Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7386
Gene name
LocationContig_79:67194..69222
Strand-
Gene length (bp)2028
Transcript length (bp)2028
Coding sequence length (bp)2028
Protein length (aa) 676

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03815 LCCL LCCL domain 3.5E-23 191 308

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40514|YIG7_YEAST Uncharacterized protein YIL067C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL067C PE=1 SV=1 105 674 1.0E-58

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 155 172 17
2 345 367 22
3 377 399 22
4 418 440 22
5 455 474 19
6 487 509 22
7 529 548 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7386
MPGHYHDDPDETQPLMRLPTRRKANDGQVIETEVADNDSGPSVERRRGQQVEHHSESESSSSPRDHGADSPLASD
GALQVEDSHQATPRFLQEERASRYCKRIPYPVRRLCCAVSRWARGPPDPQPYRIAPLLPSVQKWPLWLVNRLLPK
LWQRRWLLFVYLSIWFVTFVLVKRKESAAIEIAGWGQASTISCGSTYWRSDNSCGLDGADCRPFTMSGFAFTCPA
NCLSYTPLNPRAVGDQEIVYKPLVVGGGDESAIYRGDSYICSAAIHAGVIDNKNGGCGVVELVGRQTQFPGSNKN
GVDSIGFDSYFPLSFRFLANADCSAKDERWSLLAISVVFSVMLSLFTASSSVFFFCTFTALFITVGIATDAPPSR
SVAALVSNIVGKFLPAAFVACVVFDKVAKRTLKGLKAQVEKTILWLGGCWVGSLSNYTLGWIPIQRLNKQDLDQQ
PGAKAALAIIIMILIVIVVSQIWFFRNEGRLIRYLKLYILFLAAIVIALLIPSLHLRLHHYIFALLLLPGTSMQT
RPSLLYQGFLMGLFINGIARWGFDPVLQTAQALQGDGQRGTLLPTIAEPIINLGNGPESLSNVTFTWDTPADVQL
YDGVSVLVNDVERLRSYFEDAGAKNEFTWSRNSSLDMAEYFRFAFMSGSTSGDYTKAGTWTADGKWHKMESGPSK
*
Coding >OphauB2|7386
ATGCCGGGCCACTATCATGATGACCCCGACGAGACGCAGCCCTTGATGAGACTCCCTACGCGACGCAAAGCCAAT
GACGGCCAAGTCATCGAGACTGAGGTTGCCGACAATGATTCGGGTCCCAGCGTTGAGCGCCGGCGCGGACAGCAA
GTCGAGCATCATTCCGAGTCGGAGTCGTCGTCGTCGCCTAGAGACCATGGAGCCGATTCTCCCCTTGCCAGCGAT
GGAGCTTTGCAAGTCGAGGACTCTCACCAGGCCACGCCGCGCTTTCTCCAGGAGGAGAGGGCGTCGAGATATTGC
AAACGCATCCCGTATCCTGTGCGCCGGCTCTGTTGCGCCGTCTCTCGCTGGGCTCGAGGGCCGCCGGATCCCCAG
CCCTACCGCATCGCTCCGCTGCTGCCGAGCGTCCAGAAATGGCCTCTGTGGCTCGTCAATCGATTGCTGCCCAAG
CTATGGCAGCGCCGCTGGCTTCTCTTTGTATACTTGTCCATTTGGTTCGTCACCTTTGTCCTTGTCAAGCGCAAA
GAAAGCGCCGCAATAGAAATCGCAGGCTGGGGCCAGGCCAGCACGATAAGCTGTGGCTCCACCTACTGGAGGAGC
GACAACTCGTGCGGTCTTGACGGCGCCGACTGCCGGCCATTTACCATGAGTGGCTTTGCCTTTACCTGTCCAGCC
AACTGCTTGAGCTACACGCCCTTGAATCCCAGAGCCGTGGGCGATCAGGAGATTGTGTACAAGCCACTGGTAGTT
GGCGGCGGAGACGAATCGGCCATTTACCGCGGAGACTCGTACATTTGCAGCGCTGCTATCCACGCTGGCGTCATC
GACAACAAGAATGGCGGCTGCGGCGTCGTGGAGCTCGTAGGACGCCAGACGCAGTTTCCCGGCTCCAACAAGAAC
GGCGTCGACAGCATTGGCTTTGACTCGTATTTCCCACTCTCGTTTCGCTTTCTCGCCAACGCCGACTGTTCAGCC
AAGGATGAGCGCTGGTCTCTGCTGGCCATCTCGGTCGTCTTCTCCGTCATGCTCTCTCTGTTTACAGCCTCGTCG
TCCGTCTTTTTCTTTTGCACCTTTACCGCCTTGTTCATTACAGTGGGGATAGCCACTGATGCGCCGCCGAGTCGC
TCCGTCGCGGCCCTCGTGTCCAATATTGTGGGCAAGTTTCTGCCAGCGGCTTTTGTGGCATGCGTCGTGTTTGAC
AAGGTGGCTAAACGCACCCTCAAGGGCCTCAAGGCCCAAGTGGAAAAGACAATCTTGTGGCTGGGGGGCTGCTGG
GTAGGCTCCCTGTCCAACTACACCTTGGGCTGGATTCCAATACAGCGTCTCAACAAGCAGGATCTTGACCAGCAG
CCAGGCGCAAAGGCGGCTCTGGCCATCATCATCATGATTCTCATTGTCATTGTCGTGAGCCAGATATGGTTTTTC
CGCAACGAGGGACGATTGATTCGCTATCTCAAGCTTTACATCTTGTTCTTGGCAGCCATTGTTATTGCGCTGCTC
ATACCCAGTCTTCATCTACGCCTTCACCACTACATCTTCGCGCTGCTGCTTTTGCCGGGCACAAGCATGCAAACG
CGTCCCTCTCTGCTCTACCAGGGCTTCTTGATGGGACTCTTCATCAATGGAATCGCACGTTGGGGCTTCGATCCT
GTGCTGCAGACGGCTCAAGCCTTGCAGGGAGACGGCCAAAGAGGCACGCTGCTGCCCACCATTGCTGAGCCCATT
ATCAACCTGGGCAACGGGCCGGAAAGCCTATCCAACGTGACGTTTACCTGGGACACGCCAGCCGACGTGCAGCTT
TACGATGGCGTTTCGGTGCTGGTGAATGACGTGGAAAGATTGAGGTCCTACTTTGAGGATGCCGGAGCCAAAAAT
GAGTTTACATGGTCGAGGAACAGCTCCTTGGACATGGCTGAGTACTTTCGCTTCGCCTTTATGAGCGGTAGCACG
AGCGGAGACTATACCAAGGCTGGAACCTGGACGGCTGACGGAAAGTGGCACAAGATGGAATCTGGGCCGTCGAAA
TAA
Transcript >OphauB2|7386
ATGCCGGGCCACTATCATGATGACCCCGACGAGACGCAGCCCTTGATGAGACTCCCTACGCGACGCAAAGCCAAT
GACGGCCAAGTCATCGAGACTGAGGTTGCCGACAATGATTCGGGTCCCAGCGTTGAGCGCCGGCGCGGACAGCAA
GTCGAGCATCATTCCGAGTCGGAGTCGTCGTCGTCGCCTAGAGACCATGGAGCCGATTCTCCCCTTGCCAGCGAT
GGAGCTTTGCAAGTCGAGGACTCTCACCAGGCCACGCCGCGCTTTCTCCAGGAGGAGAGGGCGTCGAGATATTGC
AAACGCATCCCGTATCCTGTGCGCCGGCTCTGTTGCGCCGTCTCTCGCTGGGCTCGAGGGCCGCCGGATCCCCAG
CCCTACCGCATCGCTCCGCTGCTGCCGAGCGTCCAGAAATGGCCTCTGTGGCTCGTCAATCGATTGCTGCCCAAG
CTATGGCAGCGCCGCTGGCTTCTCTTTGTATACTTGTCCATTTGGTTCGTCACCTTTGTCCTTGTCAAGCGCAAA
GAAAGCGCCGCAATAGAAATCGCAGGCTGGGGCCAGGCCAGCACGATAAGCTGTGGCTCCACCTACTGGAGGAGC
GACAACTCGTGCGGTCTTGACGGCGCCGACTGCCGGCCATTTACCATGAGTGGCTTTGCCTTTACCTGTCCAGCC
AACTGCTTGAGCTACACGCCCTTGAATCCCAGAGCCGTGGGCGATCAGGAGATTGTGTACAAGCCACTGGTAGTT
GGCGGCGGAGACGAATCGGCCATTTACCGCGGAGACTCGTACATTTGCAGCGCTGCTATCCACGCTGGCGTCATC
GACAACAAGAATGGCGGCTGCGGCGTCGTGGAGCTCGTAGGACGCCAGACGCAGTTTCCCGGCTCCAACAAGAAC
GGCGTCGACAGCATTGGCTTTGACTCGTATTTCCCACTCTCGTTTCGCTTTCTCGCCAACGCCGACTGTTCAGCC
AAGGATGAGCGCTGGTCTCTGCTGGCCATCTCGGTCGTCTTCTCCGTCATGCTCTCTCTGTTTACAGCCTCGTCG
TCCGTCTTTTTCTTTTGCACCTTTACCGCCTTGTTCATTACAGTGGGGATAGCCACTGATGCGCCGCCGAGTCGC
TCCGTCGCGGCCCTCGTGTCCAATATTGTGGGCAAGTTTCTGCCAGCGGCTTTTGTGGCATGCGTCGTGTTTGAC
AAGGTGGCTAAACGCACCCTCAAGGGCCTCAAGGCCCAAGTGGAAAAGACAATCTTGTGGCTGGGGGGCTGCTGG
GTAGGCTCCCTGTCCAACTACACCTTGGGCTGGATTCCAATACAGCGTCTCAACAAGCAGGATCTTGACCAGCAG
CCAGGCGCAAAGGCGGCTCTGGCCATCATCATCATGATTCTCATTGTCATTGTCGTGAGCCAGATATGGTTTTTC
CGCAACGAGGGACGATTGATTCGCTATCTCAAGCTTTACATCTTGTTCTTGGCAGCCATTGTTATTGCGCTGCTC
ATACCCAGTCTTCATCTACGCCTTCACCACTACATCTTCGCGCTGCTGCTTTTGCCGGGCACAAGCATGCAAACG
CGTCCCTCTCTGCTCTACCAGGGCTTCTTGATGGGACTCTTCATCAATGGAATCGCACGTTGGGGCTTCGATCCT
GTGCTGCAGACGGCTCAAGCCTTGCAGGGAGACGGCCAAAGAGGCACGCTGCTGCCCACCATTGCTGAGCCCATT
ATCAACCTGGGCAACGGGCCGGAAAGCCTATCCAACGTGACGTTTACCTGGGACACGCCAGCCGACGTGCAGCTT
TACGATGGCGTTTCGGTGCTGGTGAATGACGTGGAAAGATTGAGGTCCTACTTTGAGGATGCCGGAGCCAAAAAT
GAGTTTACATGGTCGAGGAACAGCTCCTTGGACATGGCTGAGTACTTTCGCTTCGCCTTTATGAGCGGTAGCACG
AGCGGAGACTATACCAAGGCTGGAACCTGGACGGCTGACGGAAAGTGGCACAAGATGGAATCTGGGCCGTCGAAA
TAA
Gene >OphauB2|7386
ATGCCGGGCCACTATCATGATGACCCCGACGAGACGCAGCCCTTGATGAGACTCCCTACGCGACGCAAAGCCAAT
GACGGCCAAGTCATCGAGACTGAGGTTGCCGACAATGATTCGGGTCCCAGCGTTGAGCGCCGGCGCGGACAGCAA
GTCGAGCATCATTCCGAGTCGGAGTCGTCGTCGTCGCCTAGAGACCATGGAGCCGATTCTCCCCTTGCCAGCGAT
GGAGCTTTGCAAGTCGAGGACTCTCACCAGGCCACGCCGCGCTTTCTCCAGGAGGAGAGGGCGTCGAGATATTGC
AAACGCATCCCGTATCCTGTGCGCCGGCTCTGTTGCGCCGTCTCTCGCTGGGCTCGAGGGCCGCCGGATCCCCAG
CCCTACCGCATCGCTCCGCTGCTGCCGAGCGTCCAGAAATGGCCTCTGTGGCTCGTCAATCGATTGCTGCCCAAG
CTATGGCAGCGCCGCTGGCTTCTCTTTGTATACTTGTCCATTTGGTTCGTCACCTTTGTCCTTGTCAAGCGCAAA
GAAAGCGCCGCAATAGAAATCGCAGGCTGGGGCCAGGCCAGCACGATAAGCTGTGGCTCCACCTACTGGAGGAGC
GACAACTCGTGCGGTCTTGACGGCGCCGACTGCCGGCCATTTACCATGAGTGGCTTTGCCTTTACCTGTCCAGCC
AACTGCTTGAGCTACACGCCCTTGAATCCCAGAGCCGTGGGCGATCAGGAGATTGTGTACAAGCCACTGGTAGTT
GGCGGCGGAGACGAATCGGCCATTTACCGCGGAGACTCGTACATTTGCAGCGCTGCTATCCACGCTGGCGTCATC
GACAACAAGAATGGCGGCTGCGGCGTCGTGGAGCTCGTAGGACGCCAGACGCAGTTTCCCGGCTCCAACAAGAAC
GGCGTCGACAGCATTGGCTTTGACTCGTATTTCCCACTCTCGTTTCGCTTTCTCGCCAACGCCGACTGTTCAGCC
AAGGATGAGCGCTGGTCTCTGCTGGCCATCTCGGTCGTCTTCTCCGTCATGCTCTCTCTGTTTACAGCCTCGTCG
TCCGTCTTTTTCTTTTGCACCTTTACCGCCTTGTTCATTACAGTGGGGATAGCCACTGATGCGCCGCCGAGTCGC
TCCGTCGCGGCCCTCGTGTCCAATATTGTGGGCAAGTTTCTGCCAGCGGCTTTTGTGGCATGCGTCGTGTTTGAC
AAGGTGGCTAAACGCACCCTCAAGGGCCTCAAGGCCCAAGTGGAAAAGACAATCTTGTGGCTGGGGGGCTGCTGG
GTAGGCTCCCTGTCCAACTACACCTTGGGCTGGATTCCAATACAGCGTCTCAACAAGCAGGATCTTGACCAGCAG
CCAGGCGCAAAGGCGGCTCTGGCCATCATCATCATGATTCTCATTGTCATTGTCGTGAGCCAGATATGGTTTTTC
CGCAACGAGGGACGATTGATTCGCTATCTCAAGCTTTACATCTTGTTCTTGGCAGCCATTGTTATTGCGCTGCTC
ATACCCAGTCTTCATCTACGCCTTCACCACTACATCTTCGCGCTGCTGCTTTTGCCGGGCACAAGCATGCAAACG
CGTCCCTCTCTGCTCTACCAGGGCTTCTTGATGGGACTCTTCATCAATGGAATCGCACGTTGGGGCTTCGATCCT
GTGCTGCAGACGGCTCAAGCCTTGCAGGGAGACGGCCAAAGAGGCACGCTGCTGCCCACCATTGCTGAGCCCATT
ATCAACCTGGGCAACGGGCCGGAAAGCCTATCCAACGTGACGTTTACCTGGGACACGCCAGCCGACGTGCAGCTT
TACGATGGCGTTTCGGTGCTGGTGAATGACGTGGAAAGATTGAGGTCCTACTTTGAGGATGCCGGAGCCAAAAAT
GAGTTTACATGGTCGAGGAACAGCTCCTTGGACATGGCTGAGTACTTTCGCTTCGCCTTTATGAGCGGTAGCACG
AGCGGAGACTATACCAAGGCTGGAACCTGGACGGCTGACGGAAAGTGGCACAAGATGGAATCTGGGCCGTCGAAA
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail