Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7371
Gene name
LocationContig_79:30854..31830
Strand-
Gene length (bp)976
Transcript length (bp)906
Coding sequence length (bp)906
Protein length (aa) 302

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00380 Ribosomal_S9 Ribosomal protein S9/S16 1.5E-38 181 301

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S7R6|RT09_NEUCR 37S ribosomal protein S9, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrp-9 PE=3 SV=2 22 301 8.0E-102
sp|Q9P4C1|RT09_KLUMA 37S ribosomal protein S9, mitochondrial OS=Kluyveromyces marxianus GN=MRPS9 PE=3 SV=1 59 301 3.0E-50
sp|Q6CJ65|RT09_KLULA 37S ribosomal protein S9, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRPS9 PE=3 SV=1 57 301 4.0E-50
sp|P38120|RT09_YEAST 37S ribosomal protein S9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS9 PE=1 SV=1 18 301 7.0E-48
sp|Q6FL25|RT09_CANGA 37S ribosomal protein S9, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRPS9 PE=3 SV=1 62 301 5.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S7R6|RT09_NEUCR 37S ribosomal protein S9, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrp-9 PE=3 SV=2 22 301 8.0E-102
sp|Q9P4C1|RT09_KLUMA 37S ribosomal protein S9, mitochondrial OS=Kluyveromyces marxianus GN=MRPS9 PE=3 SV=1 59 301 3.0E-50
sp|Q6CJ65|RT09_KLULA 37S ribosomal protein S9, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRPS9 PE=3 SV=1 57 301 4.0E-50
sp|P38120|RT09_YEAST 37S ribosomal protein S9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS9 PE=1 SV=1 18 301 7.0E-48
sp|Q6FL25|RT09_CANGA 37S ribosomal protein S9, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRPS9 PE=3 SV=1 62 301 5.0E-45
sp|O94150|RT09_CANAL 37S ribosomal protein S9, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRPS9 PE=2 SV=1 58 301 5.0E-43
sp|O14006|RT09_SCHPO 37S ribosomal protein S9, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrps9 PE=1 SV=2 64 301 3.0E-41
sp|Q757I0|RT09_ASHGO 37S ribosomal protein S9, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRPS9 PE=3 SV=1 121 301 2.0E-40
sp|Q6BIJ5|RT09_DEBHA 37S ribosomal protein S9, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MRPS9 PE=3 SV=2 62 301 5.0E-38
sp|Q6CFK6|RT09_YARLI 37S ribosomal protein S9, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRPS9 PE=3 SV=1 119 301 1.0E-30
sp|B6IMQ2|RS9_RHOCS 30S ribosomal protein S9 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rpsI PE=3 SV=1 166 301 1.0E-28
sp|B2IK87|RS9_BEII9 30S ribosomal protein S9 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rpsI PE=3 SV=1 171 301 4.0E-27
sp|A9W606|RS9_METEP 30S ribosomal protein S9 OS=Methylobacterium extorquens (strain PA1) GN=rpsI PE=3 SV=1 171 301 6.0E-27
sp|B7KPU6|RS9_METC4 30S ribosomal protein S9 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpsI PE=3 SV=1 171 301 6.0E-27
sp|Q3A9V2|RS9_CARHZ 30S ribosomal protein S9 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpsI PE=3 SV=1 179 301 1.0E-26
sp|B0K5S8|RS9_THEPX 30S ribosomal protein S9 OS=Thermoanaerobacter sp. (strain X514) GN=rpsI PE=3 SV=1 179 301 5.0E-26
sp|B0KCN5|RS9_THEP3 30S ribosomal protein S9 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpsI PE=3 SV=1 179 301 5.0E-26
sp|B2HCZ1|RS9_MYCMM 30S ribosomal protein S9 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=rpsI PE=3 SV=1 174 301 8.0E-26
sp|A9IVX6|RS9_BART1 30S ribosomal protein S9 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpsI PE=3 SV=1 171 301 1.0E-25
sp|A0QSP9|RS9_MYCS2 30S ribosomal protein S9 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rpsI PE=1 SV=1 166 301 2.0E-25
sp|B8D7S5|RS9_BUCAT 30S ribosomal protein S9 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rpsI PE=3 SV=1 179 301 2.0E-25
sp|A4XJ60|RS9_CALS8 30S ribosomal protein S9 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpsI PE=3 SV=2 176 301 3.0E-25
sp|A8I7Z9|RS9_AZOC5 30S ribosomal protein S9 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpsI PE=3 SV=1 171 301 3.0E-25
sp|C5BS65|RS9_TERTT 30S ribosomal protein S9 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rpsI PE=3 SV=1 179 301 4.0E-25
sp|Q1BCZ0|RS9_MYCSS 30S ribosomal protein S9 OS=Mycobacterium sp. (strain MCS) GN=rpsI PE=3 SV=1 158 301 5.0E-25
sp|A1UC03|RS9_MYCSK 30S ribosomal protein S9 OS=Mycobacterium sp. (strain KMS) GN=rpsI PE=3 SV=1 158 301 5.0E-25
sp|A3PVN4|RS9_MYCSJ 30S ribosomal protein S9 OS=Mycobacterium sp. (strain JLS) GN=rpsI PE=3 SV=1 158 301 5.0E-25
sp|A1U3H7|RS9_MARHV 30S ribosomal protein S9 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpsI PE=3 SV=1 179 301 5.0E-25
sp|P57470|RS9_BUCAI 30S ribosomal protein S9 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rpsI PE=3 SV=1 179 301 5.0E-25
sp|B8D9H3|RS9_BUCA5 30S ribosomal protein S9 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rpsI PE=3 SV=1 179 301 5.0E-25
sp|A0QKT2|RS9_MYCA1 30S ribosomal protein S9 OS=Mycobacterium avium (strain 104) GN=rpsI PE=3 SV=1 174 301 5.0E-25
sp|B1ZCB4|RS9_METPB 30S ribosomal protein S9 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpsI PE=3 SV=1 171 301 6.0E-25
sp|P40828|RS9_MYCLE 30S ribosomal protein S9 OS=Mycobacterium leprae (strain TN) GN=rpsI PE=3 SV=1 174 301 1.0E-24
sp|B8ZUC0|RS9_MYCLB 30S ribosomal protein S9 OS=Mycobacterium leprae (strain Br4923) GN=rpsI PE=3 SV=1 174 301 1.0E-24
sp|A5D5F7|RS9_PELTS 30S ribosomal protein S9 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpsI PE=3 SV=1 179 301 1.0E-24
sp|A1KWD5|RS9_NEIMF 30S ribosomal protein S9 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rpsI PE=3 SV=1 179 301 1.0E-24
sp|P66642|RS9_NEIMB 30S ribosomal protein S9 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rpsI PE=3 SV=1 179 301 1.0E-24
sp|P66641|RS9_NEIMA 30S ribosomal protein S9 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rpsI PE=3 SV=1 179 301 1.0E-24
sp|A9M088|RS9_NEIM0 30S ribosomal protein S9 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rpsI PE=3 SV=1 179 301 1.0E-24
sp|A0PMD2|RS9_MYCUA 30S ribosomal protein S9 OS=Mycobacterium ulcerans (strain Agy99) GN=rpsI PE=3 SV=1 174 301 1.0E-24
sp|Q73S30|RS9_MYCPA 30S ribosomal protein S9 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=rpsI PE=3 SV=1 174 301 1.0E-24
sp|Q15PI4|RS9_PSEA6 30S ribosomal protein S9 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rpsI PE=3 SV=1 179 301 1.0E-24
sp|A9I240|RS9_BORPD 30S ribosomal protein S9 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rpsI PE=3 SV=1 179 301 2.0E-24
sp|B0TUV6|RS9_SHEHH 30S ribosomal protein S9 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rpsI PE=3 SV=1 179 301 2.0E-24
sp|A4WUK1|RS9_RHOS5 30S ribosomal protein S9 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rpsI PE=3 SV=1 167 301 2.0E-24
sp|B1J1W9|RS9_PSEPW 30S ribosomal protein S9 OS=Pseudomonas putida (strain W619) GN=rpsI PE=3 SV=1 179 301 2.0E-24
sp|Q2IWN6|RS9_RHOP2 30S ribosomal protein S9 OS=Rhodopseudomonas palustris (strain HaA2) GN=rpsI PE=3 SV=1 171 301 2.0E-24
sp|Q2RSE4|RS9_RHORT 30S ribosomal protein S9 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpsI PE=3 SV=1 144 301 2.0E-24
sp|B1KII1|RS9_SHEWM 30S ribosomal protein S9 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rpsI PE=3 SV=1 179 301 3.0E-24
sp|A8FR86|RS9_SHESH 30S ribosomal protein S9 OS=Shewanella sediminis (strain HAW-EB3) GN=rpsI PE=3 SV=1 179 301 3.0E-24
sp|A1RNJ7|RS9_SHESW 30S ribosomal protein S9 OS=Shewanella sp. (strain W3-18-1) GN=rpsI PE=3 SV=1 179 301 3.0E-24
sp|Q0HYX4|RS9_SHESR 30S ribosomal protein S9 OS=Shewanella sp. (strain MR-7) GN=rpsI PE=3 SV=1 179 301 3.0E-24
sp|Q0HF31|RS9_SHESM 30S ribosomal protein S9 OS=Shewanella sp. (strain MR-4) GN=rpsI PE=3 SV=1 179 301 3.0E-24
sp|A0KT12|RS9_SHESA 30S ribosomal protein S9 OS=Shewanella sp. (strain ANA-3) GN=rpsI PE=3 SV=1 179 301 3.0E-24
sp|A4Y3E2|RS9_SHEPC 30S ribosomal protein S9 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rpsI PE=3 SV=1 179 301 3.0E-24
sp|Q8EAG3|RS9_SHEON 30S ribosomal protein S9 OS=Shewanella oneidensis (strain MR-1) GN=rpsI PE=3 SV=1 179 301 3.0E-24
sp|A9L112|RS9_SHEB9 30S ribosomal protein S9 OS=Shewanella baltica (strain OS195) GN=rpsI PE=3 SV=1 179 301 3.0E-24
sp|A6WJ71|RS9_SHEB8 30S ribosomal protein S9 OS=Shewanella baltica (strain OS185) GN=rpsI PE=3 SV=1 179 301 3.0E-24
sp|A3D8R3|RS9_SHEB5 30S ribosomal protein S9 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rpsI PE=3 SV=1 179 301 3.0E-24
sp|B8E9M8|RS9_SHEB2 30S ribosomal protein S9 OS=Shewanella baltica (strain OS223) GN=rpsI PE=3 SV=1 179 301 3.0E-24
sp|B0UQW5|RS9_METS4 30S ribosomal protein S9 OS=Methylobacterium sp. (strain 4-46) GN=rpsI PE=3 SV=1 171 301 4.0E-24
sp|B8IUF0|RS9_METNO 30S ribosomal protein S9 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rpsI PE=3 SV=1 171 301 4.0E-24
sp|B9KT42|RS9_RHOSK 30S ribosomal protein S9 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rpsI PE=3 SV=1 167 301 4.0E-24
sp|Q3J1Z5|RS9_RHOS4 30S ribosomal protein S9 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpsI PE=3 SV=1 167 301 4.0E-24
sp|A3PK94|RS9_RHOS1 30S ribosomal protein S9 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpsI PE=3 SV=1 167 301 4.0E-24
sp|Q92QR5|RS9_RHIME 30S ribosomal protein S9 OS=Rhizobium meliloti (strain 1021) GN=rpsI PE=3 SV=1 171 301 5.0E-24
sp|Q60AF7|RS9_METCA 30S ribosomal protein S9 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rpsI PE=3 SV=1 179 301 6.0E-24
sp|A0L481|RS9_MAGMM 30S ribosomal protein S9 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rpsI PE=3 SV=1 179 301 6.0E-24
sp|B3QKG4|RS9_RHOPT 30S ribosomal protein S9 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpsI PE=3 SV=1 171 301 6.0E-24
sp|Q6N650|RS9_RHOPA 30S ribosomal protein S9 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpsI PE=1 SV=1 171 301 6.0E-24
sp|B9MLF6|RS9_CALBD 30S ribosomal protein S9 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rpsI PE=3 SV=1 179 301 7.0E-24
sp|Q21FV9|RS9_SACD2 30S ribosomal protein S9 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rpsI PE=3 SV=1 179 301 8.0E-24
sp|B7KI15|RS9_CYAP7 30S ribosomal protein S9 OS=Cyanothece sp. (strain PCC 7424) GN=rpsI PE=3 SV=1 176 301 8.0E-24
sp|A7INH2|RS9_XANP2 30S ribosomal protein S9 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpsI PE=3 SV=1 171 301 8.0E-24
sp|A7HXB2|RS9_PARL1 30S ribosomal protein S9 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpsI PE=3 SV=1 171 301 9.0E-24
sp|A8GMN0|RS9_RICAH 30S ribosomal protein S9 OS=Rickettsia akari (strain Hartford) GN=rpsI PE=3 SV=1 159 301 9.0E-24
sp|A1UT84|RS9_BARBK 30S ribosomal protein S9 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rpsI PE=3 SV=1 148 301 9.0E-24
sp|Q5P7T8|RS9_AROAE 30S ribosomal protein S9 OS=Aromatoleum aromaticum (strain EbN1) GN=rpsI PE=3 SV=1 179 301 9.0E-24
sp|Q4UKS7|RS9_RICFE 30S ribosomal protein S9 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rpsI PE=3 SV=1 153 301 9.0E-24
sp|Q6G3I7|RS9_BARHE 30S ribosomal protein S9 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpsI PE=3 SV=1 171 301 1.0E-23
sp|A8H8M0|RS9_SHEPA 30S ribosomal protein S9 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rpsI PE=3 SV=1 179 301 1.0E-23
sp|Q8R7Y9|RS9_CALS4 30S ribosomal protein S9 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpsI PE=3 SV=1 179 301 1.0E-23
sp|B1WQT9|RS9_CYAA5 30S ribosomal protein S9 OS=Cyanothece sp. (strain ATCC 51142) GN=rpsI PE=3 SV=1 179 301 1.0E-23
sp|Q88N96|RS9_PSEPK 30S ribosomal protein S9 OS=Pseudomonas putida (strain KT2440) GN=rpsI PE=3 SV=1 179 301 1.0E-23
sp|A5W8S0|RS9_PSEP1 30S ribosomal protein S9 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpsI PE=3 SV=1 179 301 1.0E-23
sp|B0KFU7|RS9_PSEPG 30S ribosomal protein S9 OS=Pseudomonas putida (strain GB-1) GN=rpsI PE=3 SV=1 179 301 1.0E-23
sp|Q1I597|RS9_PSEE4 30S ribosomal protein S9 OS=Pseudomonas entomophila (strain L48) GN=rpsI PE=3 SV=1 179 301 1.0E-23
sp|Q1QKK3|RS9_NITHX 30S ribosomal protein S9 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rpsI PE=3 SV=1 171 301 1.0E-23
sp|C4K5S1|RS9_HAMD5 30S ribosomal protein S9 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rpsI PE=3 SV=1 179 301 1.0E-23
sp|A3QI61|RS9_SHELP 30S ribosomal protein S9 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rpsI PE=3 SV=1 179 301 1.0E-23
sp|Q8UFZ8|RS9_AGRFC 30S ribosomal protein S9 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpsI PE=3 SV=1 171 301 2.0E-23
sp|Q07MN9|RS9_RHOP5 30S ribosomal protein S9 OS=Rhodopseudomonas palustris (strain BisA53) GN=rpsI PE=3 SV=1 171 301 2.0E-23
sp|A8GRA1|RS9_RICRS 30S ribosomal protein S9 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rpsI PE=3 SV=1 146 301 2.0E-23
sp|B0BWQ1|RS9_RICRO 30S ribosomal protein S9 OS=Rickettsia rickettsii (strain Iowa) GN=rpsI PE=3 SV=1 146 301 2.0E-23
sp|Q982W9|RS9_RHILO 30S ribosomal protein S9 OS=Rhizobium loti (strain MAFF303099) GN=rpsI PE=3 SV=1 171 301 2.0E-23
sp|A5EKC6|RS9_BRASB 30S ribosomal protein S9 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpsI PE=3 SV=1 171 301 2.0E-23
sp|Q92IV4|RS9_RICCN 30S ribosomal protein S9 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rpsI PE=3 SV=1 146 301 2.0E-23
sp|B4RQK5|RS9_NEIG2 30S ribosomal protein S9 OS=Neisseria gonorrhoeae (strain NCCP11945) GN=rpsI PE=3 SV=1 179 301 2.0E-23
sp|Q5F5A4|RS9_NEIG1 30S ribosomal protein S9 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rpsI PE=3 SV=1 179 301 2.0E-23
sp|Q7W3Z2|RS9_BORPA 30S ribosomal protein S9 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rpsI PE=3 SV=1 179 301 2.0E-23
sp|Q5Z1H9|RS9_NOCFA 30S ribosomal protein S9 OS=Nocardia farcinica (strain IFM 10152) GN=rpsI PE=3 SV=1 163 301 2.0E-23
sp|C3MA32|RS9_RHISN 30S ribosomal protein S9 OS=Rhizobium sp. (strain NGR234) GN=rpsI PE=3 SV=1 171 301 2.0E-23
sp|Q4K6H3|RS9_PSEF5 30S ribosomal protein S9 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rpsI PE=3 SV=1 179 301 2.0E-23
sp|Q1RK10|RS9_RICBR 30S ribosomal protein S9 OS=Rickettsia bellii (strain RML369-C) GN=rpsI PE=3 SV=1 171 301 2.0E-23
sp|A8GXN6|RS9_RICB8 30S ribosomal protein S9 OS=Rickettsia bellii (strain OSU 85-389) GN=rpsI PE=3 SV=1 171 301 2.0E-23
sp|Q2KV03|RS9_BORA1 30S ribosomal protein S9 OS=Bordetella avium (strain 197N) GN=rpsI PE=3 SV=1 179 301 2.0E-23
sp|B6JGT6|RS9_OLICO 30S ribosomal protein S9 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rpsI PE=3 SV=1 167 301 3.0E-23
sp|Q3SSQ8|RS9_NITWN 30S ribosomal protein S9 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpsI PE=3 SV=1 171 301 3.0E-23
sp|Q7VLF7|RS9_HAEDU 30S ribosomal protein S9 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpsI PE=3 SV=1 179 301 3.0E-23
sp|Q4ZNX3|RS9_PSEU2 30S ribosomal protein S9 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rpsI PE=3 SV=1 179 301 3.0E-23
sp|Q87WW8|RS9_PSESM 30S ribosomal protein S9 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rpsI PE=3 SV=1 179 301 3.0E-23
sp|Q3K724|RS9_PSEPF 30S ribosomal protein S9 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rpsI PE=3 SV=1 179 301 3.0E-23
sp|Q48EE1|RS9_PSE14 30S ribosomal protein S9 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rpsI PE=3 SV=1 179 301 3.0E-23
sp|C3K6E2|RS9_PSEFS 30S ribosomal protein S9 OS=Pseudomonas fluorescens (strain SBW25) GN=rpsI PE=3 SV=1 179 301 3.0E-23
sp|C4K0V7|RS9_RICPU 30S ribosomal protein S9 OS=Rickettsia peacockii (strain Rustic) GN=rpsI PE=3 SV=1 146 301 4.0E-23
sp|Q87SI4|RS9_VIBPA 30S ribosomal protein S9 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rpsI PE=3 SV=1 179 301 4.0E-23
sp|C0RIC5|RS9_BRUMB 30S ribosomal protein S9 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rpsI PE=3 SV=1 171 301 4.0E-23
sp|P62669|RS9_THET2 30S ribosomal protein S9 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpsI PE=1 SV=1 179 301 4.0E-23
sp|Q8YGJ0|RS9_BRUME 30S ribosomal protein S9 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpsI PE=3 SV=1 171 301 4.0E-23
sp|P73293|RS9_SYNY3 30S ribosomal protein S9 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rpsI PE=3 SV=1 179 301 5.0E-23
sp|B3PBL9|RS9_CELJU 30S ribosomal protein S9 OS=Cellvibrio japonicus (strain Ueda107) GN=rpsI PE=3 SV=1 179 301 5.0E-23
sp|Q7VUV9|RS9_BORPE 30S ribosomal protein S9 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rpsI PE=3 SV=1 179 301 5.0E-23
sp|B0BUG0|RS9_ACTPJ 30S ribosomal protein S9 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rpsI PE=3 SV=1 179 301 5.0E-23
sp|B3H130|RS9_ACTP7 30S ribosomal protein S9 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rpsI PE=3 SV=1 179 301 5.0E-23
sp|Q7WFC4|RS9_BORBR 30S ribosomal protein S9 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rpsI PE=3 SV=1 179 301 5.0E-23
sp|A6X1V5|RS9_OCHA4 30S ribosomal protein S9 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpsI PE=3 SV=1 171 301 5.0E-23
sp|Q8G1C9|RS9_BRUSU 30S ribosomal protein S9 OS=Brucella suis biovar 1 (strain 1330) GN=rpsI PE=3 SV=1 171 301 6.0E-23
sp|B0CLB7|RS9_BRUSI 30S ribosomal protein S9 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rpsI PE=3 SV=1 171 301 6.0E-23
sp|A5VPX4|RS9_BRUO2 30S ribosomal protein S9 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rpsI PE=3 SV=1 171 301 6.0E-23
sp|A9MAG7|RS9_BRUC2 30S ribosomal protein S9 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rpsI PE=3 SV=1 171 301 6.0E-23
sp|C0ZW78|RS9_RHOE4 30S ribosomal protein S9 OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=rpsI PE=3 SV=1 169 301 7.0E-23
sp|C3PMT0|RS9_RICAE 30S ribosomal protein S9 OS=Rickettsia africae (strain ESF-5) GN=rpsI PE=3 SV=1 146 301 7.0E-23
sp|A4YVP2|RS9_BRASO 30S ribosomal protein S9 OS=Bradyrhizobium sp. (strain ORS278) GN=rpsI PE=3 SV=1 171 301 7.0E-23
sp|B8CIP3|RS9_SHEPW 30S ribosomal protein S9 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rpsI PE=3 SV=1 179 301 7.0E-23
sp|A6U7T6|RS9_SINMW 30S ribosomal protein S9 OS=Sinorhizobium medicae (strain WSM419) GN=rpsI PE=3 SV=1 171 301 7.0E-23
sp|A8F0Z2|RS9_RICM5 30S ribosomal protein S9 OS=Rickettsia massiliae (strain Mtu5) GN=rpsI PE=3 SV=1 146 301 9.0E-23
sp|C4LCK6|RS9_TOLAT 30S ribosomal protein S9 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rpsI PE=3 SV=1 179 301 9.0E-23
sp|Q0SQH9|RS9_CLOPS 30S ribosomal protein S9 OS=Clostridium perfringens (strain SM101 / Type A) GN=rpsI PE=3 SV=1 178 301 1.0E-22
sp|Q8XHV7|RS9_CLOPE 30S ribosomal protein S9 OS=Clostridium perfringens (strain 13 / Type A) GN=rpsI PE=3 SV=1 178 301 1.0E-22
sp|Q0TMT2|RS9_CLOP1 30S ribosomal protein S9 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpsI PE=3 SV=1 178 301 1.0E-22
sp|A1SA66|RS9_SHEAM 30S ribosomal protein S9 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpsI PE=3 SV=1 179 301 1.0E-22
sp|P31782|RS9_HISSO 30S ribosomal protein S9 OS=Histophilus somni GN=rpsI PE=3 SV=2 179 301 1.0E-22
sp|B0UTU5|RS9_HISS2 30S ribosomal protein S9 OS=Histophilus somni (strain 2336) GN=rpsI PE=3 SV=1 179 301 1.0E-22
sp|Q0I2N2|RS9_HAES1 30S ribosomal protein S9 OS=Haemophilus somnus (strain 129Pt) GN=rpsI PE=3 SV=1 179 301 1.0E-22
sp|B8ENN1|RS9_METSB 30S ribosomal protein S9 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rpsI PE=3 SV=1 171 301 1.0E-22
sp|P80374|RS9_THET8 30S ribosomal protein S9 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpsI PE=1 SV=3 179 301 1.0E-22
sp|Q1AU64|RS9_RUBXD 30S ribosomal protein S9 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rpsI PE=3 SV=1 178 301 1.0E-22
sp|B5FB54|RS9_VIBFM 30S ribosomal protein S9 OS=Vibrio fischeri (strain MJ11) GN=rpsI PE=3 SV=1 179 301 1.0E-22
sp|Q5E2N0|RS9_VIBF1 30S ribosomal protein S9 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpsI PE=3 SV=1 179 301 1.0E-22
sp|C1DQ79|RS9_AZOVD 30S ribosomal protein S9 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rpsI PE=3 SV=1 179 301 1.0E-22
sp|Q57DW2|RS9_BRUAB 30S ribosomal protein S9 OS=Brucella abortus biovar 1 (strain 9-941) GN=rpsI PE=3 SV=1 171 301 1.0E-22
sp|Q2YND9|RS9_BRUA2 30S ribosomal protein S9 OS=Brucella abortus (strain 2308) GN=rpsI PE=3 SV=1 171 301 1.0E-22
sp|B2S535|RS9_BRUA1 30S ribosomal protein S9 OS=Brucella abortus (strain S19) GN=rpsI PE=3 SV=1 171 301 1.0E-22
sp|B1M201|RS9_METRJ 30S ribosomal protein S9 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpsI PE=3 SV=1 171 301 2.0E-22
sp|C5CM23|RS9_VARPS 30S ribosomal protein S9 OS=Variovorax paradoxus (strain S110) GN=rpsI PE=3 SV=1 179 301 2.0E-22
sp|Q89KE5|RS9_BRADU 30S ribosomal protein S9 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpsI PE=3 SV=1 171 301 2.0E-22
sp|A4VIF8|RS9_PSEU5 30S ribosomal protein S9 OS=Pseudomonas stutzeri (strain A1501) GN=rpsI PE=3 SV=1 179 301 2.0E-22
sp|A7MWN0|RS9_VIBCB 30S ribosomal protein S9 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rpsI PE=3 SV=1 179 301 2.0E-22
sp|Q136Q2|RS9_RHOPS 30S ribosomal protein S9 OS=Rhodopseudomonas palustris (strain BisB5) GN=rpsI PE=3 SV=1 171 301 2.0E-22
sp|Q8YPK7|RS9_NOSS1 30S ribosomal protein S9 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rpsI PE=3 SV=1 175 301 2.0E-22
sp|Q3MF93|RS9_ANAVT 30S ribosomal protein S9 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rpsI PE=3 SV=1 175 301 2.0E-22
sp|A6VPF4|RS9_ACTSZ 30S ribosomal protein S9 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpsI PE=3 SV=1 179 301 2.0E-22
sp|A3MZW7|RS9_ACTP2 30S ribosomal protein S9 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpsI PE=3 SV=1 179 301 2.0E-22
sp|C4ZI84|RS9_EUBR3 30S ribosomal protein S9 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=rpsI PE=3 SV=1 179 301 3.0E-22
sp|A4FPH0|RS9_SACEN 30S ribosomal protein S9 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=rpsI PE=3 SV=1 175 301 3.0E-22
sp|A0KPZ2|RS9_AERHH 30S ribosomal protein S9 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpsI PE=3 SV=1 179 301 3.0E-22
sp|Q64P28|RS9_BACFR 30S ribosomal protein S9 OS=Bacteroides fragilis (strain YCH46) GN=rpsI PE=3 SV=1 179 301 3.0E-22
sp|Q5L8W6|RS9_BACFN 30S ribosomal protein S9 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rpsI PE=3 SV=1 179 301 3.0E-22
sp|B5ZXZ5|RS9_RHILW 30S ribosomal protein S9 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rpsI PE=3 SV=1 171 301 3.0E-22
sp|Q1MIP3|RS9_RHIL3 30S ribosomal protein S9 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpsI PE=3 SV=1 171 301 3.0E-22
sp|A8EXY2|RS9_RICCK 30S ribosomal protein S9 OS=Rickettsia canadensis (strain McKiel) GN=rpsI PE=3 SV=1 166 301 3.0E-22
sp|B6ELJ4|RS9_ALISL 30S ribosomal protein S9 OS=Aliivibrio salmonicida (strain LFI1238) GN=rpsI PE=3 SV=1 179 301 3.0E-22
sp|A4SHZ5|RS9_AERS4 30S ribosomal protein S9 OS=Aeromonas salmonicida (strain A449) GN=rpsI PE=3 SV=1 179 301 4.0E-22
sp|Q32BA9|RS9_SHIDS 30S ribosomal protein S9 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpsI PE=3 SV=1 179 301 4.0E-22
sp|B3EFY3|RS9_CHLL2 30S ribosomal protein S9 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rpsI PE=3 SV=1 181 301 4.0E-22
sp|Q3SF20|RS9_THIDA 30S ribosomal protein S9 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rpsI PE=3 SV=1 179 301 4.0E-22
sp|A9KJF4|RS9_CLOPH 30S ribosomal protein S9 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rpsI PE=3 SV=1 179 301 4.0E-22
sp|B3E0U1|RS9_METI4 30S ribosomal protein S9 OS=Methylacidiphilum infernorum (isolate V4) GN=rpsI PE=3 SV=1 179 301 5.0E-22
sp|A4XQQ4|RS9_PSEMY 30S ribosomal protein S9 OS=Pseudomonas mendocina (strain ymp) GN=rpsI PE=3 SV=1 179 301 5.0E-22
sp|A5UEV9|RS9_HAEIG 30S ribosomal protein S9 OS=Haemophilus influenzae (strain PittGG) GN=rpsI PE=3 SV=1 179 301 5.0E-22
sp|A5UC54|RS9_HAEIE 30S ribosomal protein S9 OS=Haemophilus influenzae (strain PittEE) GN=rpsI PE=3 SV=1 179 301 5.0E-22
sp|Q4QKG9|RS9_HAEI8 30S ribosomal protein S9 OS=Haemophilus influenzae (strain 86-028NP) GN=rpsI PE=3 SV=1 179 301 5.0E-22
sp|B7VIY4|RS9_VIBTL 30S ribosomal protein S9 OS=Vibrio tasmaniensis (strain LGP32) GN=rpsI PE=3 SV=1 179 301 5.0E-22
sp|B1I1E6|RS9_DESAP 30S ribosomal protein S9 OS=Desulforudis audaxviator (strain MP104C) GN=rpsI PE=3 SV=1 179 301 5.0E-22
sp|Q2K9W4|RS9_RHIEC 30S ribosomal protein S9 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpsI PE=3 SV=1 171 301 5.0E-22
sp|Q9ZDU0|RS9_RICPR 30S ribosomal protein S9 OS=Rickettsia prowazekii (strain Madrid E) GN=rpsI PE=3 SV=1 148 301 6.0E-22
sp|A8GK02|RS9_SERP5 30S ribosomal protein S9 OS=Serratia proteamaculans (strain 568) GN=rpsI PE=3 SV=1 179 301 6.0E-22
sp|B0S3F6|RS9_FINM2 30S ribosomal protein S9 OS=Finegoldia magna (strain ATCC 29328) GN=rpsI PE=3 SV=1 176 301 6.0E-22
sp|Q0AUL6|RS9_SYNWW 30S ribosomal protein S9 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpsI PE=3 SV=1 179 301 7.0E-22
sp|B3PVW3|RS9_RHIE6 30S ribosomal protein S9 OS=Rhizobium etli (strain CIAT 652) GN=rpsI PE=3 SV=1 171 301 7.0E-22
sp|Q7MNX0|RS9_VIBVY 30S ribosomal protein S9 OS=Vibrio vulnificus (strain YJ016) GN=rpsI PE=3 SV=1 179 301 7.0E-22
sp|Q8DEJ0|RS9_VIBVU 30S ribosomal protein S9 OS=Vibrio vulnificus (strain CMCP6) GN=rpsI PE=3 SV=1 179 301 7.0E-22
sp|Q47LM6|RS9_THEFY 30S ribosomal protein S9 OS=Thermobifida fusca (strain YX) GN=rpsI PE=3 SV=1 175 301 7.0E-22
sp|B2ITM7|RS9_NOSP7 30S ribosomal protein S9 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rpsI PE=3 SV=1 175 301 8.0E-22
sp|B8F3F7|RS9_HAEPS 30S ribosomal protein S9 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rpsI PE=3 SV=1 179 301 8.0E-22
sp|Q9A8H6|RS9_CAUCR 30S ribosomal protein S9 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rpsI PE=3 SV=1 160 301 9.0E-22
sp|B8H554|RS9_CAUCN 30S ribosomal protein S9 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rpsI PE=3 SV=1 160 301 9.0E-22
sp|A3DGC4|RS9_CLOTH 30S ribosomal protein S9 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpsI PE=3 SV=1 179 301 9.0E-22
sp|A9EYT5|RS9_SORC5 30S ribosomal protein S9 OS=Sorangium cellulosum (strain So ce56) GN=rpsI PE=3 SV=1 176 301 9.0E-22
sp|Q68XD4|RS9_RICTY 30S ribosomal protein S9 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rpsI PE=3 SV=1 148 301 9.0E-22
sp|Q3ZZP2|RS9_DEHMC 30S ribosomal protein S9 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rpsI PE=3 SV=1 178 301 1.0E-21
sp|P44388|RS9_HAEIN 30S ribosomal protein S9 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpsI PE=3 SV=2 179 301 1.0E-21
sp|A6VXZ2|RS9_MARMS 30S ribosomal protein S9 OS=Marinomonas sp. (strain MWYL1) GN=rpsI PE=3 SV=1 179 301 1.0E-21
sp|B2VGU9|RS9_ERWT9 30S ribosomal protein S9 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rpsI PE=3 SV=1 179 301 1.0E-21
sp|Q87DD4|RS9_XYLFT 30S ribosomal protein S9 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|B2IAE7|RS9_XYLF2 30S ribosomal protein S9 OS=Xylella fastidiosa (strain M23) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|A4WF42|RS9_ENT38 30S ribosomal protein S9 OS=Enterobacter sp. (strain 638) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|A4G1T3|RS9_HERAR 30S ribosomal protein S9 OS=Herminiimonas arsenicoxydans GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|Q6DAE6|RS9_PECAS 30S ribosomal protein S9 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|Q3YX18|RS9_SHISS 30S ribosomal protein S9 OS=Shigella sonnei (strain Ss046) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|Q0T058|RS9_SHIF8 30S ribosomal protein S9 OS=Shigella flexneri serotype 5b (strain 8401) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|Q31W98|RS9_SHIBS 30S ribosomal protein S9 OS=Shigella boydii serotype 4 (strain Sb227) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|B2U1V5|RS9_SHIB3 30S ribosomal protein S9 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|A6TEN8|RS9_KLEP7 30S ribosomal protein S9 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|Q1R6B0|RS9_ECOUT 30S ribosomal protein S9 OS=Escherichia coli (strain UTI89 / UPEC) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|B1LGJ6|RS9_ECOSM 30S ribosomal protein S9 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|B6I1U8|RS9_ECOSE 30S ribosomal protein S9 OS=Escherichia coli (strain SE11) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|B7NDK8|RS9_ECOLU 30S ribosomal protein S9 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|P0A7X3|RS9_ECOLI 30S ribosomal protein S9 OS=Escherichia coli (strain K12) GN=rpsI PE=1 SV=2 179 301 2.0E-21
sp|B1IQP9|RS9_ECOLC 30S ribosomal protein S9 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|P0A7X4|RS9_ECOL6 30S ribosomal protein S9 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpsI PE=3 SV=2 179 301 2.0E-21
sp|Q0TCN6|RS9_ECOL5 30S ribosomal protein S9 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|A1AGC3|RS9_ECOK1 30S ribosomal protein S9 OS=Escherichia coli O1:K1 / APEC GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|A8A539|RS9_ECOHS 30S ribosomal protein S9 OS=Escherichia coli O9:H4 (strain HS) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|B1XHK3|RS9_ECODH 30S ribosomal protein S9 OS=Escherichia coli (strain K12 / DH10B) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|C4ZSW8|RS9_ECOBW 30S ribosomal protein S9 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|B7M0U2|RS9_ECO8A 30S ribosomal protein S9 OS=Escherichia coli O8 (strain IAI1) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|B7N102|RS9_ECO81 30S ribosomal protein S9 OS=Escherichia coli O81 (strain ED1a) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|B7NKU2|RS9_ECO7I 30S ribosomal protein S9 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|B5YSV6|RS9_ECO5E 30S ribosomal protein S9 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|P0A7X5|RS9_ECO57 30S ribosomal protein S9 OS=Escherichia coli O157:H7 GN=rpsI PE=3 SV=2 179 301 2.0E-21
sp|B7LHT8|RS9_ECO55 30S ribosomal protein S9 OS=Escherichia coli (strain 55989 / EAEC) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|B7MBZ1|RS9_ECO45 30S ribosomal protein S9 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|B7UJW2|RS9_ECO27 30S ribosomal protein S9 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|A7ZSC4|RS9_ECO24 30S ribosomal protein S9 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|A8AQC0|RS9_CITK8 30S ribosomal protein S9 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|C5B748|RS9_EDWI9 30S ribosomal protein S9 OS=Edwardsiella ictaluri (strain 93-146) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|A6L0V0|RS9_BACV8 30S ribosomal protein S9 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpsI PE=3 SV=1 179 301 2.0E-21
sp|B9JVC4|RS9_AGRVS 30S ribosomal protein S9 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpsI PE=3 SV=1 171 301 3.0E-21
sp|Q0BZT3|RS9_HYPNA 30S ribosomal protein S9 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpsI PE=3 SV=1 171 301 3.0E-21
sp|C3LS61|RS9_VIBCM 30S ribosomal protein S9 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rpsI PE=3 SV=1 179 301 3.0E-21
sp|Q9KUF0|RS9_VIBCH 30S ribosomal protein S9 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpsI PE=3 SV=1 179 301 3.0E-21
sp|A5F998|RS9_VIBC3 30S ribosomal protein S9 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpsI PE=3 SV=1 179 301 3.0E-21
sp|A1SF28|RS9_NOCSJ 30S ribosomal protein S9 OS=Nocardioides sp. (strain BAA-499 / JS614) GN=rpsI PE=3 SV=1 177 301 3.0E-21
sp|B2A4Q7|RS9_NATTJ 30S ribosomal protein S9 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rpsI PE=3 SV=1 179 301 3.0E-21
sp|Q2NWI3|RS9_SODGM 30S ribosomal protein S9 OS=Sodalis glossinidius (strain morsitans) GN=rpsI PE=3 SV=1 179 301 3.0E-21
sp|Q47VT2|RS9_COLP3 30S ribosomal protein S9 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rpsI PE=3 SV=1 179 301 3.0E-21
sp|Q6FZQ5|RS9_BARQU 30S ribosomal protein S9 OS=Bartonella quintana (strain Toulouse) GN=rpsI PE=3 SV=1 171 301 3.0E-21
sp|Q65T21|RS9_MANSM 30S ribosomal protein S9 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpsI PE=3 SV=1 179 301 3.0E-21
sp|A5FRV9|RS9_DEHMB 30S ribosomal protein S9 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rpsI PE=3 SV=1 178 301 4.0E-21
sp|Q03EE9|RS9_PEDPA 30S ribosomal protein S9 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpsI PE=3 SV=1 179 301 4.0E-21
sp|Q3Z949|RS9_DEHM1 30S ribosomal protein S9 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rpsI PE=3 SV=1 178 301 4.0E-21
sp|P66643|RS9_SALTY 30S ribosomal protein S9 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpsI PE=1 SV=2 179 301 4.0E-21
sp|P66644|RS9_SALTI 30S ribosomal protein S9 OS=Salmonella typhi GN=rpsI PE=3 SV=2 179 301 4.0E-21
sp|B4TWJ4|RS9_SALSV 30S ribosomal protein S9 OS=Salmonella schwarzengrund (strain CVM19633) GN=rpsI PE=3 SV=1 179 301 4.0E-21
sp|B5BGP9|RS9_SALPK 30S ribosomal protein S9 OS=Salmonella paratyphi A (strain AKU_12601) GN=rpsI PE=3 SV=1 179 301 4.0E-21
sp|A9N839|RS9_SALPB 30S ribosomal protein S9 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpsI PE=3 SV=1 179 301 4.0E-21
sp|Q5PJS6|RS9_SALPA 30S ribosomal protein S9 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpsI PE=3 SV=1 179 301 4.0E-21
sp|B4T754|RS9_SALNS 30S ribosomal protein S9 OS=Salmonella newport (strain SL254) GN=rpsI PE=3 SV=1 179 301 4.0E-21
sp|B4TJR8|RS9_SALHS 30S ribosomal protein S9 OS=Salmonella heidelberg (strain SL476) GN=rpsI PE=3 SV=1 179 301 4.0E-21
sp|B5R0L7|RS9_SALEP 30S ribosomal protein S9 OS=Salmonella enteritidis PT4 (strain P125109) GN=rpsI PE=3 SV=1 179 301 4.0E-21
sp|B5FIS2|RS9_SALDC 30S ribosomal protein S9 OS=Salmonella dublin (strain CT_02021853) GN=rpsI PE=3 SV=1 179 301 4.0E-21
sp|Q57JC4|RS9_SALCH 30S ribosomal protein S9 OS=Salmonella choleraesuis (strain SC-B67) GN=rpsI PE=3 SV=1 179 301 4.0E-21
sp|A9MNY1|RS9_SALAR 30S ribosomal protein S9 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rpsI PE=3 SV=1 179 301 4.0E-21
sp|B5F7K4|RS9_SALA4 30S ribosomal protein S9 OS=Salmonella agona (strain SL483) GN=rpsI PE=3 SV=1 179 301 4.0E-21
sp|B5XSS2|RS9_KLEP3 30S ribosomal protein S9 OS=Klebsiella pneumoniae (strain 342) GN=rpsI PE=3 SV=1 179 301 4.0E-21
sp|B7LRJ8|RS9_ESCF3 30S ribosomal protein S9 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rpsI PE=3 SV=1 179 301 4.0E-21
sp|B1VA58|RS9_PHYAS 30S ribosomal protein S9 OS=Phytoplasma australiense GN=rpsI PE=3 SV=1 178 301 4.0E-21
sp|A1WYS8|RS9_HALHL 30S ribosomal protein S9 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rpsI PE=3 SV=1 179 301 4.0E-21
sp|B4EXM0|RS9_PROMH 30S ribosomal protein S9 OS=Proteus mirabilis (strain HI4320) GN=rpsI PE=3 SV=1 179 301 4.0E-21
sp|Q83Q07|RS9_SHIFL 30S ribosomal protein S9 OS=Shigella flexneri GN=rpsI PE=3 SV=3 179 301 5.0E-21
sp|C1B057|RS9_RHOOB 30S ribosomal protein S9 OS=Rhodococcus opacus (strain B4) GN=rpsI PE=3 SV=1 142 301 5.0E-21
sp|B0TC92|RS9_HELMI 30S ribosomal protein S9 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpsI PE=3 SV=1 178 301 5.0E-21
sp|C0PZN9|RS9_SALPC 30S ribosomal protein S9 OS=Salmonella paratyphi C (strain RKS4594) GN=rpsI PE=3 SV=1 179 301 5.0E-21
sp|B4UBJ2|RS9_ANASK 30S ribosomal protein S9 OS=Anaeromyxobacter sp. (strain K) GN=rpsI PE=3 SV=1 178 301 5.0E-21
sp|Q2IEX8|RS9_ANADE 30S ribosomal protein S9 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rpsI PE=3 SV=1 178 301 5.0E-21
sp|B8J5I5|RS9_ANAD2 30S ribosomal protein S9 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rpsI PE=3 SV=1 178 301 5.0E-21
sp|Q7N079|RS9_PHOLL 30S ribosomal protein S9 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpsI PE=3 SV=1 179 301 5.0E-21
sp|C6DIQ2|RS9_PECCP 30S ribosomal protein S9 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rpsI PE=3 SV=1 179 301 5.0E-21
sp|Q8A0Z5|RS9_BACTN 30S ribosomal protein S9 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpsI PE=3 SV=1 179 301 5.0E-21
sp|B1JL67|RS9_YERPY 30S ribosomal protein S9 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rpsI PE=3 SV=1 179 301 6.0E-21
sp|Q665L0|RS9_YERPS 30S ribosomal protein S9 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpsI PE=3 SV=1 179 301 6.0E-21
sp|A4THJ2|RS9_YERPP 30S ribosomal protein S9 OS=Yersinia pestis (strain Pestoides F) GN=rpsI PE=3 SV=1 179 301 6.0E-21
sp|Q1CE09|RS9_YERPN 30S ribosomal protein S9 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpsI PE=3 SV=1 179 301 6.0E-21
sp|A9R1R9|RS9_YERPG 30S ribosomal protein S9 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rpsI PE=3 SV=1 179 301 6.0E-21
sp|Q8ZB62|RS9_YERPE 30S ribosomal protein S9 OS=Yersinia pestis GN=rpsI PE=3 SV=1 179 301 6.0E-21
sp|B2K3Z6|RS9_YERPB 30S ribosomal protein S9 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rpsI PE=3 SV=1 179 301 6.0E-21
sp|Q1C1G9|RS9_YERPA 30S ribosomal protein S9 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpsI PE=3 SV=1 179 301 6.0E-21
sp|A7FDX5|RS9_YERP3 30S ribosomal protein S9 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpsI PE=3 SV=1 179 301 6.0E-21
sp|C4KZL2|RS9_EXISA 30S ribosomal protein S9 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rpsI PE=3 SV=1 176 301 7.0E-21
sp|A6LPU7|RS9_CLOB8 30S ribosomal protein S9 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rpsI PE=3 SV=1 178 301 7.0E-21
sp|C1D165|RS9_DEIDV 30S ribosomal protein S9 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=rpsI PE=3 SV=1 179 301 7.0E-21
sp|B1YH85|RS9_EXIS2 30S ribosomal protein S9 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpsI PE=3 SV=1 176 301 7.0E-21
sp|A9C178|RS9_DELAS 30S ribosomal protein S9 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rpsI PE=3 SV=1 179 301 8.0E-21
sp|Q8K9G0|RS9_BUCAP 30S ribosomal protein S9 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rpsI PE=3 SV=1 179 301 9.0E-21
sp|Q493Y5|RS9_BLOPB 30S ribosomal protein S9 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rpsI PE=3 SV=1 179 301 9.0E-21
sp|Q890R7|RS9_CLOTE 30S ribosomal protein S9 OS=Clostridium tetani (strain Massachusetts / E88) GN=rpsI PE=3 SV=1 179 301 1.0E-20
sp|Q83AX9|RS9_COXBU 30S ribosomal protein S9 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpsI PE=3 SV=1 178 301 1.0E-20
sp|A9NAB0|RS9_COXBR 30S ribosomal protein S9 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rpsI PE=3 SV=1 178 301 1.0E-20
sp|A9KBY1|RS9_COXBN 30S ribosomal protein S9 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rpsI PE=3 SV=1 178 301 1.0E-20
sp|B6J2V0|RS9_COXB2 30S ribosomal protein S9 OS=Coxiella burnetii (strain CbuG_Q212) GN=rpsI PE=3 SV=1 178 301 1.0E-20
sp|A1K970|RS9_AZOSB 30S ribosomal protein S9 OS=Azoarcus sp. (strain BH72) GN=rpsI PE=3 SV=1 179 301 1.0E-20
sp|Q2YBK3|RS9_NITMU 30S ribosomal protein S9 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rpsI PE=3 SV=1 177 301 1.0E-20
sp|A0PXY2|RS9_CLONN 30S ribosomal protein S9 OS=Clostridium novyi (strain NT) GN=rpsI PE=3 SV=1 179 301 1.0E-20
sp|B8DPL8|RS9_DESVM 30S ribosomal protein S9 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rpsI PE=3 SV=1 179 301 1.0E-20
sp|A2SKM0|RS9_METPP 30S ribosomal protein S9 OS=Methylibium petroleiphilum (strain PM1) GN=rpsI PE=3 SV=1 179 301 1.0E-20
sp|A1JR92|RS9_YERE8 30S ribosomal protein S9 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpsI PE=3 SV=1 179 301 1.0E-20
sp|A6LHM6|RS9_PARD8 30S ribosomal protein S9 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpsI PE=3 SV=1 179 301 2.0E-20
sp|B1Y3K6|RS9_LEPCP 30S ribosomal protein S9 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rpsI PE=3 SV=1 179 301 2.0E-20
sp|A6SUN8|RS9_JANMA 30S ribosomal protein S9 OS=Janthinobacterium sp. (strain Marseille) GN=rpsI PE=3 SV=1 179 301 2.0E-20
sp|B2TIL1|RS9_CLOBB 30S ribosomal protein S9 OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rpsI PE=3 SV=1 178 301 2.0E-20
sp|A1W3P8|RS9_ACISJ 30S ribosomal protein S9 OS=Acidovorax sp. (strain JS42) GN=rpsI PE=3 SV=1 179 301 2.0E-20
sp|B9MD53|RS9_ACIET 30S ribosomal protein S9 OS=Acidovorax ebreus (strain TPSY) GN=rpsI PE=3 SV=1 179 301 2.0E-20
sp|B3EU85|RS9_AMOA5 30S ribosomal protein S9 OS=Amoebophilus asiaticus (strain 5a2) GN=rpsI PE=3 SV=1 179 301 2.0E-20
sp|B0JY34|RS9_MICAN 30S ribosomal protein S9 OS=Microcystis aeruginosa (strain NIES-843) GN=rpsI PE=3 SV=1 179 301 2.0E-20
sp|A1TUF5|RS9_ACIAC 30S ribosomal protein S9 OS=Acidovorax citrulli (strain AAC00-1) GN=rpsI PE=3 SV=1 179 301 2.0E-20
sp|B9K8D3|RS9_THENN 30S ribosomal protein S9 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rpsI PE=3 SV=1 179 301 2.0E-20
sp|B1XJI0|RS9_SYNP2 30S ribosomal protein S9 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rpsI PE=3 SV=1 179 301 2.0E-20
sp|B1KSI9|RS9_CLOBM 30S ribosomal protein S9 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rpsI PE=3 SV=1 179 301 2.0E-20
sp|A7GJ38|RS9_CLOBL 30S ribosomal protein S9 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rpsI PE=3 SV=1 179 301 2.0E-20
sp|B1IGB8|RS9_CLOBK 30S ribosomal protein S9 OS=Clostridium botulinum (strain Okra / Type B1) GN=rpsI PE=3 SV=1 179 301 2.0E-20
sp|C1FMR5|RS9_CLOBJ 30S ribosomal protein S9 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=rpsI PE=3 SV=1 179 301 2.0E-20
sp|A5I7H0|RS9_CLOBH 30S ribosomal protein S9 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rpsI PE=3 SV=1 179 301 2.0E-20
sp|C3KVL5|RS9_CLOB6 30S ribosomal protein S9 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=rpsI PE=3 SV=1 179 301 2.0E-20
sp|A7FZ37|RS9_CLOB1 30S ribosomal protein S9 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rpsI PE=3 SV=1 179 301 2.0E-20
sp|Q475T2|RS9_CUPPJ 30S ribosomal protein S9 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rpsI PE=3 SV=1 179 301 2.0E-20
sp|B0U6Z5|RS9_XYLFM 30S ribosomal protein S9 OS=Xylella fastidiosa (strain M12) GN=rpsI PE=3 SV=1 179 301 3.0E-20
sp|A1VJJ4|RS9_POLNA 30S ribosomal protein S9 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rpsI PE=3 SV=1 179 301 3.0E-20
sp|Q220T1|RS9_RHOFT 30S ribosomal protein S9 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rpsI PE=3 SV=1 179 301 3.0E-20
sp|Q1LRC9|RS9_CUPMC 30S ribosomal protein S9 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rpsI PE=3 SV=1 179 301 3.0E-20
sp|Q63QW4|RS9_BURPS 30S ribosomal protein S9 OS=Burkholderia pseudomallei (strain K96243) GN=rpsI PE=3 SV=1 179 301 3.0E-20
sp|A1BHZ6|RS9_CHLPD 30S ribosomal protein S9 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rpsI PE=3 SV=1 181 301 3.0E-20
sp|Q9CNB1|RS9_PASMU 30S ribosomal protein S9 OS=Pasteurella multocida (strain Pm70) GN=rpsI PE=3 SV=1 179 301 4.0E-20
sp|Q124N7|RS9_POLSJ 30S ribosomal protein S9 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpsI PE=3 SV=1 179 301 4.0E-20
sp|P59514|RS9_BUCBP 30S ribosomal protein S9 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rpsI PE=3 SV=1 179 301 4.0E-20
sp|B2UYE6|RS9_CLOBA 30S ribosomal protein S9 OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rpsI PE=3 SV=1 178 301 4.0E-20
sp|B8DB44|RS9_LISMH 30S ribosomal protein S9 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rpsI PE=3 SV=1 179 301 4.0E-20
sp|Q71WI2|RS9_LISMF 30S ribosomal protein S9 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpsI PE=3 SV=1 179 301 4.0E-20
sp|C1KZ11|RS9_LISMC 30S ribosomal protein S9 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rpsI PE=3 SV=1 179 301 4.0E-20
sp|Q927P3|RS9_LISIN 30S ribosomal protein S9 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpsI PE=3 SV=1 179 301 4.0E-20
sp|A9VPB1|RS9_BACWK 30S ribosomal protein S9 OS=Bacillus weihenstephanensis (strain KBAB4) GN=rpsI PE=3 SV=1 179 301 4.0E-20
sp|A8F8P5|RS9_PSELT 30S ribosomal protein S9 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rpsI PE=3 SV=1 181 301 5.0E-20
sp|Q0KED8|RS9_CUPNH 30S ribosomal protein S9 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rpsI PE=3 SV=1 179 301 5.0E-20
sp|A3NDG7|RS9_BURP6 30S ribosomal protein S9 OS=Burkholderia pseudomallei (strain 668) GN=rpsI PE=3 SV=1 179 301 5.0E-20
sp|Q3JNR2|RS9_BURP1 30S ribosomal protein S9 OS=Burkholderia pseudomallei (strain 1710b) GN=rpsI PE=3 SV=1 179 301 5.0E-20
sp|A3NZ79|RS9_BURP0 30S ribosomal protein S9 OS=Burkholderia pseudomallei (strain 1106a) GN=rpsI PE=3 SV=1 179 301 5.0E-20
sp|A1V052|RS9_BURMS 30S ribosomal protein S9 OS=Burkholderia mallei (strain SAVP1) GN=rpsI PE=3 SV=1 179 301 5.0E-20
sp|Q62HB9|RS9_BURMA 30S ribosomal protein S9 OS=Burkholderia mallei (strain ATCC 23344) GN=rpsI PE=3 SV=1 179 301 5.0E-20
sp|A2S582|RS9_BURM9 30S ribosomal protein S9 OS=Burkholderia mallei (strain NCTC 10229) GN=rpsI PE=3 SV=1 179 301 5.0E-20
sp|A3MP60|RS9_BURM7 30S ribosomal protein S9 OS=Burkholderia mallei (strain NCTC 10247) GN=rpsI PE=3 SV=1 179 301 5.0E-20
sp|B7J1R3|RS9_BORBZ 30S ribosomal protein S9 OS=Borrelia burgdorferi (strain ZS7) GN=rpsI PE=3 SV=1 177 301 6.0E-20
sp|O51313|RS9_BORBU 30S ribosomal protein S9 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rpsI PE=3 SV=1 177 301 6.0E-20
sp|C5CDI2|RS9_KOSOT 30S ribosomal protein S9 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rpsI PE=3 SV=1 178 301 6.0E-20
sp|A9AH80|RS9_BURM1 30S ribosomal protein S9 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rpsI PE=3 SV=1 179 301 6.0E-20
sp|B6J4Q5|RS9_COXB1 30S ribosomal protein S9 OS=Coxiella burnetii (strain CbuK_Q154) GN=rpsI PE=3 SV=1 178 301 6.0E-20
sp|Q0SNH4|RS9_BORAP 30S ribosomal protein S9 OS=Borrelia afzelii (strain PKo) GN=rpsI PE=3 SV=1 177 301 7.0E-20
sp|B2AH58|RS9_CUPTR 30S ribosomal protein S9 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rpsI PE=3 SV=1 179 301 7.0E-20
sp|B1LBJ1|RS9_THESQ 30S ribosomal protein S9 OS=Thermotoga sp. (strain RQ2) GN=rpsI PE=3 SV=1 179 301 8.0E-20
sp|A6Q6P0|RS9_SULNB 30S ribosomal protein S9 OS=Sulfurovum sp. (strain NBC37-1) GN=rpsI PE=3 SV=1 179 301 8.0E-20
sp|Q9X1G4|RS9_THEMA 30S ribosomal protein S9 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsI PE=3 SV=1 179 301 9.0E-20
sp|A7GK54|RS9_BACCN 30S ribosomal protein S9 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpsI PE=3 SV=1 179 301 1.0E-19
sp|Q661S9|RS9_BORBP 30S ribosomal protein S9 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rpsI PE=3 SV=1 177 301 1.0E-19
sp|Q81VP8|RS9_BACAN 30S ribosomal protein S9 OS=Bacillus anthracis GN=rpsI PE=3 SV=1 179 301 1.0E-19
sp|C3LJX8|RS9_BACAC 30S ribosomal protein S9 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rpsI PE=3 SV=1 179 301 1.0E-19
sp|C3PAK4|RS9_BACAA 30S ribosomal protein S9 OS=Bacillus anthracis (strain A0248) GN=rpsI PE=3 SV=1 179 301 1.0E-19
sp|Q38UV5|RS9_LACSS 30S ribosomal protein S9 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpsI PE=3 SV=1 179 301 1.0E-19
sp|B2JGV1|RS9_BURP8 30S ribosomal protein S9 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rpsI PE=3 SV=1 179 301 1.0E-19
sp|B2UFK2|RS9_RALPJ 30S ribosomal protein S9 OS=Ralstonia pickettii (strain 12J) GN=rpsI PE=3 SV=1 179 301 1.0E-19
sp|Q8NST5|RS9_CORGL 30S ribosomal protein S9 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=rpsI PE=3 SV=1 169 301 1.0E-19
sp|A4QBS4|RS9_CORGB 30S ribosomal protein S9 OS=Corynebacterium glutamicum (strain R) GN=rpsI PE=3 SV=1 169 301 1.0E-19
sp|B8I816|RS9_CLOCE 30S ribosomal protein S9 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=rpsI PE=3 SV=1 179 301 1.0E-19
sp|A0ALT2|RS9_LISW6 30S ribosomal protein S9 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpsI PE=3 SV=1 179 301 1.0E-19
sp|Q18CJ5|RS9_PEPD6 30S ribosomal protein S9 OS=Peptoclostridium difficile (strain 630) GN=rpsI PE=3 SV=1 179 301 1.0E-19
sp|C6C1K0|RS9_DESAD 30S ribosomal protein S9 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rpsI PE=3 SV=1 179 301 1.0E-19
sp|B1HMU8|RS9_LYSSC 30S ribosomal protein S9 OS=Lysinibacillus sphaericus (strain C3-41) GN=rpsI PE=3 SV=1 178 301 1.0E-19
sp|Q3B5U1|RS9_CHLL7 30S ribosomal protein S9 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rpsI PE=3 SV=1 181 301 1.0E-19
sp|Q8PD66|RS9_XANCP 30S ribosomal protein S9 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpsI PE=3 SV=1 179 301 1.0E-19
sp|B0RN06|RS9_XANCB 30S ribosomal protein S9 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rpsI PE=3 SV=1 179 301 1.0E-19
sp|Q4UZF1|RS9_XANC8 30S ribosomal protein S9 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpsI PE=3 SV=1 179 301 1.0E-19
sp|B3QLF6|RS9_CHLP8 30S ribosomal protein S9 OS=Chlorobaculum parvum (strain NCIB 8327) GN=rpsI PE=3 SV=1 179 284 1.0E-19
sp|Q2SZ68|RS9_BURTA 30S ribosomal protein S9 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rpsI PE=3 SV=1 179 301 1.0E-19
sp|Q1WSC3|RS9_LACS1 30S ribosomal protein S9 OS=Lactobacillus salivarius (strain UCC118) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|B0T0S3|RS9_CAUSK 30S ribosomal protein S9 OS=Caulobacter sp. (strain K31) GN=rpsI PE=3 SV=1 160 301 2.0E-19
sp|B6YQS6|RS9_AZOPC 30S ribosomal protein S9 OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|Q3BYA8|RS9_XANC5 30S ribosomal protein S9 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|Q8PQ41|RS9_XANAC 30S ribosomal protein S9 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|Q5GV67|RS9_XANOR 30S ribosomal protein S9 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|B2SL10|RS9_XANOP 30S ribosomal protein S9 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|Q2NYE4|RS9_XANOM 30S ribosomal protein S9 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|A4JBK5|RS9_BURVG 30S ribosomal protein S9 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|A5IMD2|RS9_THEP1 30S ribosomal protein S9 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|A1WL75|RS9_VEREI 30S ribosomal protein S9 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|P31177|RS9_STACT 30S ribosomal protein S9 OS=Staphylococcus carnosus (strain TM300) GN=rpsI PE=3 SV=2 179 301 2.0E-19
sp|Q6HPM5|RS9_BACHK 30S ribosomal protein S9 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|Q63H57|RS9_BACCZ 30S ribosomal protein S9 OS=Bacillus cereus (strain ZK / E33L) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|Q81J12|RS9_BACCR 30S ribosomal protein S9 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|B9IZM8|RS9_BACCQ 30S ribosomal protein S9 OS=Bacillus cereus (strain Q1) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|B7HQX8|RS9_BACC7 30S ribosomal protein S9 OS=Bacillus cereus (strain AH187) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|B7HJJ1|RS9_BACC4 30S ribosomal protein S9 OS=Bacillus cereus (strain B4264) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|C1ET73|RS9_BACC3 30S ribosomal protein S9 OS=Bacillus cereus (strain 03BB102) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|B7IT53|RS9_BACC2 30S ribosomal protein S9 OS=Bacillus cereus (strain G9842) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|Q73F62|RS9_BACC1 30S ribosomal protein S9 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|B7JKF4|RS9_BACC0 30S ribosomal protein S9 OS=Bacillus cereus (strain AH820) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|A0R8L3|RS9_BACAH 30S ribosomal protein S9 OS=Bacillus thuringiensis (strain Al Hakam) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|A6TWE6|RS9_ALKMQ 30S ribosomal protein S9 OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|A0T0K2|RR9_PHATC 30S ribosomal protein S9, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rps9 PE=3 SV=1 163 301 2.0E-19
sp|Q39JJ9|RS9_BURL3 30S ribosomal protein S9 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|B4EET5|RS9_BURCJ 30S ribosomal protein S9 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|A0K4K6|RS9_BURCH 30S ribosomal protein S9 OS=Burkholderia cenocepacia (strain HI2424) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|B1JVU5|RS9_BURCC 30S ribosomal protein S9 OS=Burkholderia cenocepacia (strain MC0-3) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|Q1BZ44|RS9_BURCA 30S ribosomal protein S9 OS=Burkholderia cenocepacia (strain AU 1054) GN=rpsI PE=3 SV=1 179 301 2.0E-19
sp|B2FJU3|RS9_STRMK 30S ribosomal protein S9 OS=Stenotrophomonas maltophilia (strain K279a) GN=rpsI PE=3 SV=1 179 301 3.0E-19
sp|B4SLE0|RS9_STRM5 30S ribosomal protein S9 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rpsI PE=3 SV=1 179 301 3.0E-19
sp|Q8RGG8|RS9_FUSNN 30S ribosomal protein S9 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rpsI PE=3 SV=1 172 301 3.0E-19
sp|Q82Z47|RS9_ENTFA 30S ribosomal protein S9 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpsI PE=3 SV=1 179 301 3.0E-19
sp|Q9RXY0|RS9_DEIRA 30S ribosomal protein S9 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rpsI PE=3 SV=1 179 301 3.0E-19
sp|Q054G7|RS9_LEPBL 30S ribosomal protein S9 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=rpsI PE=3 SV=1 179 301 3.0E-19
sp|Q04QG5|RS9_LEPBJ 30S ribosomal protein S9 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=rpsI PE=3 SV=1 179 301 3.0E-19
sp|Q13UB3|RS9_BURXL 30S ribosomal protein S9 OS=Burkholderia xenovorans (strain LB400) GN=rpsI PE=3 SV=1 179 301 3.0E-19
sp|B2SYK9|RS9_BURPP 30S ribosomal protein S9 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rpsI PE=3 SV=1 179 301 3.0E-19
sp|Q9PD43|RS9_XYLFA 30S ribosomal protein S9 OS=Xylella fastidiosa (strain 9a5c) GN=rpsI PE=3 SV=1 179 301 4.0E-19
sp|Q9KGD4|RS9_BACHD 30S ribosomal protein S9 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpsI PE=3 SV=1 179 301 4.0E-19
sp|Q7MX42|RS9_PORGI 30S ribosomal protein S9 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rpsI PE=3 SV=1 179 301 4.0E-19
sp|B2RL63|RS9_PORG3 30S ribosomal protein S9 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rpsI PE=3 SV=1 179 301 4.0E-19
sp|Q2S9X3|RS9_HAHCH 30S ribosomal protein S9 OS=Hahella chejuensis (strain KCTC 2396) GN=rpsI PE=3 SV=1 179 301 4.0E-19
sp|Q0BI90|RS9_BURCM 30S ribosomal protein S9 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpsI PE=3 SV=1 179 301 4.0E-19
sp|B1YTD2|RS9_BURA4 30S ribosomal protein S9 OS=Burkholderia ambifaria (strain MC40-6) GN=rpsI PE=3 SV=1 179 301 4.0E-19
sp|Q02VM1|RS9_LACLS 30S ribosomal protein S9 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpsI PE=3 SV=1 179 301 4.0E-19
sp|A2RP61|RS9_LACLM 30S ribosomal protein S9 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpsI PE=3 SV=1 179 301 4.0E-19
sp|Q9CDG7|RS9_LACLA 30S ribosomal protein S9 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rpsI PE=3 SV=1 179 301 4.0E-19
sp|Q03PZ0|RS9_LACBA 30S ribosomal protein S9 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpsI PE=3 SV=1 179 301 4.0E-19
sp|O67723|RS9_AQUAE 30S ribosomal protein S9 OS=Aquifex aeolicus (strain VF5) GN=rpsI PE=3 SV=1 179 301 5.0E-19
sp|Q0A6F4|RS9_ALKEH 30S ribosomal protein S9 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpsI PE=3 SV=1 179 301 5.0E-19
sp|Q8Y245|RS9_RALSO 30S ribosomal protein S9 OS=Ralstonia solanacearum (strain GMI1000) GN=rpsI PE=3 SV=1 179 301 6.0E-19
sp|Q8Y459|RS9_LISMO 30S ribosomal protein S9 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpsI PE=3 SV=1 179 301 7.0E-19
sp|Q1LU53|RS9_BAUCH 30S ribosomal protein S9 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rpsI PE=3 SV=1 179 301 7.0E-19
sp|C1CC86|RS9_STRZJ 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain JJA) GN=rpsI PE=3 SV=1 179 301 7.0E-19
sp|Q8CWU4|RS9_STRR6 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpsI PE=3 SV=1 179 301 7.0E-19
sp|B2ISM4|RS9_STRPS 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain CGSP14) GN=rpsI PE=3 SV=1 179 301 7.0E-19
sp|B1I922|RS9_STRPI 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpsI PE=3 SV=1 179 301 7.0E-19
sp|C1CB69|RS9_STRP7 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain 70585) GN=rpsI PE=3 SV=1 179 301 7.0E-19
sp|B5E6W9|RS9_STRP4 30S ribosomal protein S9 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpsI PE=3 SV=1 179 301 7.0E-19
sp|Q04MF5|RS9_STRP2 30S ribosomal protein S9 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpsI PE=3 SV=1 179 301 7.0E-19
sp|A1VBD2|RS9_DESVV 30S ribosomal protein S9 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rpsI PE=3 SV=1 179 301 7.0E-19
sp|Q728T3|RS9_DESVH 30S ribosomal protein S9 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rpsI PE=3 SV=1 179 301 7.0E-19
sp|C5D3V1|RS9_GEOSW 30S ribosomal protein S9 OS=Geobacillus sp. (strain WCH70) GN=rpsI PE=3 SV=1 179 301 8.0E-19
sp|C1CPG8|RS9_STRZT 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpsI PE=3 SV=1 179 301 8.0E-19
sp|C1CIH6|RS9_STRZP 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain P1031) GN=rpsI PE=3 SV=1 179 301 8.0E-19
sp|Q97SN4|RS9_STRPN 30S ribosomal protein S9 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpsI PE=3 SV=1 179 301 8.0E-19
sp|B8ZL30|RS9_STRPJ 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpsI PE=3 SV=1 179 301 8.0E-19
sp|P9WH25|RS9_MYCTU 30S ribosomal protein S9 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rpsI PE=1 SV=1 180 301 8.0E-19
sp|P9WH24|RS9_MYCTO 30S ribosomal protein S9 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rpsI PE=3 SV=1 180 301 8.0E-19
sp|A5U8B8|RS9_MYCTA 30S ribosomal protein S9 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=rpsI PE=3 SV=1 180 301 8.0E-19
sp|C1AHQ1|RS9_MYCBT 30S ribosomal protein S9 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=rpsI PE=3 SV=1 180 301 8.0E-19
sp|A1KPC9|RS9_MYCBP 30S ribosomal protein S9 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=rpsI PE=3 SV=1 180 301 8.0E-19
sp|P66640|RS9_MYCBO 30S ribosomal protein S9 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=rpsI PE=3 SV=1 180 301 8.0E-19
sp|Q9MUV1|RR9_MESVI 30S ribosomal protein S9, chloroplastic OS=Mesostigma viride GN=rps9 PE=3 SV=1 178 301 9.0E-19
sp|Q1XDJ7|RR9_PYRYE 30S ribosomal protein S9, chloroplastic OS=Pyropia yezoensis GN=rps9 PE=3 SV=1 179 301 9.0E-19
sp|P51291|RR9_PORPU 30S ribosomal protein S9, chloroplastic OS=Porphyra purpurea GN=rps9 PE=3 SV=1 179 301 9.0E-19
sp|B0C426|RS9_ACAM1 30S ribosomal protein S9 OS=Acaryochloris marina (strain MBIC 11017) GN=rpsI PE=3 SV=1 179 301 1.0E-18
sp|Q7NRT4|RS9_CHRVO 30S ribosomal protein S9 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rpsI PE=3 SV=1 179 301 1.0E-18
sp|B8HNG6|RS9_CYAP4 30S ribosomal protein S9 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=rpsI PE=3 SV=1 178 301 1.0E-18
sp|Q88XU7|RS9_LACPL 30S ribosomal protein S9 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpsI PE=3 SV=1 179 301 1.0E-18
sp|Q9HVY3|RS9_PSEAE 30S ribosomal protein S9 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rpsI PE=3 SV=1 179 301 1.0E-18
sp|Q02H08|RS9_PSEAB 30S ribosomal protein S9 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rpsI PE=3 SV=1 179 301 1.0E-18
sp|B7UZL0|RS9_PSEA8 30S ribosomal protein S9 OS=Pseudomonas aeruginosa (strain LESB58) GN=rpsI PE=3 SV=1 179 301 1.0E-18
sp|A5N4T2|RS9_CLOK5 30S ribosomal protein S9 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpsI PE=3 SV=1 179 301 1.0E-18
sp|B9DYE4|RS9_CLOK1 30S ribosomal protein S9 OS=Clostridium kluyveri (strain NBRC 12016) GN=rpsI PE=3 SV=1 179 301 1.0E-18
sp|Q0AHZ9|RS9_NITEC 30S ribosomal protein S9 OS=Nitrosomonas eutropha (strain C91) GN=rpsI PE=3 SV=1 179 301 2.0E-18
sp|Q11QN5|RS9_CYTH3 30S ribosomal protein S9 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=rpsI PE=3 SV=1 179 301 2.0E-18
sp|Q8DW97|RS9_STRMU 30S ribosomal protein S9 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpsI PE=3 SV=1 179 301 3.0E-18
sp|Q5WLM8|RS9_BACSK 30S ribosomal protein S9 OS=Bacillus clausii (strain KSM-K16) GN=rpsI PE=3 SV=1 179 301 3.0E-18
sp|Q24ZM5|RS9_DESHY 30S ribosomal protein S9 OS=Desulfitobacterium hafniense (strain Y51) GN=rpsI PE=3 SV=1 179 301 3.0E-18
sp|B8FW05|RS9_DESHD 30S ribosomal protein S9 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rpsI PE=3 SV=1 179 301 3.0E-18
sp|Q6ANL9|RS9_DESPS 30S ribosomal protein S9 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rpsI PE=3 SV=1 169 301 4.0E-18
sp|Q49ZD5|RS9_STAS1 30S ribosomal protein S9 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpsI PE=3 SV=1 179 301 4.0E-18
sp|A1ATL0|RS9_PELPD 30S ribosomal protein S9 OS=Pelobacter propionicus (strain DSM 2379) GN=rpsI PE=3 SV=1 179 301 4.0E-18
sp|A6VBA5|RS9_PSEA7 30S ribosomal protein S9 OS=Pseudomonas aeruginosa (strain PA7) GN=rpsI PE=3 SV=1 179 301 4.0E-18
sp|Q20F01|RR9_OLTVI 30S ribosomal protein S9, chloroplastic OS=Oltmannsiellopsis viridis GN=rps9 PE=3 SV=1 178 301 4.0E-18
sp|Q9PPR3|RS9_UREPA 30S ribosomal protein S9 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rpsI PE=3 SV=1 181 301 4.0E-18
sp|B1AJL7|RS9_UREP2 30S ribosomal protein S9 OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=rpsI PE=3 SV=1 181 301 4.0E-18
sp|Q82UK1|RS9_NITEU 30S ribosomal protein S9 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rpsI PE=3 SV=1 179 301 5.0E-18
sp|Q53875|RS9_STRCO 30S ribosomal protein S9 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rpsI PE=3 SV=1 177 301 5.0E-18
sp|Q2NIP5|RS9_AYWBP 30S ribosomal protein S9 OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rpsI PE=3 SV=1 179 301 5.0E-18
sp|A4SDC0|RS9_CHLPM 30S ribosomal protein S9 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rpsI PE=3 SV=1 180 301 5.0E-18
sp|B4U561|RS9_STREM 30S ribosomal protein S9 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rpsI PE=3 SV=1 179 301 5.0E-18
sp|C0M903|RS9_STRE4 30S ribosomal protein S9 OS=Streptococcus equi subsp. equi (strain 4047) GN=rpsI PE=3 SV=1 179 301 5.0E-18
sp|Q6YR77|RS9_ONYPE 30S ribosomal protein S9 OS=Onion yellows phytoplasma (strain OY-M) GN=rpsI PE=3 SV=1 179 301 5.0E-18
sp|A8MLH6|RS9_ALKOO 30S ribosomal protein S9 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpsI PE=3 SV=1 179 301 5.0E-18
sp|A4XBI6|RS9_SALTO 30S ribosomal protein S9 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=rpsI PE=3 SV=1 155 301 6.0E-18
sp|P19459|RR9_GUITH 30S ribosomal protein S9, chloroplastic OS=Guillardia theta GN=rps9 PE=3 SV=2 178 301 6.0E-18
sp|C0MFN0|RS9_STRS7 30S ribosomal protein S9 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpsI PE=3 SV=1 179 301 6.0E-18
sp|Q8ETV3|RS9_OCEIH 30S ribosomal protein S9 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpsI PE=3 SV=1 179 301 7.0E-18
sp|Q03MU5|RS9_STRTD 30S ribosomal protein S9 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpsI PE=3 SV=1 179 301 7.0E-18
sp|Q5M6E6|RS9_STRT2 30S ribosomal protein S9 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpsI PE=3 SV=1 179 301 7.0E-18
sp|Q5M1V6|RS9_STRT1 30S ribosomal protein S9 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpsI PE=3 SV=1 179 301 7.0E-18
sp|Q30Y42|RS9_DESAG 30S ribosomal protein S9 OS=Desulfovibrio alaskensis (strain G20) GN=rpsI PE=3 SV=1 179 301 8.0E-18
sp|B9M6W3|RS9_GEODF 30S ribosomal protein S9 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rpsI PE=3 SV=1 179 301 8.0E-18
sp|Q3A3B7|RS9_PELCD 30S ribosomal protein S9 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rpsI PE=3 SV=1 176 301 1.0E-17
sp|Q4L880|RS9_STAHJ 30S ribosomal protein S9 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpsI PE=3 SV=1 179 301 1.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0043228 non-membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043226 organelle No
GO:1901576 organic substance biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0003674 molecular_function No
GO:0009059 macromolecule biosynthetic process No
GO:0005198 structural molecule activity No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0009058 biosynthetic process No
GO:0043043 peptide biosynthetic process No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7371
MASTLANSLRRRCLQAPRVSLAAWQASSPRMNMRQISQETLSTPIPDPRSIEIPFQGVSCARAVPVSPSYFSRET
KFNDIFVNFTKLLAKYHHLPTLTVAEAPQVPWMKLRLLRVRLGEPIKAAQFAKFRRIAKRLNLIEPSLMPPEVKN
AIKEVLRDINPFLNRPRQLVLDKFGRAVATGKRKESTARAFVVEGTGEVLVNGKPLHEAFGRVHDRESAIWALIA
TQRLDKYNVWALARGGGTTGQSEALALAVAKALAVHEPDLKPALRRAGCITRDPRGVERKKTGHVKARKMPAWRK
R*
Coding >OphauB2|7371
ATGGCTTCGACGCTTGCAAATAGCTTGCGGCGCCGCTGTCTTCAGGCGCCACGAGTGAGCTTAGCTGCCTGGCAA
GCGTCGAGTCCACGGATGAATATGCGTCAAATATCACAGGAAACATTGAGCACGCCTATTCCTGACCCTCGGTCT
ATCGAAATTCCCTTTCAAGGCGTCTCGTGCGCGCGTGCCGTACCGGTCTCGCCCTCGTACTTTTCGCGAGAAACA
AAATTCAATGACATCTTTGTCAATTTCACCAAGCTTCTGGCAAAATATCACCATCTGCCCACTCTTACCGTGGCC
GAGGCGCCTCAAGTGCCATGGATGAAGCTACGATTACTGCGTGTGCGCCTGGGAGAGCCTATCAAAGCTGCTCAA
TTTGCCAAATTTAGACGTATAGCAAAAAGACTTAATCTCATCGAGCCATCGTTGATGCCACCAGAGGTCAAGAAC
GCAATAAAAGAAGTTTTACGAGACATCAATCCCTTCCTCAATCGACCCAGGCAGTTGGTATTGGACAAATTCGGA
CGTGCAGTTGCCACGGGCAAAAGAAAGGAATCGACCGCCCGAGCGTTTGTTGTTGAAGGTACGGGGGAAGTTCTC
GTCAATGGAAAACCGCTACACGAAGCTTTTGGCCGGGTACACGACCGCGAAAGCGCCATCTGGGCGCTTATAGCT
ACCCAAAGACTGGACAAGTACAATGTCTGGGCATTGGCACGAGGAGGCGGAACGACTGGGCAGTCAGAGGCGCTT
GCGCTGGCCGTGGCAAAGGCTCTCGCTGTGCATGAGCCAGATTTGAAGCCAGCACTGAGACGAGCTGGATGCATT
ACGAGGGATCCCAGAGGGGTCGAGAGGAAGAAGACTGGCCACGTCAAAGCCCGCAAGATGCCAGCGTGGAGAAAG
CGATAA
Transcript >OphauB2|7371
ATGGCTTCGACGCTTGCAAATAGCTTGCGGCGCCGCTGTCTTCAGGCGCCACGAGTGAGCTTAGCTGCCTGGCAA
GCGTCGAGTCCACGGATGAATATGCGTCAAATATCACAGGAAACATTGAGCACGCCTATTCCTGACCCTCGGTCT
ATCGAAATTCCCTTTCAAGGCGTCTCGTGCGCGCGTGCCGTACCGGTCTCGCCCTCGTACTTTTCGCGAGAAACA
AAATTCAATGACATCTTTGTCAATTTCACCAAGCTTCTGGCAAAATATCACCATCTGCCCACTCTTACCGTGGCC
GAGGCGCCTCAAGTGCCATGGATGAAGCTACGATTACTGCGTGTGCGCCTGGGAGAGCCTATCAAAGCTGCTCAA
TTTGCCAAATTTAGACGTATAGCAAAAAGACTTAATCTCATCGAGCCATCGTTGATGCCACCAGAGGTCAAGAAC
GCAATAAAAGAAGTTTTACGAGACATCAATCCCTTCCTCAATCGACCCAGGCAGTTGGTATTGGACAAATTCGGA
CGTGCAGTTGCCACGGGCAAAAGAAAGGAATCGACCGCCCGAGCGTTTGTTGTTGAAGGTACGGGGGAAGTTCTC
GTCAATGGAAAACCGCTACACGAAGCTTTTGGCCGGGTACACGACCGCGAAAGCGCCATCTGGGCGCTTATAGCT
ACCCAAAGACTGGACAAGTACAATGTCTGGGCATTGGCACGAGGAGGCGGAACGACTGGGCAGTCAGAGGCGCTT
GCGCTGGCCGTGGCAAAGGCTCTCGCTGTGCATGAGCCAGATTTGAAGCCAGCACTGAGACGAGCTGGATGCATT
ACGAGGGATCCCAGAGGGGTCGAGAGGAAGAAGACTGGCCACGTCAAAGCCCGCAAGATGCCAGCGTGGAGAAAG
CGATAA
Gene >OphauB2|7371
ATGGCTTCGACGCTTGCAAATAGCTTGCGGCGCCGCTGTCTTCAGGCGCCACGAGTGAGCTTAGCTGCCTGGCAA
GCGTCGAGTCCACGGATGAATATGCGTCAAATATCACAGGAAACATTGAGCACGCCTATTCCTGACCCTCGGTCT
ATCGAAATTCCCTTTCAAGGCGTCTCGTGCGCGCGTGCCGTACCGGTCTCGCCCTCGTACTTTTCGCGAGAAACA
AAATTCAATGACATCTTTGTCAATTTCACCAAGCTTCTGGCAAAATATCACCATCTGCCCACTCTTACCGTGGCC
GAGGCGCCTCAAGTGCCATGGATGAAGCTACGATTACTGCGTGTGCGCCTGGGAGAGCCTATCAAAGCTGCTCAA
TTTGCCAAATTTAGACGTATAGCAAAAAGACTTAATCTCATCGAGCCATCGTTGATGCCACCAGAGGTCAAGAAC
GCAATAAAAGAAGTTTTACGAGACATCAATCCCTTCCTCAATCGACCCAGGCAGTTGGTATTGGACAAATTCGGA
CGTGCAGTTGCCACGGGCAAAAGAAAGGAATCGACCGCCCGAGCGTTTGTTGTTGAAGGTACGGGGGAAGTTCTC
GTCAATGGAAAACCGCTACACGAAGCTTTTGGCCGGGTACACGACCGCGAAAGCGCCATCTGGGCGCTTATAGCT
ACCCAAAGACTGGACAAGTACAATGTCTGGGCATTGGCACGAGGAGGCGGAACGACTGGGCAGTCAGAGGCGCTT
GCGCTGGCCGTGGCAAAGGCTCTCGCTGTGCATGAGCCAGATTTGAAGCCAGCACTGAGACGAGGTAAGGACCAT
TATTGGTCAATGCTGTATGCATGTCATTTCACAATGCTAATCCGTTGCCATCTCGTCAGCTGGATGCATTACGAG
GGATCCCAGAGGGGTCGAGAGGAAGAAGACTGGCCACGTCAAAGCCCGCAAGATGCCAGCGTGGAGAAAGCGATA
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail