Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7351
Gene name
LocationContig_78:66468..67345
Strand+
Gene length (bp)877
Transcript length (bp)666
Coding sequence length (bp)666
Protein length (aa) 222

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e 1.7E-35 12 166

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09127|RL10A_SCHPO 60S ribosomal protein L10-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1001 PE=2 SV=2 1 216 2.0E-120
sp|Q9P769|RL10B_SCHPO 60S ribosomal protein L10-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1002 PE=3 SV=1 1 216 3.0E-120
sp|P41805|RL10_YEAST 60S ribosomal protein L10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL10 PE=1 SV=1 1 221 4.0E-117
sp|O96647|RL10_BOMMA 60S ribosomal protein L10 OS=Bombyx mandarina GN=RpL10 PE=2 SV=1 1 206 2.0E-108
sp|P86048|RL10L_MOUSE 60S ribosomal protein L10-like OS=Mus musculus GN=Rpl10l PE=2 SV=1 1 206 9.0E-108
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09127|RL10A_SCHPO 60S ribosomal protein L10-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1001 PE=2 SV=2 1 216 2.0E-120
sp|Q9P769|RL10B_SCHPO 60S ribosomal protein L10-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1002 PE=3 SV=1 1 216 3.0E-120
sp|P41805|RL10_YEAST 60S ribosomal protein L10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL10 PE=1 SV=1 1 221 4.0E-117
sp|O96647|RL10_BOMMA 60S ribosomal protein L10 OS=Bombyx mandarina GN=RpL10 PE=2 SV=1 1 206 2.0E-108
sp|P86048|RL10L_MOUSE 60S ribosomal protein L10-like OS=Mus musculus GN=Rpl10l PE=2 SV=1 1 206 9.0E-108
sp|Q2TBW8|RL10L_BOVIN 60S ribosomal protein L10-like OS=Bos taurus GN=RPL10L PE=2 SV=1 1 206 9.0E-108
sp|Q6PDV7|RL10_RAT 60S ribosomal protein L10 OS=Rattus norvegicus GN=Rpl10 PE=1 SV=3 1 206 2.0E-107
sp|A9CB60|RL10_PAPAN 60S ribosomal protein L10 OS=Papio anubis GN=RPL10 PE=3 SV=1 1 206 2.0E-107
sp|Q6ZWV3|RL10_MOUSE 60S ribosomal protein L10 OS=Mus musculus GN=Rpl10 PE=1 SV=3 1 206 2.0E-107
sp|P27635|RL10_HUMAN 60S ribosomal protein L10 OS=Homo sapiens GN=RPL10 PE=1 SV=4 1 206 2.0E-107
sp|A8D8X1|RL10_SHEEP 60S ribosomal protein L10 OS=Ovis aries GN=RPL10 PE=2 SV=1 1 206 4.0E-107
sp|Q29195|RL10_PIG 60S ribosomal protein L10 OS=Sus scrofa GN=RPL10 PE=1 SV=3 1 206 4.0E-107
sp|Q9XSI3|RL10_BOVIN 60S ribosomal protein L10 OS=Bos taurus GN=RPL10 PE=2 SV=4 1 206 4.0E-107
sp|Q5R931|RL10_PONAB 60S ribosomal protein L10 OS=Pongo abelii GN=RPL10 PE=2 SV=3 1 206 5.0E-107
sp|Q4R4D3|RL10L_MACFA 60S ribosomal protein L10-like OS=Macaca fascicularis GN=RPL10L PE=2 SV=1 1 206 6.0E-107
sp|O61231|RL10_DROME 60S ribosomal protein L10 OS=Drosophila melanogaster GN=RpL10 PE=1 SV=1 1 206 1.0E-106
sp|Q4R7Y2|RL10_MACFA 60S ribosomal protein L10 OS=Macaca fascicularis GN=RPL10 PE=2 SV=1 1 206 2.0E-105
sp|Q54J69|RL10_DICDI 60S ribosomal protein L10 OS=Dictyostelium discoideum GN=rpl10 PE=1 SV=2 1 208 2.0E-104
sp|Q09533|RL10_CAEEL 60S ribosomal protein L10 OS=Caenorhabditis elegans GN=rpl-10 PE=3 SV=1 1 211 6.0E-104
sp|Q96L21|RL10L_HUMAN 60S ribosomal protein L10-like OS=Homo sapiens GN=RPL10L PE=1 SV=3 1 206 1.0E-103
sp|Q08200|RL10_CHICK 60S ribosomal protein L10 (Fragment) OS=Gallus gallus GN=RPL10 PE=2 SV=1 7 206 3.0E-103
sp|P93847|RL10_SOLME 60S ribosomal protein L10 OS=Solanum melongena GN=RPL10 PE=2 SV=1 1 206 1.0E-99
sp|Q0ITS8|RL101_ORYSJ 60S ribosomal protein L10-1 OS=Oryza sativa subsp. japonica GN=SC34 PE=2 SV=1 1 221 1.0E-99
sp|A2ZCQ7|RL101_ORYSI 60S ribosomal protein L10-1 OS=Oryza sativa subsp. indica GN=SC34 PE=2 SV=2 1 221 1.0E-99
sp|P45633|RL10_MAIZE 60S ribosomal protein L10 OS=Zea mays GN=RPL10 PE=2 SV=1 1 208 1.0E-97
sp|Q9SPB3|RL10_VITRI 60S ribosomal protein L10 OS=Vitis riparia GN=RPL10 PE=2 SV=1 1 206 2.0E-97
sp|Q93W22|RL103_ARATH 60S ribosomal protein L10-3 OS=Arabidopsis thaliana GN=RPL10C PE=2 SV=1 1 206 2.0E-96
sp|Q9M5M7|RL10_EUPES 60S ribosomal protein L10 OS=Euphorbia esula GN=RPL10 PE=2 SV=1 1 206 6.0E-95
sp|Q08770|RL102_ARATH 60S ribosomal protein L10-2 OS=Arabidopsis thaliana GN=RPL10B PE=2 SV=2 1 206 6.0E-95
sp|O22431|RL10_PINTA 60S ribosomal protein L10 OS=Pinus taeda GN=RPL10 PE=2 SV=1 1 206 8.0E-95
sp|Q93VT9|RL101_ARATH 60S ribosomal protein L10-1 OS=Arabidopsis thaliana GN=RPL10A PE=1 SV=1 1 206 1.0E-94
sp|Q0DKF0|RL102_ORYSJ 60S ribosomal protein L10-2 OS=Oryza sativa subsp. japonica GN=SG12 PE=2 SV=1 1 206 2.0E-93
sp|A2Y0T4|RL102_ORYSI 60S ribosomal protein L10-2 OS=Oryza sativa subsp. indica GN=SG12 PE=2 SV=2 1 206 2.0E-93
sp|Q39724|RL10_EUGGR 60S ribosomal protein L10 OS=Euglena gracilis GN=RPL10 PE=2 SV=1 1 206 3.0E-89
sp|Q8SR96|RL10_ENCCU 60S ribosomal protein L10 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPL10 PE=1 SV=1 1 212 5.0E-86
sp|Q235M8|RL10_TETTS 60S ribosomal protein L10 OS=Tetrahymena thermophila (strain SB210) GN=RPL10 PE=1 SV=1 1 206 1.0E-84
sp|Q40592|RL10_TOBAC 60S ribosomal protein L10 (Fragment) OS=Nicotiana tabacum GN=RPL10 PE=2 SV=1 80 206 2.0E-50
sp|Q8TYP2|RL10E_METKA 50S ribosomal protein L10e OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl10e PE=3 SV=1 1 169 1.0E-43
sp|Q9YEY5|RL10E_AERPE 50S ribosomal protein L10e OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl10e PE=3 SV=1 1 167 6.0E-40
sp|O28930|RL10E_ARCFU 50S ribosomal protein L10e OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpl10e PE=3 SV=1 1 170 1.0E-39
sp|A3DM76|RL10E_STAMF 50S ribosomal protein L10e OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rpl10e PE=3 SV=1 1 177 1.0E-39
sp|Q57963|RL10E_METJA 50S ribosomal protein L10e OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl10e PE=3 SV=1 4 170 1.0E-37
sp|B1YDH6|RL10E_PYRNV 50S ribosomal protein L10e OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rpl10e PE=3 SV=1 1 167 1.0E-36
sp|A6USY4|RL10E_META3 50S ribosomal protein L10e OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl10e PE=3 SV=1 1 169 6.0E-36
sp|A3MXP3|RL10E_PYRCJ 50S ribosomal protein L10e OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rpl10e PE=3 SV=1 1 167 9.0E-36
sp|Q12W43|RL10E_METBU 50S ribosomal protein L10e OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rpl10e PE=3 SV=1 1 169 1.0E-35
sp|Q8ZSV4|RL10E_PYRAE 50S ribosomal protein L10e OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpl10e PE=3 SV=1 1 167 2.0E-35
sp|A4WN05|RL10E_PYRAR 50S ribosomal protein L10e OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rpl10e PE=3 SV=1 1 168 2.0E-35
sp|A2BNA6|RL10E_HYPBU 50S ribosomal protein L10e OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rpl10e PE=3 SV=1 1 160 4.0E-35
sp|A1RXM2|RL10E_THEPD 50S ribosomal protein L10e OS=Thermofilum pendens (strain Hrk 5) GN=rpl10e PE=3 SV=1 1 169 9.0E-35
sp|Q0W389|RL10E_METAR 50S ribosomal protein L10e OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rpl10e PE=3 SV=1 1 169 2.0E-34
sp|A1RT11|RL10E_PYRIL 50S ribosomal protein L10e OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rpl10e PE=3 SV=1 1 172 2.0E-34
sp|Q8PWV0|RL10E_METMA 50S ribosomal protein L10e OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpl10e PE=3 SV=1 1 169 5.0E-34
sp|Q4JC84|RL10E_SULAC 50S ribosomal protein L10e OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl10e PE=3 SV=1 1 168 1.0E-33
sp|Q6LXR0|RL10E_METMP 50S ribosomal protein L10e OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl10e PE=3 SV=1 1 169 2.0E-33
sp|A3CTT1|RL10E_METMJ 50S ribosomal protein L10e OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rpl10e PE=3 SV=1 1 166 2.0E-33
sp|Q6L152|RL10E_PICTO 50S ribosomal protein L10e OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rpl10e PE=3 SV=1 1 174 3.0E-33
sp|A6VGM6|RL10E_METM7 50S ribosomal protein L10e OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl10e PE=3 SV=1 1 169 4.0E-33
sp|A9AA25|RL10E_METM6 50S ribosomal protein L10e OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl10e PE=3 SV=1 1 169 4.0E-33
sp|A2SQE9|RL10E_METLZ 50S ribosomal protein L10e OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rpl10e PE=3 SV=1 1 168 6.0E-33
sp|A4FWP5|RL10E_METM5 50S ribosomal protein L10e OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl10e PE=3 SV=1 1 169 9.0E-33
sp|Q8TU90|RL10E_METAC 50S ribosomal protein L10e OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpl10e PE=3 SV=1 1 169 1.0E-32
sp|Q9HJB3|RL10E_THEAC 50S ribosomal protein L10e OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl10e PE=3 SV=2 1 170 1.0E-32
sp|A4YHV3|RL10E_METS5 50S ribosomal protein L10e OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rpl10e PE=3 SV=1 1 179 1.0E-32
sp|O27191|RL10E_METTH 50S ribosomal protein L10e OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl10e PE=3 SV=1 15 169 9.0E-32
sp|Q46CR0|RL10E_METBF 50S ribosomal protein L10e OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl10e PE=3 SV=1 1 169 1.0E-31
sp|P58299|RL10E_THEVO 50S ribosomal protein L10e OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpl10e PE=3 SV=1 1 170 2.0E-31
sp|C6A4T2|RL10E_THESM 50S ribosomal protein L10e OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rpl10e PE=3 SV=1 1 160 3.0E-31
sp|Q9UWP5|RL10E_PYRFU 50S ribosomal protein L10e OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl10e PE=1 SV=1 1 160 6.0E-31
sp|Q96YA4|RL10E_SULTO 50S ribosomal protein L10e OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl10e PE=3 SV=2 1 167 8.0E-31
sp|O58367|RL10E_PYRHO 50S ribosomal protein L10e OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl10e PE=3 SV=1 1 160 1.0E-30
sp|B8GH15|RL10E_METPE 50S ribosomal protein L10e OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=rpl10e PE=3 SV=1 1 169 2.0E-30
sp|C3N7I5|RL10E_SULIY 50S ribosomal protein L10e OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rpl10e PE=3 SV=1 1 179 4.0E-30
sp|C3NFZ1|RL10E_SULIN 50S ribosomal protein L10e OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rpl10e PE=3 SV=1 1 179 4.0E-30
sp|C3MXL7|RL10E_SULIM 50S ribosomal protein L10e OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpl10e PE=3 SV=1 1 179 4.0E-30
sp|C3MRC8|RL10E_SULIL 50S ribosomal protein L10e OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rpl10e PE=3 SV=1 1 179 4.0E-30
sp|C4KIP3|RL10E_SULIK 50S ribosomal protein L10e OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpl10e PE=3 SV=1 1 179 4.0E-30
sp|C3MZG3|RL10E_SULIA 50S ribosomal protein L10e OS=Sulfolobus islandicus (strain M.16.27) GN=rpl10e PE=3 SV=1 1 179 4.0E-30
sp|Q9UYU9|RL10E_PYRAB 50S ribosomal protein L10e OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl10e PE=3 SV=1 1 160 4.0E-30
sp|Q2NHZ0|RL10E_METST 50S ribosomal protein L10e OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpl10e PE=3 SV=1 15 169 6.0E-30
sp|B6YSL0|RL10E_THEON 50S ribosomal protein L10e OS=Thermococcus onnurineus (strain NA1) GN=rpl10e PE=3 SV=1 1 160 2.0E-29
sp|Q980J7|RL10E_SULSO 50S ribosomal protein L10e OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl10e PE=3 SV=1 1 167 6.0E-29
sp|A8MDE4|RL10E_CALMQ 50S ribosomal protein L10e OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rpl10e PE=3 SV=1 1 160 1.0E-28
sp|Q2FLD3|RL10E_METHJ 50S ribosomal protein L10e OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rpl10e PE=3 SV=1 1 167 1.0E-28
sp|P60617|RL10E_HALMA 50S ribosomal protein L10e OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl10e PE=1 SV=2 1 159 2.0E-28
sp|C5A293|RL10E_THEGJ 50S ribosomal protein L10e OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpl10e PE=3 SV=1 1 160 6.0E-28
sp|Q5JDI6|RL10E_THEKO 50S ribosomal protein L10e OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl10e PE=3 SV=1 1 160 2.0E-27
sp|Q9HSS4|RL10E_HALSA 50S ribosomal protein L10e OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl10e PE=3 SV=1 1 159 7.0E-27
sp|B0R2M5|RL10E_HALS3 50S ribosomal protein L10e OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpl10e PE=3 SV=1 1 159 7.0E-27
sp|B9LQR1|RL10E_HALLT 50S ribosomal protein L10e OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rpl10e PE=3 SV=1 1 169 3.0E-26
sp|Q3IU82|RL10E_NATPD 50S ribosomal protein L10e OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rpl10e PE=3 SV=1 1 159 4.0E-24
sp|Q18KD2|RL10E_HALWD 50S ribosomal protein L10e OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rpl10e PE=3 SV=1 1 168 7.0E-24
sp|Q74M84|RL10E_NANEQ 50S ribosomal protein L10e OS=Nanoarchaeum equitans (strain Kin4-M) GN=rpl10e PE=3 SV=1 1 138 3.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0043228 non-membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043226 organelle No
GO:1901576 organic substance biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0003674 molecular_function No
GO:0009059 macromolecule biosynthetic process No
GO:0005198 structural molecule activity No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0009058 biosynthetic process No
GO:0043043 peptide biosynthetic process No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7351
MARRPARCYRYCKNKPFPKSRFNRGVPDPKIRIFDLGRKRANVDDFPLCIHLVSNEYEQLSSEALEAARICANKY
LVKHTGKEGFHLRVRAHPFHVVRINKMLSCAGADRLQTGMRGAWGKPNGTVARVNIGQIIMSVRTRDSNRPLALE
ALRRSQYKFPGRQKIIISKNWGFTPLRREDYLERKAAGRVKVDGAYVQFLKNYGPLKENFERFPQAFQAEA*
Coding >OphauB2|7351
ATGGCGCGTCGTCCTGCTCGTTGCTACCGCTACTGCAAGAATAAGCCGTTTCCCAAGTCTCGGTTCAACCGTGGT
GTCCCCGACCCCAAGATCCGCATCTTCGATCTGGGCCGCAAGCGCGCCAATGTCGACGACTTCCCCCTTTGCATC
CACCTCGTGTCAAACGAATATGAGCAGCTGAGCTCTGAGGCTCTTGAGGCCGCTCGTATCTGTGCCAACAAGTAC
CTGGTCAAGCACACTGGCAAGGAGGGCTTCCATCTCCGTGTCCGCGCCCATCCCTTCCACGTCGTTCGCATCAAC
AAGATGTTGTCTTGCGCCGGCGCCGATAGACTGCAGACTGGTATGCGCGGTGCCTGGGGCAAGCCCAACGGTACC
GTCGCCCGTGTCAACATTGGTCAAATCATCATGAGCGTCCGAACTCGCGACTCGAATCGTCCCCTTGCTCTTGAG
GCTCTGCGACGGTCCCAGTACAAGTTCCCTGGCCGCCAAAAGATCATCATCTCAAAGAACTGGGGCTTCACGCCT
CTCCGTCGTGAGGATTATTTGGAGCGCAAGGCTGCTGGCCGCGTCAAGGTGGACGGCGCCTACGTTCAGTTCCTC
AAGAACTATGGCCCTCTCAAAGAGAACTTTGAGCGTTTCCCCCAAGCCTTCCAGGCTGAAGCCTGA
Transcript >OphauB2|7351
ATGGCGCGTCGTCCTGCTCGTTGCTACCGCTACTGCAAGAATAAGCCGTTTCCCAAGTCTCGGTTCAACCGTGGT
GTCCCCGACCCCAAGATCCGCATCTTCGATCTGGGCCGCAAGCGCGCCAATGTCGACGACTTCCCCCTTTGCATC
CACCTCGTGTCAAACGAATATGAGCAGCTGAGCTCTGAGGCTCTTGAGGCCGCTCGTATCTGTGCCAACAAGTAC
CTGGTCAAGCACACTGGCAAGGAGGGCTTCCATCTCCGTGTCCGCGCCCATCCCTTCCACGTCGTTCGCATCAAC
AAGATGTTGTCTTGCGCCGGCGCCGATAGACTGCAGACTGGTATGCGCGGTGCCTGGGGCAAGCCCAACGGTACC
GTCGCCCGTGTCAACATTGGTCAAATCATCATGAGCGTCCGAACTCGCGACTCGAATCGTCCCCTTGCTCTTGAG
GCTCTGCGACGGTCCCAGTACAAGTTCCCTGGCCGCCAAAAGATCATCATCTCAAAGAACTGGGGCTTCACGCCT
CTCCGTCGTGAGGATTATTTGGAGCGCAAGGCTGCTGGCCGCGTCAAGGTGGACGGCGCCTACGTTCAGTTCCTC
AAGAACTATGGCCCTCTCAAAGAGAACTTTGAGCGTTTCCCCCAAGCCTTCCAGGCTGAAGCCTGA
Gene >OphauB2|7351
ATGGCGCGTCGTCCTGCTCGTTGCTACCGCTACTGCAAGAATAAGGTGAGAATCACCTCATTACCTATATCGCCG
CCGTGCTTGCCAGGTTCCGCCAACGCCACAAGCGCTACCAATGATGAAGACTCTCAAATTGCTGCACATGGCTTA
TACGTATCACATGAATTTCACTTTCTAACAATTCCATTTGATAGCCGTTTCCCAAGTCTCGGTTCAACCGTGGTG
TCCCCGACCCCAAGATCCGCATCTTCGATCTGGGCCGCAAGCGCGCCAATGTCGACGACTTCCCCCTTTGCATCC
ACCTCGTGTCAAACGAATATGAGCAGCTGAGCTCTGAGGCTCTTGAGGCCGCTCGTATCTGTGCCAACAAGTACC
TGGTCAAGCACACTGGCAAGGAGGGCTTCCATCTCCGTGTCCGCGCCCATCCCTTCCACGTCGTTCGCATCAACA
AGATGTTGTCTTGCGCCGGCGCCGATAGACTGCAGACTGGTATGCGCGGTGCCTGGGGCAAGCCCAACGGTACCG
TCGCCCGTGTCAACATTGGTCAAATCATCATGAGCGTCCGAACTCGCGACTCGAGTACGTGTTGGCTAGTGAAGC
AGGCTCACAAGAAGTCATCGTTGTGCTAACCCATATTATAGATCGTCCCCTTGCTCTTGAGGCTCTGCGACGGTC
CCAGTACAAGTTCCCTGGCCGCCAAAAGATCATCATCTCAAAGAACTGGGGCTTCACGCCTCTCCGTCGTGAGGA
TTATTTGGAGCGCAAGGCTGCTGGCCGCGTCAAGGTGGACGGCGCCTACGTTCAGTTCCTCAAGAACTATGGCCC
TCTCAAAGAGAACTTTGAGCGTTTCCCCCAAGCCTTCCAGGCTGAAGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail