Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7394
Gene name
LocationContig_8:2839..3655
Strand-
Gene length (bp)816
Transcript length (bp)816
Coding sequence length (bp)816
Protein length (aa) 272

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 1.8E-08 57 234

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P21158|CSGA_MYXXA C-factor OS=Myxococcus xanthus GN=csgA PE=1 SV=1 102 270 2.0E-13
sp|P36086|YKH1_YEAST Uncharacterized oxidoreductase YKL071W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL071W PE=1 SV=1 8 268 5.0E-09
sp|Q7Z9I3|YCP8_SCHPO Uncharacterized oxidoreductase C663.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.08c PE=3 SV=1 8 270 6.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7394
MSSLPWILVCPSSRGIGFALTRRLLLTTSLPILATTRSCNLCSAKSALLQGLDNASAADFAQRLNLVSCDVTDES
SMRAASQTASHLFPPQTHHLQLACAIAGVLHVEKSPSQIEAAAALDSFRINALGPLLLAKHFFPLLPRRAANPQA
SAVKALPAQAVWLTMAARVGSTSDNRAGGWYSYRASKAAVISLTRSLDMFLQARSPDSAMAVAYHPGTVKTDLSR
HFWNSVADKQLFTPEYAAERMVQVIAGLQDNQRGRCWDWKGDEVPP*
Coding >OphauB2|7394
ATGTCCTCATTGCCCTGGATCCTCGTCTGCCCCTCAAGCCGGGGCATCGGCTTTGCCCTTACCCGCCGCCTGCTC
CTCACCACGTCGCTCCCAATCCTGGCCACGACGCGCTCTTGCAACCTATGCTCTGCAAAGTCTGCCCTCCTCCAA
GGCCTCGACAATGCATCAGCAGCAGACTTTGCTCAGCGCCTCAACCTTGTGAGCTGCGACGTGACAGACGAGTCG
TCCATGCGTGCCGCCAGCCAGACTGCGTCGCATCTGTTCCCCCCTCAGACGCACCATTTGCAGCTGGCCTGTGCC
ATTGCTGGCGTGCTGCATGTGGAAAAGTCGCCCTCGCAAATCGAAGCCGCCGCCGCCCTCGACTCGTTTCGCATC
AATGCCCTCGGACCCTTGCTGCTGGCAAAGCACTTTTTCCCTCTTTTGCCTCGCCGCGCCGCCAACCCCCAAGCC
TCTGCCGTCAAAGCCCTGCCCGCCCAGGCCGTCTGGCTCACCATGGCTGCCCGCGTCGGCTCGACAAGCGACAAC
CGCGCTGGCGGCTGGTACTCGTACCGCGCCAGCAAGGCTGCCGTCATCAGCCTCACCCGCAGTCTCGACATGTTT
CTCCAAGCTCGCAGCCCGGACAGTGCCATGGCCGTTGCCTACCACCCGGGAACCGTCAAGACTGACTTGAGCCGT
CATTTCTGGAATAGTGTAGCCGACAAGCAGCTCTTTACACCCGAGTACGCGGCCGAGCGCATGGTCCAAGTCATA
GCCGGCCTGCAAGATAACCAGAGGGGCAGGTGCTGGGACTGGAAGGGCGACGAGGTGCCACCTTGA
Transcript >OphauB2|7394
ATGTCCTCATTGCCCTGGATCCTCGTCTGCCCCTCAAGCCGGGGCATCGGCTTTGCCCTTACCCGCCGCCTGCTC
CTCACCACGTCGCTCCCAATCCTGGCCACGACGCGCTCTTGCAACCTATGCTCTGCAAAGTCTGCCCTCCTCCAA
GGCCTCGACAATGCATCAGCAGCAGACTTTGCTCAGCGCCTCAACCTTGTGAGCTGCGACGTGACAGACGAGTCG
TCCATGCGTGCCGCCAGCCAGACTGCGTCGCATCTGTTCCCCCCTCAGACGCACCATTTGCAGCTGGCCTGTGCC
ATTGCTGGCGTGCTGCATGTGGAAAAGTCGCCCTCGCAAATCGAAGCCGCCGCCGCCCTCGACTCGTTTCGCATC
AATGCCCTCGGACCCTTGCTGCTGGCAAAGCACTTTTTCCCTCTTTTGCCTCGCCGCGCCGCCAACCCCCAAGCC
TCTGCCGTCAAAGCCCTGCCCGCCCAGGCCGTCTGGCTCACCATGGCTGCCCGCGTCGGCTCGACAAGCGACAAC
CGCGCTGGCGGCTGGTACTCGTACCGCGCCAGCAAGGCTGCCGTCATCAGCCTCACCCGCAGTCTCGACATGTTT
CTCCAAGCTCGCAGCCCGGACAGTGCCATGGCCGTTGCCTACCACCCGGGAACCGTCAAGACTGACTTGAGCCGT
CATTTCTGGAATAGTGTAGCCGACAAGCAGCTCTTTACACCCGAGTACGCGGCCGAGCGCATGGTCCAAGTCATA
GCCGGCCTGCAAGATAACCAGAGGGGCAGGTGCTGGGACTGGAAGGGCGACGAGGTGCCACCTTGA
Gene >OphauB2|7394
ATGTCCTCATTGCCCTGGATCCTCGTCTGCCCCTCAAGCCGGGGCATCGGCTTTGCCCTTACCCGCCGCCTGCTC
CTCACCACGTCGCTCCCAATCCTGGCCACGACGCGCTCTTGCAACCTATGCTCTGCAAAGTCTGCCCTCCTCCAA
GGCCTCGACAATGCATCAGCAGCAGACTTTGCTCAGCGCCTCAACCTTGTGAGCTGCGACGTGACAGACGAGTCG
TCCATGCGTGCCGCCAGCCAGACTGCGTCGCATCTGTTCCCCCCTCAGACGCACCATTTGCAGCTGGCCTGTGCC
ATTGCTGGCGTGCTGCATGTGGAAAAGTCGCCCTCGCAAATCGAAGCCGCCGCCGCCCTCGACTCGTTTCGCATC
AATGCCCTCGGACCCTTGCTGCTGGCAAAGCACTTTTTCCCTCTTTTGCCTCGCCGCGCCGCCAACCCCCAAGCC
TCTGCCGTCAAAGCCCTGCCCGCCCAGGCCGTCTGGCTCACCATGGCTGCCCGCGTCGGCTCGACAAGCGACAAC
CGCGCTGGCGGCTGGTACTCGTACCGCGCCAGCAAGGCTGCCGTCATCAGCCTCACCCGCAGTCTCGACATGTTT
CTCCAAGCTCGCAGCCCGGACAGTGCCATGGCCGTTGCCTACCACCCGGGAACCGTCAAGACTGACTTGAGCCGT
CATTTCTGGAATAGTGTAGCCGACAAGCAGCTCTTTACACCCGAGTACGCGGCCGAGCGCATGGTCCAAGTCATA
GCCGGCCTGCAAGATAACCAGAGGGGCAGGTGCTGGGACTGGAAGGGCGACGAGGTGCCACCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail