Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7393
Gene name
LocationContig_8:1438..2733
Strand+
Gene length (bp)1295
Transcript length (bp)1230
Coding sequence length (bp)1230
Protein length (aa) 410

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16893 fn3_2 Fibronectin type III domain 4.6E-37 75 162
PF16892 CHS5_N Chitin biosynthesis protein CHS5 N-terminus 1.2E-24 3 49
PF12738 PTCB-BRCT twin BRCT domain 1.8E-12 174 233
PF00533 BRCT BRCA1 C Terminus (BRCT) domain 9.1E-11 164 237
PF16589 BRCT_2 BRCT domain, a BRCA1 C-terminus domain 3.2E-06 180 249

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q92357|CFR1_SCHPO Cell fusion protein cfr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cfr1 PE=3 SV=1 5 252 1.0E-73
sp|Q12114|CHS5_YEAST Chitin biosynthesis protein CHS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS5 PE=1 SV=1 3 255 7.0E-72
sp|O74161|CHS5_CANAL Chitin biosynthesis protein CHS5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHS5 PE=3 SV=2 3 256 3.0E-71

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0005515 protein binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7393
MLVSLTVGKVDAGVAILLTPDKRLIEFPSLLLPPNISTGSIVDITVSQNTAKESSSERQFGELQEHIFKSFGASE
PQTPVLRCRNATQTSVVLEWDAIDLATADLISLSLYRNGQKAGNIPRPLQMHSTKISGLAVDTEYNFYLVLRTSA
GIRVSDKVKVRTHKMTDLSGVTITSGIMPPATKDRLAQAVERIGAKIVEGVRIDTTHFVTTEGRGTAWEKAVENN
IPVVRPEWVEACEKNGRILGVTKFYLDAVQPGQQTEHDVASSPDTRTKETSRGRDETPARQGASSDTGGKTLSPS
RDREANSSSGNVAQAANGKQDKAQEQEQEQEQDKAQEQDKAQHQEQHQQQEQETQHTASQPKDGELPGDSQRLQD
EAEQQDGHDAADHDGTNGKSDAAMDGSSFQEVEL*
Coding >OphauB2|7393
ATGCTCGTTTCGCTGACGGTCGGAAAGGTGGACGCCGGCGTCGCAATTCTCTTGACGCCGGACAAAAGACTGATT
GAGTTCCCATCGCTCCTCCTGCCGCCCAACATCTCGACGGGCAGCATCGTCGACATCACCGTCTCTCAAAACACG
GCCAAGGAGTCAAGCTCGGAGCGCCAGTTTGGCGAGCTGCAAGAGCACATCTTCAAGTCGTTTGGAGCCTCTGAG
CCCCAGACGCCCGTGCTACGCTGCCGCAATGCCACGCAGACTTCGGTGGTGCTGGAGTGGGATGCCATTGATCTG
GCCACTGCCGACCTCATCTCGCTCAGTCTGTATCGCAACGGCCAGAAGGCTGGCAACATTCCCCGTCCGCTGCAG
ATGCACAGCACAAAGATTAGCGGTCTTGCCGTCGATACCGAATACAACTTTTATCTCGTGTTGCGCACCAGCGCC
GGCATCCGCGTCAGCGACAAGGTCAAGGTTCGCACCCACAAAATGACTGACCTCAGTGGCGTCACCATCACCTCG
GGCATCATGCCGCCCGCCACCAAGGACAGGCTGGCTCAGGCGGTCGAGCGCATCGGCGCCAAGATTGTCGAAGGC
GTCCGCATTGACACGACGCATTTTGTCACCACCGAGGGCCGCGGCACCGCCTGGGAAAAGGCTGTAGAGAACAAC
ATTCCAGTCGTGCGCCCCGAATGGGTCGAGGCATGCGAAAAGAATGGCAGGATTCTCGGCGTCACCAAGTTTTAT
CTCGACGCCGTGCAGCCCGGCCAGCAAACGGAACACGACGTGGCGTCATCTCCCGACACACGCACCAAGGAGACG
AGCCGTGGGCGAGACGAGACGCCCGCCCGGCAAGGCGCATCCTCGGACACTGGCGGCAAGACTCTGTCGCCGTCA
AGAGACAGAGAGGCAAACTCAAGCTCTGGCAATGTGGCCCAGGCGGCAAACGGGAAACAGGACAAGGCGCAGGAG
CAGGAGCAGGAGCAGGAGCAGGACAAGGCGCAGGAGCAGGACAAGGCGCAACATCAGGAGCAACATCAGCAACAG
GAGCAGGAGACGCAGCACACTGCCTCGCAGCCCAAGGACGGCGAGCTGCCAGGCGACTCTCAAAGACTGCAAGAC
GAGGCAGAACAACAAGACGGCCATGACGCAGCAGACCATGACGGGACAAACGGCAAGTCGGACGCCGCCATGGAT
GGGTCGTCTTTTCAGGAAGTTGAGCTGTAA
Transcript >OphauB2|7393
ATGCTCGTTTCGCTGACGGTCGGAAAGGTGGACGCCGGCGTCGCAATTCTCTTGACGCCGGACAAAAGACTGATT
GAGTTCCCATCGCTCCTCCTGCCGCCCAACATCTCGACGGGCAGCATCGTCGACATCACCGTCTCTCAAAACACG
GCCAAGGAGTCAAGCTCGGAGCGCCAGTTTGGCGAGCTGCAAGAGCACATCTTCAAGTCGTTTGGAGCCTCTGAG
CCCCAGACGCCCGTGCTACGCTGCCGCAATGCCACGCAGACTTCGGTGGTGCTGGAGTGGGATGCCATTGATCTG
GCCACTGCCGACCTCATCTCGCTCAGTCTGTATCGCAACGGCCAGAAGGCTGGCAACATTCCCCGTCCGCTGCAG
ATGCACAGCACAAAGATTAGCGGTCTTGCCGTCGATACCGAATACAACTTTTATCTCGTGTTGCGCACCAGCGCC
GGCATCCGCGTCAGCGACAAGGTCAAGGTTCGCACCCACAAAATGACTGACCTCAGTGGCGTCACCATCACCTCG
GGCATCATGCCGCCCGCCACCAAGGACAGGCTGGCTCAGGCGGTCGAGCGCATCGGCGCCAAGATTGTCGAAGGC
GTCCGCATTGACACGACGCATTTTGTCACCACCGAGGGCCGCGGCACCGCCTGGGAAAAGGCTGTAGAGAACAAC
ATTCCAGTCGTGCGCCCCGAATGGGTCGAGGCATGCGAAAAGAATGGCAGGATTCTCGGCGTCACCAAGTTTTAT
CTCGACGCCGTGCAGCCCGGCCAGCAAACGGAACACGACGTGGCGTCATCTCCCGACACACGCACCAAGGAGACG
AGCCGTGGGCGAGACGAGACGCCCGCCCGGCAAGGCGCATCCTCGGACACTGGCGGCAAGACTCTGTCGCCGTCA
AGAGACAGAGAGGCAAACTCAAGCTCTGGCAATGTGGCCCAGGCGGCAAACGGGAAACAGGACAAGGCGCAGGAG
CAGGAGCAGGAGCAGGAGCAGGACAAGGCGCAGGAGCAGGACAAGGCGCAACATCAGGAGCAACATCAGCAACAG
GAGCAGGAGACGCAGCACACTGCCTCGCAGCCCAAGGACGGCGAGCTGCCAGGCGACTCTCAAAGACTGCAAGAC
GAGGCAGAACAACAAGACGGCCATGACGCAGCAGACCATGACGGGACAAACGGCAAGTCGGACGCCGCCATGGAT
GGGTCGTCTTTTCAGGAAGTTGAGCTGTAA
Gene >OphauB2|7393
ATGCTCGTTTCGCTGACGGTCGGAAAGGTGGACGCCGGCGTCGCAATTCTCTTGACGCCGGACAAAAGACTGGTA
CCGTGCACAAAGCCCCCAATGCTGGCTAAACCGTCTCTTGCTAAGCCGCTGCCGTGCCCCAGATTGAGTTCCCAT
CGCTCCTCCTGCCGCCCAACATCTCGACGGGCAGCATCGTCGACATCACCGTCTCTCAAAACACGGCCAAGGAGT
CAAGCTCGGAGCGCCAGTTTGGCGAGCTGCAAGAGCACATCTTCAAGTCGTTTGGAGCCTCTGAGCCCCAGACGC
CCGTGCTACGCTGCCGCAATGCCACGCAGACTTCGGTGGTGCTGGAGTGGGATGCCATTGATCTGGCCACTGCCG
ACCTCATCTCGCTCAGTCTGTATCGCAACGGCCAGAAGGCTGGCAACATTCCCCGTCCGCTGCAGATGCACAGCA
CAAAGATTAGCGGTCTTGCCGTCGATACCGAATACAACTTTTATCTCGTGTTGCGCACCAGCGCCGGCATCCGCG
TCAGCGACAAGGTCAAGGTTCGCACCCACAAAATGACTGACCTCAGTGGCGTCACCATCACCTCGGGCATCATGC
CGCCCGCCACCAAGGACAGGCTGGCTCAGGCGGTCGAGCGCATCGGCGCCAAGATTGTCGAAGGCGTCCGCATTG
ACACGACGCATTTTGTCACCACCGAGGGCCGCGGCACCGCCTGGGAAAAGGCTGTAGAGAACAACATTCCAGTCG
TGCGCCCCGAATGGGTCGAGGCATGCGAAAAGAATGGCAGGATTCTCGGCGTCACCAAGTTTTATCTCGACGCCG
TGCAGCCCGGCCAGCAAACGGAACACGACGTGGCGTCATCTCCCGACACACGCACCAAGGAGACGAGCCGTGGGC
GAGACGAGACGCCCGCCCGGCAAGGCGCATCCTCGGACACTGGCGGCAAGACTCTGTCGCCGTCAAGAGACAGAG
AGGCAAACTCAAGCTCTGGCAATGTGGCCCAGGCGGCAAACGGGAAACAGGACAAGGCGCAGGAGCAGGAGCAGG
AGCAGGAGCAGGACAAGGCGCAGGAGCAGGACAAGGCGCAACATCAGGAGCAACATCAGCAACAGGAGCAGGAGA
CGCAGCACACTGCCTCGCAGCCCAAGGACGGCGAGCTGCCAGGCGACTCTCAAAGACTGCAAGACGAGGCAGAAC
AACAAGACGGCCATGACGCAGCAGACCATGACGGGACAAACGGCAAGTCGGACGCCGCCATGGATGGGTCGTCTT
TTCAGGAAGTTGAGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail