Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7358
Gene name
LocationContig_78:86665..87708
Strand+
Gene length (bp)1043
Transcript length (bp)753
Coding sequence length (bp)753
Protein length (aa) 251

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10294 Methyltransf_16 Lysine methyltransferase 1.2E-40 41 204

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53970|EFM6_YEAST Protein-lysine N-methyltransferase EFM6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFM6 PE=1 SV=1 19 230 9.0E-31
sp|Q8C436|MT21D_MOUSE Protein-lysine methyltransferase METTL21D OS=Mus musculus GN=Vcpkmt PE=2 SV=2 52 234 1.0E-14
sp|Q9H867|MT21D_HUMAN Protein-lysine methyltransferase METTL21D OS=Homo sapiens GN=VCPKMT PE=1 SV=2 52 192 3.0E-14
sp|A4IGU3|MT21A_XENTR Protein N-lysine methyltransferase METTL21A OS=Xenopus tropicalis GN=mettl21a PE=2 SV=1 50 213 5.0E-13
sp|Q5BLD8|MT21A_DANRE Protein N-lysine methyltransferase METTL21A OS=Danio rerio GN=mettl21a PE=2 SV=1 82 217 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53970|EFM6_YEAST Protein-lysine N-methyltransferase EFM6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFM6 PE=1 SV=1 19 230 9.0E-31
sp|Q8C436|MT21D_MOUSE Protein-lysine methyltransferase METTL21D OS=Mus musculus GN=Vcpkmt PE=2 SV=2 52 234 1.0E-14
sp|Q9H867|MT21D_HUMAN Protein-lysine methyltransferase METTL21D OS=Homo sapiens GN=VCPKMT PE=1 SV=2 52 192 3.0E-14
sp|A4IGU3|MT21A_XENTR Protein N-lysine methyltransferase METTL21A OS=Xenopus tropicalis GN=mettl21a PE=2 SV=1 50 213 5.0E-13
sp|Q5BLD8|MT21A_DANRE Protein N-lysine methyltransferase METTL21A OS=Danio rerio GN=mettl21a PE=2 SV=1 82 217 1.0E-10
sp|O13926|YF66_SCHPO UPF0665 family protein C23C4.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23C4.06c PE=3 SV=1 58 200 2.0E-10
sp|Q96AZ1|MT21B_HUMAN Protein-lysine methyltransferase METTL21B OS=Homo sapiens GN=METTL21B PE=1 SV=1 50 194 8.0E-09
sp|P0C5J1|F86B2_HUMAN Putative protein N-methyltransferase FAM86B2 OS=Homo sapiens GN=FAM86B2 PE=1 SV=1 54 220 2.0E-08
sp|Q8N7N1|F86B1_HUMAN Putative protein N-methyltransferase FAM86B1 OS=Homo sapiens GN=FAM86B1 PE=2 SV=2 54 220 2.0E-08
sp|Q8WXB1|MT21A_HUMAN Protein N-lysine methyltransferase METTL21A OS=Homo sapiens GN=METTL21A PE=1 SV=2 43 209 6.0E-08
sp|Q96G04|EF2KT_HUMAN Protein-lysine N-methyltransferase EEF2KMT OS=Homo sapiens GN=EEF2KMT PE=1 SV=2 54 178 1.0E-07
sp|A4FV98|MT21B_BOVIN Protein-lysine methyltransferase METTL21B OS=Bos taurus GN=METTL21B PE=2 SV=1 50 192 2.0E-07
sp|A2AA28|MET23_MOUSE Methyltransferase-like protein 23 OS=Mus musculus GN=Mettl23 PE=2 SV=1 54 225 3.0E-07
sp|Q8CDZ2|MT21E_MOUSE Protein-lysine methyltransferase METTL21E OS=Mus musculus GN=Mettl21e PE=2 SV=1 54 212 4.0E-07
sp|A7IQW5|MT21_CAEEL Protein-lysine methyltransferase C42C1.13 OS=Caenorhabditis elegans GN=C42C1.13 PE=3 SV=1 45 210 7.0E-07
sp|Q9CQL0|MT21A_MOUSE Protein N-lysine methyltransferase METTL21A OS=Mus musculus GN=Mettl21A PE=2 SV=1 83 212 7.0E-07
sp|Q6DJF8|MET23_XENLA Methyltransferase-like protein 23 OS=Xenopus laevis GN=mettl23 PE=2 SV=1 54 192 1.0E-06
sp|Q6FJ22|NNT1_CANGA Protein N-methyltransferase NNT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NNT1 PE=3 SV=1 58 205 7.0E-06
sp|Q5RE14|MT21A_PONAB Protein N-lysine methyltransferase METTL21A OS=Pongo abelii GN=METTL21A PE=2 SV=1 43 209 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7358
MRDRSSSPLLDAFAVSEHLTPLPELKQAGLVQIDLDGHLEPPLKYHEDVRLGCGGQTWPAGLLLAKHMLRYHRSQ
LEHHDAILELGAGGGLVGLAVALGCAGKSKVLLTDQDEMVGLARHNIRLNGLESRVTALVLNWGEALPHAVVQQR
PSIILAAECVYFEPAFPLLMQTLKDLLALNAEAVVYFCFKKRRRADLHFVKAARKSFIVDELFDHDRPGFARQAL
HLFSLRGKEAATAKNATINRDAVAS*
Coding >OphauB2|7358
ATGCGAGACCGCTCTTCGTCACCGCTTCTTGACGCCTTTGCCGTCAGCGAGCATCTTACTCCCCTGCCCGAGCTC
AAGCAAGCAGGCCTTGTGCAAATCGACCTCGACGGCCACCTCGAGCCTCCGCTCAAGTATCATGAGGATGTGCGC
TTGGGCTGTGGCGGCCAGACGTGGCCGGCCGGTCTGCTGCTCGCCAAGCATATGCTGCGCTACCACCGGAGCCAA
CTGGAGCATCATGATGCAATATTGGAACTAGGCGCGGGCGGTGGCTTGGTTGGACTGGCAGTGGCGCTGGGGTGC
GCCGGCAAGTCAAAGGTGCTGCTGACGGATCAAGACGAAATGGTTGGCCTGGCACGGCACAATATCCGCCTCAAC
GGGCTAGAGTCGAGAGTGACGGCCCTTGTCCTCAACTGGGGCGAGGCACTACCGCATGCCGTTGTGCAACAGCGG
CCCAGCATCATCTTGGCTGCCGAGTGTGTCTACTTTGAGCCTGCCTTTCCACTGCTCATGCAGACGCTCAAGGAC
CTATTGGCCCTCAACGCCGAGGCTGTAGTCTACTTTTGCTTCAAGAAGCGCCGGCGGGCTGACTTGCATTTTGTC
AAGGCTGCTAGAAAGAGCTTCATCGTCGATGAGCTCTTTGACCACGACAGGCCGGGCTTTGCGCGCCAGGCGCTC
CATCTCTTCAGCCTTCGAGGCAAGGAGGCAGCCACGGCGAAGAATGCAACTATTAACAGAGATGCCGTGGCAAGT
TAG
Transcript >OphauB2|7358
ATGCGAGACCGCTCTTCGTCACCGCTTCTTGACGCCTTTGCCGTCAGCGAGCATCTTACTCCCCTGCCCGAGCTC
AAGCAAGCAGGCCTTGTGCAAATCGACCTCGACGGCCACCTCGAGCCTCCGCTCAAGTATCATGAGGATGTGCGC
TTGGGCTGTGGCGGCCAGACGTGGCCGGCCGGTCTGCTGCTCGCCAAGCATATGCTGCGCTACCACCGGAGCCAA
CTGGAGCATCATGATGCAATATTGGAACTAGGCGCGGGCGGTGGCTTGGTTGGACTGGCAGTGGCGCTGGGGTGC
GCCGGCAAGTCAAAGGTGCTGCTGACGGATCAAGACGAAATGGTTGGCCTGGCACGGCACAATATCCGCCTCAAC
GGGCTAGAGTCGAGAGTGACGGCCCTTGTCCTCAACTGGGGCGAGGCACTACCGCATGCCGTTGTGCAACAGCGG
CCCAGCATCATCTTGGCTGCCGAGTGTGTCTACTTTGAGCCTGCCTTTCCACTGCTCATGCAGACGCTCAAGGAC
CTATTGGCCCTCAACGCCGAGGCTGTAGTCTACTTTTGCTTCAAGAAGCGCCGGCGGGCTGACTTGCATTTTGTC
AAGGCTGCTAGAAAGAGCTTCATCGTCGATGAGCTCTTTGACCACGACAGGCCGGGCTTTGCGCGCCAGGCGCTC
CATCTCTTCAGCCTTCGAGGCAAGGAGGCAGCCACGGCGAAGAATGCAACTATTAACAGAGATGCCGTGGCAAGT
TAG
Gene >OphauB2|7358
ATGCGAGACCGCTCTTCGTCACCGCTTCTTGACGCCTTTGCCGTCAGCGAGCATCTTACTCCCCTGCCCGAGCTC
AAGCAAGCAGGCCTTGTGCAAATCGACCTCGACGGCCACCTCGAGCCTCCGCTCAAGTATCATGAGGATGTGCGC
TTGGGCTGTGGCGGCCAGACGTGGCCGGCCGGTCTGCTGCTCGCCAAGCATATGCTGCGCTACCACCGGAGCCAA
CTGGAGCATCATGATGCAATGTACGGCCGTCTCGTCTAGTATCCGTGTGTCTGCTCTCTGCTTGGCGAGGGGAAA
AAAACGCCTCCTTGTTGCTCTAGTTTCCCCTTGTCTCGTCGTCTCATCTTTCCCCCGCCTTCCCCACTCCTCCTC
TGACCTTGGCTTGCTTGGCTCGGCGCACGCAACAACGAAGAAAAGTGGCTGACCGGGAGCTTGCTTGTCGGATCG
TGCAGATTGGAACTAGGCGCGGGCGGTGGCTTGGTTGGACTGGCAGTGGCGCTGGGGTGCGCCGGCAAGTCAAAG
GTGCTGCTGACGGATCAAGACGAAATGGTTGGCCTGGCACGGCACAATATCCGCCTCAACGGGCTAGAGTCGAGA
GTGACGGCCCTTGTCCTCAACTGGTGAGTTGGGGCGACTTGATTTGGGAGAGAGGGAGAGAGAGAGAGAGAGAGC
TACGTGTCTGACGGCCTTTGGGCTCTAGGGGCGAGGCACTACCGCATGCCGTTGTGCAACAGCGGCCCAGCATCA
TCTTGGCTGCCGAGTGTGTCTACTTTGAGCCTGCCTTTCCACTGCTCATGCAGACGCTCAAGGACCTATTGGCCC
TCAACGCCGAGGCTGTAGTCTACTTTTGCTTCAAGAAGCGCCGGCGGGCTGACTTGCATTTTGTCAAGGCTGCTA
GAAAGAGCTTCATCGTCGATGAGCTCTTTGACCACGACAGGCCGGGCTTTGCGCGCCAGGCGCTCCATCTCTTCA
GCCTTCGAGGCAAGGAGGCAGCCACGGCGAAGAATGCAACTATTAACAGAGATGCCGTGGCAAGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail