAGCAGGCCAAGCTGCCTGTATCCGTGCC
GGCTTTGATGCCTTGAGCTTTACCATCAAGTCATTTCTCGTGTCCAAGACGAGCATTGCGCCACCCACGACGCAC
CTGTACGCCAGCGCTGCTTTCAACTTGGTTGTCAAACACAGAGACCTTATTCTTGCAAACATGAGAGCGCCGCGC
CAGAGTCACGAGGGCCCCGAGGGCTGGACCACTTTCAAGCTTGCCGACGCGGCCAAGGCTGTGCTGGATGCGGCC
ATGAGGCTGGAGATGAGTCTCATCTCGGAGGAGTACATGGCATGTCTGGACGTCAAGGACATCCAGTCGACAGTA
ACCAGGAGCTCACAGGCGTACTGGGAATGCATCATTGAGATGCTCGACATGTCGCGAGACCGAGTAGGGCTGGCC
AAAGACATCTTGTCATGTCTTGAGCCCCTCATTTCCATTGAGCAGATTCGGCCGACCAAGAAGAGCAACAAGCTT
GATGCAAGCAGCCAGCGCTTCAACACTCTGCTTCAGGGGGTTAGCACTGCTCTGGGCAAGATTCTGGTCCGTGTC
TCCGAGTTTGACAGTGCTGAGCTGGACACGCTATTCGCAGATCGATGCTCGTTCCAGGCTCTCATTGGACTGTCG
GTGAATAGCGAGCCGGATCTGGCAGAGGCAGCGGTCGAGGTGCTCAAGACGTGGACGAGCGAACTATCGCGAGAC
TCGGCGCTTGAATACATGACGCAACACCACACGGAGCAGACTCTGTCTTGCATGATTTGGACCATGGATCGCATT
GTAAAGGAGCCGTGGCCGTGGGGCTCCATTAGACCACTGAGAAACACGAGCAGCGCAGTGCTCCGAGGCCTCGCA
GACCCTAGTCTGGGAGTCTTGCGGACATCGTCTGTTGATGGCAAGCTGGGAGCAACCATTTTGCGATGGTGGCAT
GAACAGTGGCGCTTCATCTCCATGTCTTGCACGCACCTTGAGTTCTGGTCGTCGTACATATCAAACACCATTATG
ACAGACTTTTGTCGGGAAATCATGGAGCTGGCAGAGCAGCTCATTGCCGAGGACGGCCTGCTTGCCTCGACGACT
GCCCAGGGACGAAGCGAACAGGAGGCCATGATTAGAATCCTCAGGCCAGCAAAGGACAACTTTCAAGGCATGGAA
AACATGATTCGCCTCAAGGACCGTTATCTGGTTGACGTGACAGTTCGCGTGCTCTGCAAGATTCTGTCTCGGCTC
AAGGACAATCATCTTGACATCAATGCTCACTCGCGGCGACTTATTATTGACGCTTGCGTCATGGGACCCACGGGG
AAATACGAGAGGCTGACAAACCTGTTGGACCATCAACGGGCGGAGCTTCTGCAAGCATTGGGCTATGAAGAAGAC
ATTGAGGTGGTCAAGGTTGGTGCGGCGCCAGGGGGCGTGGCCAAGGAAAAGGCAAAGAAGCAAAGCAAACTCGAC
GCCTGGTCCAAGTCGGGGCTAACAGAAACGTCTGTATCGGCGACGAGGCCAAGAGGAAGCAATCGCGACGATGTT
TTGGAGCTGAGCAGGTCGGCAGATAGCAGCATTGTTAAGCAGATTGCGAGGCGTCAAGCTCAGGGCAAGGCTTCG
TCGCTTAAAGCAAGCCCCAAGGTGCCGGATGTCAAGGCAATCAATGCACTCAAGGAGAGCAGACAACGAGAAAAG
GCAGAAAGAGCAAGAAGAGATGCCGAGGCGATTGCCAGGGCCAGACAGCTGCGAGGAGAGAATGTGGGGGATGGC
GGCAAGCTGACCAAGAGCGAAATCATGGTGAACTCTGACGACGAGTCTGAGCAAGATGGCGACGAGGATGACGAG
GAGGAGGACATGGATGACCAGCTTGCTGCTCTAAGCACTGGAGGGCAGGCAGGACTAGACGAAGAGCAGAAGCGC
AGGCAGCTGGCGCTGCAGGGCCAGCTTAGAAGACCAGTCAAGAAGATTCGACAAGTACGGTCGGCCAAGGACATG
AGGGCACGTCTTGTACCATCGATGGAGAGACTACACAATACGGTGCTCTCGTGGGACCTGTTCCACCAGGGCAAT
GAGCCGCCAAATGGGCCGGTGGCCAGCAAGGTGGAAGGGAAATATTCGGATCCCAAGTCTTACCAGGCAACATTT
TTCCCGCTGCTTGCCTGGGAGGCGTGGCGATCTTTTGTCACGTCAAAGGAGGAGACAACGTCTGGGGCGTTTAGC
ATGAAGATTGTCAGCCGTGCAACGGTGGACAGCTTTGTGGAGGCGACGTTTGCAGTGCCGTTTAGCGAGAGCCGT
GAGCGAGGATTTGGCGAGGGGGACATATTGCTTGTGTCTCAAGATGAGAAGCCACTGGCGAATGGCGAGGCCAAG
CACTGCCTGGGGCGAGTTCACCGCATGACGCACAAGAAGGAGCTGGTGGAAATCACATACCAAGTGTCTAGTCGC
GGCAATGCGCTGACGCAAGAGCTTAGGCCGGGGGCGGTGGTGCACGGCATCAAAATCACAAACATGACGACGATT
GAGCGCGAGTATGCGGCACTGGAAAGCCTGCAACATTACGACTTGATGGAGGAGATTCTCAAGGCGGAAGCGTCG
CCGATTTTGAGCTACGGGGAGCAAAAGGTGAAGGAGACGATGGGGACATGGGATCTCAACAAGGCGCAGGCGTTG
GCGGTTCTGGGGGCGAATGAGAATGACGGCTTCACGCTGATCCAGGGACCGCCGGGGACAGGCAAGACCAAGACG
ATTGTGGCCATGGTGGGGGCGCTCTTGTCGGAGCAGCTCAAGCAGGCGGGGGCTCTGAAGCTGCTGGGCGGGGAC
GTGACGCTGGACGAGCTGGCGGACCGGGAGCAGCTGCACCAAGAGGCGGGGCGGATCCGCGAGGAGCTCAAGATG
CTTCGGCCGCGGCTGGAGGAGACGCGGGGGGGGGAGGAGCGGGGGGCGCACAACAGCCTGTGGCGGCAGTTTGAG
GAGCTGAAGCGGCAGCAGATGCAGGTGGGCAAGCAGATTGAGGCGAGTCGCGACAGCGGCAACTCGGTGCTGTGC
GCGACGCTGAGCGGCAGCGGGCACGAGATGCTGCGCAAGCTCGACGTGGAGTTTGAGCGCGTCATTATCGACGAG
GCGGCGCAGTGCGTGGAGCTGAGCGCGCTGATTCCGCTCAAGTACGGCTGCTGCCGCTGCATTTTGGTGGGGGAT
CCCAAGCAGCTGCCTCCGACGGTGCTGTCGCAGTCGGCGGCGCGCTTTGGCTACGACCAGAGTCTGTTTTACCGC
ATGCACCCGGCCATCAGCGCCTTTGCCAGCCGCGAGTTCTACGAGGGACAGCTGCGAGACGGGCCGGGAATGGCG
AGCCTGCGGCGACGGCCCTGGCACCAGAGCCAGCTGCTGGCGCCCTACCGCTTCTTCCACGTGGCGGGCGCTGAG
ACGCGTGGGCGCCGCGGCCAGTCGCTGGTGAATACGCACGAGCTGGCGGCGGCTCTGCAGCTCTACCACTGCTTC
GCCTCCAACTATGGCGAGTGCGACGTGCCCGGCACCATTGGCATCATCACGCCCTACAAGGCGCAGCTGGCGGAG
CTCAAGGCGCGCTTCAAGGCACGCTACGGCGACGGCATTGTCGACAAGATTGAGTTCAACACGACGGATGCCTTT
CAGGGCCGCGAGTGCGAAATCATCATACTGTCGTGTGTCCGCGCCAGCCCCACGGGCGGCATTGGCTTCATGACG
GACATTCGCCGCATGAATGTCGGCCTGACGCGCGCCAAGTCGTCGCTGTGGATTCTTGGCGACGCCCGCGCTCTT
GTCCAGGGCGAATTTTGGCGCAAGCTGCTGCACGACGCCCAGGCCCGCCGCTGCTACACCACGGGCGACATTGTT
GCTCTGCTGCGCCAGCCGCTGCAGCAGGCCACGGATGCCGAGGGCGATGTGTCGATGGGCGGCACCAGCCTGCCA
TTGCCGCCTGTCAACGACGACGACGCCGCCCACAAGCCCCTTGATGGCCAGGTGCTGCCTCCTAGCCAGGTGCTG
CCTCCTAGCCAGGTGCTGCCTCCTAGCCAGGTGCTGCCAGCGCATTGTGCTAGTCGGCCCCTCGAAAACTTGCAG
CCGCCCAAGCGACTTGTCCAAGACTTGCAGCCGCCCAAGCGACTCCTCGAAAACCATTTGCAGCCGCCCAAACGG
CCCCTCGAAAACCCGCCGCCTGCCGCCGCCCAGCCTGCGGCAAAAAAGCTGGCCCAGCACAAGCCGCGCGGGCTG
TCAGCCAAGTTTGCGCCAAAGGCCCCCAGGCCTCCAGCTGCGCCCCAGGACCCTTCAGCCTTGGCAGTCCTGGGA
CTGACGCCCCCTGAGAGACCTCGTGCCTTGACACCTCCATTGCCCAACCAGCCTTCGTCGAATCTGCCAGCTGCA
GGCAACGTGGTGCAGCAGCGAGACGGGCCCCTTGTGCGCAAGAAAAAGGCCAAGCCAAGTGTGTTTTTGCCCAAG
AAGCGCTAG
Transcript >OphauB2|7396
ATGGCAGAGATCAACGAAGAGTTGGCCCTGTGGTTCGAAAAGTACAAAAAGATAGCGCCCGGGTGTCATCTGCTT
TGCGCCAAGGTTAACGACCAAGACGACGAAGACTACAAGTCACCCAACGAGCCTTCGTCTCATCTGTCCACCTCT
GAGAAGCAGAAGCGAATTGCTCAAGGCGACGAGCGCATTGAAACGACTTACTGGAACAGCCTCATCTTTGGCTTC
AGTAAGGAAGATGCTGGCAAGTGGCTCGACGACTTTACGCGGCAGCTCGAACTGTCCCTCGAGCAGTGCTCCGAG
TGCGTGCTCAATTGGCACATGAAGCGCAGCAAGTACATACGCAAATTCACCGAGCGGTGGGATGAAGAAACAGCA
ACCCATTTTGAGGGCATCCTTGAGCGGCTTGATATTGCCCGCATAGACAAGAACCTTGCCTGGATTAAAGATTAC
ATGGAAAAAATCGAGGCCAGAGGCATCGTCTTCAAAAAATCTCAGCTCGGAGAGAATCTAACAAGGGTGCTCATC
ACAGTCTACGAGGCCCTGTGTTGTGTTGCCTATATTGCCACCCCAGAGCAGCGAAAGCTCTTCCAATATGTCTTT
ATGCGCATGCAGGGCAAAAGCTACCTCAAGCTTGGGGCCAAAGATCCCTTGCCCGGCATGACGTTTTTTCTCTTT
GATGCAAAGTTTGAGGACCGCTTCAAATGGGCCATGGAGAACTGGAAGTGCATTCCCAATGACTCCATGACGGAT
GAGCAGTTTGACTGGGCAGTCAGTGCCGGCCTGGTCAAAGGTATCAACGAAATCAGCAAGATCGATCCTTTGCAA
GCCACGAGCGAGGCCTATCTGGAAATTCAGTCATTTTGGCAAGGTATCGAGTGCATTCTGCCAGCCCTGACTGGC
AGTCTCGTTCTCAGCCGCTTGCGAAGCCTCCAAGTGCGTCCTGGCAGTCCTGACCTATACGACTTGCTCTTTCGC
CATATACAATTTTGTCGCTCAGAGGGCGTCTTGGTAGTAGCCATTCGAGTTCTGTCGGCCTTGCTCGTAAAGTCG
CCCAAGGCCATCTGGGACGTGGTGGGAGACGCAAGACCAAACGTGATTACAGATTTGCTCTTTGGGAGCCCAGTT
TACAAGGTGCTGCTCCAGCAATCACTCCAGGACTGTTGGTATGGCCCCGAGCACGGCCCCAATCACATGGTGCCC
TTTTCCACTTGCTGGATCCAACCCTGGCTGCAGTCGTTGAATCGTGACCGCATGTACGACGCTTGCGAGGTCTTG
ATGCATACTTTGTTCGAGACGCTTGCCAAGGACACGTCGATTGGCGAAGCAGGCCAAGCTGCCTGTATCCGTGCC
GGCTTTGATGCCTTGAGCTTTACCATCAAGTCATTTCTCGTGTCCAAGACGAGCATTGCGCCACCCACGACGCAC
CTGTACGCCAGCGCTGCTTTCAACTTGGTTGTCAAACACAGAGACCTTATTCTTGCAAACATGAGAGCGCCGCGC
CAGAGTCACGAGGGCCCCGAGGGCTGGACCACTTTCAAGCTTGCCGACGCGGCCAAGGCTGTGCTGGATGCGGCC
ATGAGGCTGGAGATGAGTCTCATCTCGGAGGAGTACATGGCATGTCTGGACGTCAAGGACATCCAGTCGACAGTA
ACCAGGAGCTCACAGGCGTACTGGGAATGCATCATTGAGATGCTCGACATGTCGCGAGACCGAGTAGGGCTGGCC
AAAGACATCTTGTCATGTCTTGAGCCCCTCATTTCCATTGAGCAGATTCGGCCGACCAAGAAGAGCAACAAGCTT
GATGCAAGCAGCCAGCGCTTCAACACTCTGCTTCAGGGGGTTAGCACTGCTCTGGGCAAGATTCTGGTCCGTGTC
TCCGAGTTTGACAGTGCTGAGCTGGACACGCTATTCGCAGATCGATGCTCGTTCCAGGCTCTCATTGGACTGTCG
GTGAATAGCGAGCCGGATCTGGCAGAGGCAGCGGTCGAGGTGCTCAAGACGTGGACGAGCGAACTATCGCGAGAC
TCGGCGCTTGAATACATGACGCAACACCACACGGAGCAGACTCTGTCTTGCATGATTTGGACCATGGATCGCATT
GTAAAGGAGCCGTGGCCGTGGGGCTCCATTAGACCACTGAGAAACACGAGCAGCGCAGTGCTCCGAGGCCTCGCA
GACCCTAGTCTGGGAGTCTTGCGGACATCGTCTGTTGATGGCAAGCTGGGAGCAACCATTTTGCGATGGTGGCAT
GAACAGTGGCGCTTCATCTCCATGTCTTGCACGCACCTTGAGTTCTGGTCGTCGTACATATCAAACACCATTATG
ACAGACTTTTGTCGGGAAATCATGGAGCTGGCAGAGCAGCTCATTGCCGAGGACGGCCTGCTTGCCTCGACGACT
GCCCAGGGACGAAGCGAACAGGAGGCCATGATTAGAATCCTCAGGCCAGCAAAGGACAACTTTCAAGGCATGGAA
AACATGATTCGCCTCAAGGACCGTTATCTGGTTGACGTGACAGTTCGCGTGCTCTGCAAGATTCTGTCTCGGCTC
AAGGACAATCATCTTGACATCAATGCTCACTCGCGGCGACTTATTATTGACGCTTGCGTCATGGGACCCACGGGG
AAATACGAGAGGCTGACAAACCTGTTGGACCATCAACGGGCGGAGCTTCTGCAAGCATTGGGCTATGAAGAAGAC
ATTGAGGTGGTCAAGGTTGGTGCGGCGCCAGGGGGCGTGGCCAAGGAAAAGGCAAAGAAGCAAAGCAAACTCGAC
GCCTGGTCCAAGTCGGGGCTAACAGAAACGTCTGTATCGGCGACGAGGCCAAGAGGAAGCAATCGCGACGATGTT
TTGGAGCTGAGCAGGTCGGCAGATAGCAGCATTGTTAAGCAGATTGCGAGGCGTCAAGCTCAGGGCAAGGCTTCG
TCGCTTAAAGCAAGCCCCAAGGTGCCGGATGTCAAGGCAATCAATGCACTCAAGGAGAGCAGACAACGAGAAAAG
GCAGAAAGAGCAAGAAGAGATGCCGAGGCGATTGCCAGGGCCAGACAGCTGCGAGGAGAGAATGTGGGGGATGGC
GGCAAGCTGACCAAGAGCGAAATCATGGTGAACTCTGACGACGAGTCTGAGCAAGATGGCGACGAGGATGACGAG
GAGGAGGACATGGATGACCAGCTTGCTGCTCTAAGCACTGGAGGGCAGGCAGGACTAGACGAAGAGCAGAAGCGC
AGGCAGCTGGCGCTGCAGGGCCAGCTTAGAAGACCAGTCAAGAAGATTCGACAAGTACGGTCGGCCAAGGACATG
AGGGCACGTCTTGTACCATCGATGGAGAGACTACACAATACGGTGCTCTCGTGGGACCTGTTCCACCAGGGCAAT
GAGCCGCCAAATGGGCCGGTGGCCAGCAAGGTGGAAGGGAAATATTCGGATCCCAAGTCTTACCAGGCAACATTT
TTCCCGCTGCTTGCCTGGGAGGCGTGGCGATCTTTTGTCACGTCAAAGGAGGAGACAACGTCTGGGGCGTTTAGC
ATGAAGATTGTCAGCCGTGCAACGGTGGACAGCTTTGTGGAGGCGACGTTTGCAGTGCCGTTTAGCGAGAGCCGT
GAGCGAGGATTTGGCGAGGGGGACATATTGCTTGTGTCTCAAGATGAGAAGCCACTGGCGAATGGCGAGGCCAAG
CACTGCCTGGGGCGAGTTCACCGCATGACGCACAAGAAGGAGCTGGTGGAAATCACATACCAAGTGTCTAGTCGC
GGCAATGCGCTGACGCAAGAGCTTAGGCCGGGGGCGGTGGTGCACGGCATCAAAATCACAAACATGACGACGATT
GAGCGCGAGTATGCGGCACTGGAAAGCCTGCAACATTACGACTTGATGGAGGAGATTCTCAAGGCGGAAGCGTCG
CCGATTTTGAGCTACGGGGAGCAAAAGGTGAAGGAGACGATGGGGACATGGGATCTCAACAAGGCGCAGGCGTTG
GCGGTTCTGGGGGCGAATGAGAATGACGGCTTCACGCTGATCCAGGGACCGCCGGGGACAGGCAAGACCAAGACG
ATTGTGGCCATGGTGGGGGCGCTCTTGTCGGAGCAGCTCAAGCAGGCGGGGGCTCTGAAGCTGCTGGGCGGGGAC
GTGACGCTGGACGAGCTGGCGGACCGGGAGCAGCTGCACCAAGAGGCGGGGCGGATCCGCGAGGAGCTCAAGATG
CTTCGGCCGCGGCTGGAGGAGACGCGGGGGGGGGAGGAGCGGGGGGCGCACAACAGCCTGTGGCGGCAGTTTGAG
GAGCTGAAGCGGCAGCAGATGCAGGTGGGCAAGCAGATTGAGGCGAGTCGCGACAGCGGCAACTCGGTGCTGTGC
GCGACGCTGAGCGGCAGCGGGCACGAGATGCTGCGCAAGCTCGACGTGGAGTTTGAGCGCGTCATTATCGACGAG
GCGGCGCAGTGCGTGGAGCTGAGCGCGCTGATTCCGCTCAAGTACGGCTGCTGCCGCTGCATTTTGGTGGGGGAT
CCCAAGCAGCTGCCTCCGACGGTGCTGTCGCAGTCGGCGGCGCGCTTTGGCTACGACCAGAGTCTGTTTTACCGC
ATGCACCCGGCCATCAGCGCCTTTGCCAGCCGCGAGTTCTACGAGGGACAGCTGCGAGACGGGCCGGGAATGGCG
AGCCTGCGGCGACGGCCCTGGCACCAGAGCCAGCTGCTGGCGCCCTACCGCTTCTTCCACGTGGCGGGCGCTGAG
ACGCGTGGGCGCCGCGGCCAGTCGCTGGTGAATACGCACGAGCTGGCGGCGGCTCTGCAGCTCTACCACTGCTTC
GCCTCCAACTATGGCGAGTGCGACGTGCCCGGCACCATTGGCATCATCACGCCCTACAAGGCGCAGCTGGCGGAG
CTCAAGGCGCGCTTCAAGGCACGCTACGGCGACGGCATTGTCGACAAGATTGAGTTCAACACGACGGATGCCTTT
CAGGGCCGCGAGTGCGAAATCATCATACTGTCGTGTGTCCGCGCCAGCCCCACGGGCGGCATTGGCTTCATGACG
GACATTCGCCGCATGAATGTCGGCCTGACGCGCGCCAAGTCGTCGCTGTGGATTCTTGGCGACGCCCGCGCTCTT
GTCCAGGGCGAATTTTGGCGCAAGCTGCTGCACGACGCCCAGGCCCGCCGCTGCTACACCACGGGCGACATTGTT
GCTCTGCTGCGCCAGCCGCTGCAGCAGGCCACGGATGCCGAGGGCGATGTGTCGATGGGCGGCACCAGCCTGCCA
TTGCCGCCTGTCAACGACGACGACGCCGCCCACAAGCCCCTTGATGGCCAGGTGCTGCCTCCTAGCCAGGTGCTG
CCTCCTAGCCAGGTGCTGCCTCCTAGCCAGGTGCTGCCAGCGCATTGTGCTAGTCGGCCCCTCGAAAACTTGCAG
CCGCCCAAGCGACTTGTCCAAGACTTGCAGCCGCCCAAGCGACTCCTCGAAAACCATTTGCAGCCGCCCAAACGG
CCCCTCGAAAACCCGCCGCCTGCCGCCGCCCAGCCTGCGGCAAAAAAGCTGGCCCAGCACAAGCCGCGCGGGCTG
TCAGCCAAGTTTGCGCCAAAGGCCCCCAGGCCTCCAGCTGCGCCCCAGGACCCTTCAGCCTTGGCAGTCCTGGGA
CTGACGCCCCCTGAGAGACCTCGTGCCTTGACACCTCCATTGCCCAACCAGCCTTCGTCGAATCTGCCAGCTGCA
GGCAACGTGGTGCAGCAGCGAGACGGGCCCCTTGTGCGCAAGAAAAAGGCCAAGCCAAGTGTGTTTTTGCCCAAG
AAGCGCTAG
Gene >OphauB2|7396
ATGGCAGAGATCAACGAAGAGTTGGCCCTGTGGTTCGAAAAGTACAAAAAGATAGCGCCCGGGTGTCATCTGCTT
TGCGCCAAGGTTAACGACCAAGACGACGAAGACTACAAGTCACCCAACGAGCCTTCGTCTCATCTGTCCACCTCT
GAGAAGCAGAAGCGAATTGCTCAAGGCGACGAGCGCATTGAAACGACTTACTGGAACAGCCTCATCTTTGGCTTC
AGTAAGGAAGATGCTGGCAAGTGGCTCGACGACTTTACGCGGCAGCTCGAACTGTCCCTCGAGCAGTGCTCCGAG
TGCGTGCTCAATTGGCACATGAAGCGCAGCAAGTACATACGCAAATTCACCGAGTATGTTCTTACCATGGCCACG
CCACGCCATGCTTGATTTGTTGACGTGTCGTAGGCGGTGGGATGAAGAAACAGCAACCCATTTTGAGGGCATCCT
TGAGCGGCTTGATATTGCCCGCATAGACAAGAACCTTGCCTGGATTAAAGATTACATGGAAAAAATCGAGGCCAG
AGGCATCGTCTTCAAAAAATCTCAGCTCGGAGAGAATCTAACAAGGGTGCTCATCACAGTCTACGAGGCCCTGTG
TTGTGTTGCCTATATTGCCACCCCAGAGCAGCGAAAGCTCTTCCAATATGTCTTTATGCGCATGCAGGGCAAAAG
CTACCTCAAGCTTGGGGCCAAAGATCCCTTGCCCGGCATGACGTTTTTTCTCTTTGATGCAAAGTTTGAGGACCG
CTTCAAATGGGCCATGGAGAACTGGAAGTGCATTCCCAATGACTCCATGACGGATGAGCAGTTTGACTGGGCAGT
CAGTGCCGGCCTGGTCAAAGGTATCAACGAAATCAGCAAGATCGATCCTTTGCAAGCCACGAGCGAGGCCTATCT
GGAAATTCAGTCATTTTGGCAAGGTATCGAGTGCATTCTGCCAGCCCTGACTGGCAGTCTCGTTCTCAGCCGCTT
GCGAAGCCTCCAAGTGCGTCCTGGCAGTCCTGACCTATACGACTTGCTCTTTCGCCATATACAATTTTGTCGCTC
AGAGGGCGTCTTGGTAGTAGCCATTCGAGTTCTGTCGGCCTTGCTCGTAAAGTCGCCCAAGGCCATCTGGGACGT
GGTGGGAGACGCAAGACCAAACGTGATTACAGATTTGCTCTTTGGGAGCCCAGTTTACAAGGTGCTGCTCCAGCA
ATCACTCCAGGACTGTTGGTATGGCCCCGAGCACGGCCCCAATCACATGGTGCCCTTTTCCACTTGCTGGATCCA
ACCCTGGCTGCAGTCGTTGAATCGTGACCGCATGTACGACGCTTGCGAGGTCTTGATGCATACTTTGTTCGAGAC
GCTTGCCAAGGACACGTCGATTGGCGAAGCAGGCCAAGCTGCCTGTATCCGTGCCGGCTTTGATGCCTTGAGCTT
TACCATCAAGTCATTTCTCGTGTCCAAGACGAGCATTGCGCCACCCACGACGCACCTGTACGCCAGCGCTGCTTT
CAACTTGGTTGTCAAACACAGAGACCTTATTCTTGCAAACATGAGAGCGCCGCGCCAGAGTCACGAGGGCCCCGA
GGGCTGGACCACTTTCAAGCTTGCCGACGCGGCCAAGGCTGTGCTGGATGCGGCCATGAGGCTGGAGATGAGTCT
CATCTCGGAGGAGTACATGGCATGTCTGGACGTCAAGGACATCCAGTCGACAGTAACCAGGAGCTCACAGGCGTA
CTGGGAATGCATCATTGAGATGCTCGACATGTCGCGAGACCGAGTAGGGCTGGCCAAAGACATCTTGTCATGTCT
TGAGCCCCTCATTTCCATTGAGCAGATTCGGCCGACCAAGAAGAGCAACAAGCTTGATGCAAGCAGCCAGCGCTT
CAACACTCTGCTTCAGGGGGTTAGCACTGCTCTGGGCAAGATTCTGGTCCGTGTCTCCGAGTTTGACAGTGCTGA
GCTGGACACGCTATTCGCAGATCGATGCTCGTTCCAGGCTCTCATTGGACTGTCGGTGAATAGCGAGCCGGATCT
GGCAGAGGCAGCGGTCGAGGTGCTCAAGACGTGGACGAGCGAACTATCGCGAGACTCGGCGCTTGAATACATGAC
GCAACACCACACGGAGCAGACTCTGTCTTGCATGATTTGGACCATGGATCGCATTGTAAAGGAGCCGTGGCCGTG
GGGCTCCATTAGACCACTGAGAAACACGAGCAGCGCAGTGCTCCGAGGCCTCGCAGACCCTAGTCTGGGAGTCTT
GCGGACATCGTCTGTTGATGGCAAGCTGGGAGCAACCATTTTGCGATGGTGGCATGAACAGTGGCGCTTCATCTC
CATGTCTTGCACGCACCTTGAGTTCTGGTCGTCGTACATATCAAACACCATTATGACAGACTTTTGTCGGGAAAT
CATGGAGCTGGCAGAGCAGCTCATTGCCGAGGACGGCCTGCTTGCCTCGACGACTGCCCAGGGACGAAGCGAACA
GGAGGCCATGATTAGAATCCTCAGGCCAGCAAAGGACAACTTTCAAGGCATGGAAAACATGATTCGCCTCAAGGA
CCGTTATCTGGTTGACGTGACAGTTCGCGTGCTCTGCAAGATTCTGTCTCGGCTCAAGGACAATCATCTTGACAT
CAATGCTCACTCGCGGCGACTTATTATTGACGCTTGCGTCATGGGACCCACGGGGAAATACGAGAGGCTGACAAA
CCTGTTGGACCATCAACGGGCGGAGCTTCTGCAAGCATTGGGCTATGAAGAAGACATTGAGGTGGTCAAGGTTGG
TGCGGCGCCAGGGGGCGTGGCCAAGGAAAAGGCAAAGAAGCAAAGCAAACTCGACGCCTGGTCCAAGTCGGGGCT
AACAGAAACGTCTGTATCGGCGACGAGGCCAAGAGGAAGCAATCGCGACGATGTTTTGGAGCTGAGCAGGTCGGC
AGATAGCAGCATTGTTAAGCAGATTGCGAGGCGTCAAGCTCAGGGCAAGGCTTCGTCGCTTAAAGCAAGCCCCAA
GGTGCCGGATGTCAAGGCAATCAATGCACTCAAGGAGAGCAGACAACGAGAAAAGGCAGAAAGAGCAAGAAGAGA
TGCCGAGGCGATTGCCAGGGCCAGACAGCTGCGAGGAGAGAATGTGGGGGATGGCGGCAAGCTGACCAAGAGCGA
AATCATGGTGAACTCTGACGACGAGTCTGAGCAAGATGGCGACGAGGATGACGAGGAGGAGGACATGGATGACCA
GCTTGCTGCTCTAAGCACTGGAGGGCAGGCAGGACTAGACGAAGAGCAGAAGCGCAGGCAGCTGGCGCTGCAGGG
CCAGCTTAGAAGACCAGTCAAGAAGATTCGACAAGTACGGTCGGCCAAGGACATGAGGGCACGTCTTGTACCATC
GATGGAGAGACTACACAATACGGTGCTCTCGTGGGACCTGTTCCACCAGGGCAATGAGCCGCCAAATGGGCCGGT
GGCCAGCAAGGTGGAAGGGAAATATTCGGATCCCAAGTCTTACCAGGCAACATTTTTCCCGCTGCTTGCCTGGGA
GGCGTGGCGATCTTTTGTCACGTCAAAGGAGGAGACAACGTCTGGGGCGTTTAGCATGAAGATTGTCAGCCGTGC
AACGGTGGACAGCTTTGTGGAGGCGACGTTTGCAGTGCCGTTTAGCGAGAGCCGTGAGCGAGGATTTGGCGAGGG
GGACATATTGCTTGTGTCTCAAGATGAGAAGCCACTGGCGAATGGCGAGGCCAAGCACTGCCTGGGGCGAGTTCA
CCGCATGACGCACAAGAAGGAGCTGGTGGAAATCACATACCAAGTGTCTAGTCGCGGCAATGCGCTGACGCAAGA
GCTTAGGCCGGGGGCGGTGGTGCACGGCATCAAAATCACAAACATGACGACGATTGAGCGCGAGTATGCGGCACT
GGAAAGCCTGCAACATTACGACTTGATGGAGGAGATTCTCAAGGCGGAAGCGTCGCCGATTTTGAGCTACGGGGA
GCAAAAGGTGAAGGAGACGATGGGGACATGGGATCTCAACAAGGCGCAGGCGTTGGCGGTTCTGGGGGCGAATGA
GAATGACGGCTTCACGCTGATCCAGGGGTAAGTGAGTGGGTGGGGAGGTGACGGGGCAGAGAGCAAGGCTGACAG
GGGCAAAGACCGCCGGGGACAGGCAAGACCAAGACGATTGTGGCCATGGTGGGGGCGCTCTTGTCGGAGCAGCTC
AAGCAGGCGGGGGCTCTGGTGGGGGGAATGGGAGAGAAGGGGAGNNNNNNNNNGGGGGGGGGGGGGCAAGAAGCT
GCTGGTGTGCGCGCCGAGCAACGCAGCAGTGGACGAGCTGGTGCTGCGGCTCAAGGGCGGGGTGAGGACGAGTCA
GGGCAAGCAGCACAAGATCCAGGTGCTGCGGCTGGGACGGAGCGACGTGATCAATGCGGCAGTCAAGGACGTGAC
GCTGGACGAGCTGGTGCGGGCGCGGCTCGAGGGCGACACGACGCGGGAGCGGGCCAAGGCGGACCGGGAGCAGCT
GCACCAAGAGGCGGGGCGGATCCGCGAGGAGCTCAAGATGCTTCGGCCGCGGCTGGAGGAGACGCGGGGGGGGGA
GGAGCGGGGGGCGCACAACAGCCTGTGGCGGCAGTTTGAGGAGCTGAAGCGGCAGCAGATGCAGGTGGGCAAGCA
GATTGAGGCGAGTCGCGACAGCGGCAACTCGGTGGCGCGGGAGCTGGAGCTGGGGCGGCGGCGGGTGCAGCAGGA
GCTGCTGAATGGGGCGCAGGTGCTGTGCGCGACGCTGAGCGGCAGCGGGCACGAGATGCTGCGCAAGCTCGACGT
GGAGTTTGAGCGCGTCATTATCGACGAGGCGGCGCAGTGCGTGGAGCTGAGCGCGCTGATTCCGCTCAAGTACGG
CTGCTGCCGCTGCATTTTGGTGGGGGATCCCAAGCAGCTGCCTCCGACGGTGCTGTCGCAGTCGGCGGCGCGCTT
TGGCTACGACCAGAGTCTGTTTGTGCGCATGTACCAGAGCAACGCGGCGCGGGTGCACATGCTCAATACGCAGTA
CCGCATGCACCCGGCCATCAGCGCCTTTGCCAGCCGCGAGTTCTACGAGGGACAGCTGCGAGACGGGCCGGGAAT
GGCGAGCCTGCGGCGACGGCCCTGGCACCAGAGCCAGCTGCTGGCGCCCTACCGCTTCTTCCACGTGGCGGGCGC
TGAGACGCGTGGGCGCCGCGGCCAGTCGCTGGTGAATACGCACGAGCTGGCGGCGGCTCTGCAGCTCTACCACTG
CTTCGCCTCCAACTATGGCGAGTGCGACGTGCCCGGCACCATTGGCATCATCACGCCCTACAAGGCGCAGCTGGC
GGAGCTCAAGGCGCGCTTCAAGGCACGCTACGGCGACGGCATTGTCGACAAGATTGAGTTCAACACGACGGATGC
CTTTCAGGGCCGCGAGTGCGAAATCATCATACTGTCGTGTGTCCGCGCCAGCCCCACGGGCGGCATTGGCTTCAT
GACGGACATTCGCCGCATGAATGTCGGCCTGACGCGCGCCAAGTCGTCGCTGTGGATTCTTGGCGACGCCCGCGC
TCTTGTCCAGGGCGAATTTTGGCGCAAGCTGCTGCACGACGCCCAGGCCCGCCGCTGCTACACCACGGGCGACAT
TGTTGCTCTGCTGCGCCAGCCGCTGCAGCAGGCCACGGATGCCGAGGGCGATGTGTCGATGGGCGGCACCAGCCT
GCCATTGCCGCCTGTCAACGACGACGACGCCGCCCACAAGCCCCTTGATGGCCAGGTGCTGCCTCCTAGCCAGGT
GCTGCCTCCTAGCCAGGTGCTGCCTCCTAGCCAGGTGCTGCCAGCGCATTGTGCTAGTCGGCCCCTCGAAAACTT
GCAGCCGCCCAAGCGACTTGTCCAAGACTTGCAGCCGCCCAAGCGACTCCTCGAAAACCATTTGCAGCCGCCCAA
ACGGCCCCTCGAAAACCCGCCGCCTGCCGCCGCCCAGCCTGCGGCAAAAAAGGTGCGTCAAGACTGCCCCTGCCC
CTTGGCCGCCGACACTAATGCATTGCAGCTGGCCCAGCACAAGCCGCGCGGGCTGTCAGCCAAGTTTGCGCCAAA
GGCCCCCAGGCCTCCAGCTGCGCCCCAGGACCCTTCAGCCTTGGCAGTCCTGGGACTGACGCCCCCTGAGAGACC
TCGTGCCTTGACACCTCCATTGCCCAACCAGCCTTCGTCGAATCTGCCAGCTGCAGGCAACGTGGTGCAGCAGCG
AGACGGGCCCCTTGTGCGCAAGAAAAAGGCCAAGCCAAGTGTGTTTTTGCCCAAGAAGCGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail