Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7345
Gene name
LocationContig_78:44446..46924
Strand-
Gene length (bp)2478
Transcript length (bp)2415
Coding sequence length (bp)2415
Protein length (aa) 805

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12751 Vac7 Vacuolar segregation subunit 7 9.2E-158 281 666

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53950|VAC7_YEAST Vacuolar segregation protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAC7 PE=1 SV=1 556 788 5.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 584 606 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7345
MAPGTPANDSPVASRDTSPTRKPSRKCSIPALATRNAASRSRKNSQQDGSPRRSADFAPAKTLSPSTTPSLLPVA
KEAQALVQAPTPQKPPAVQELKDSPRWPVSPRLRSPPPQLQLHKPSIATPRRCEQEPPVISLQRPSPSPRPPCDP
SPSQSPPETDIDDLPMLPGIRTPARSPLETVQEVSQNNSPARPADKGLVEHVKEKLAPTDTQSDSAVSDSGRLHK
PTVAAMASSDAVASQPESRRTSSVPPPPPLISRQSSALSAKHVKPSKPEGSTQNMTVETETVPSVPQVALTAGTK
SDSGNGTLKAKPSTETIKPRKDKKRMARKQPQVNPGTGSKADIFEAKIANAVDEANTSDSEETFVYDSNPPENAE
RANRRFHSRTPSATSMVSQADRQNLRSIYGIMEAGVHAHPHGPVPKKSMKFVNTFNGNASDSLTPGDEDGKGTGR
SAGGSGRGTARHHHHIGGRWGRQPGNGHASLFDNESPFPNAAKSKLAASASRTSSGPPSPRNFHSTRGHFGTKRS
AMQMSSYDLDEAAGADDERTPLIDSNRSLRNNRVRRGPHNLRQAESQTYTRRSSYLNRFAACLVLTMMLLLVITG
AIGFMFATSQPMDGMEIVSIDNVVTSEQVLMFDLQVKAHNPNIVVVTVSDANLEIFAKSEYAGKDSEWWRHPNSG
GFHAQDDPWDDPPWIPGDDDDDDRRPNVLLGRVTEFDSPLTFEGSLLHQGFSYSTGEMQLAYPGNDTSGGSKRWE
AIYQNEFDLIIKGVVKYSLPLSAHVRSATVSGRTTVKPNAANDPSLTPNTTAQN*
Coding >OphauB2|7345
ATGGCACCCGGCACACCCGCAAATGATTCACCGGTGGCTTCTCGAGACACGTCTCCGACCCGCAAGCCAAGCAGA
AAGTGCTCGATTCCAGCACTGGCCACGAGAAACGCGGCTAGTCGGTCGCGCAAAAATAGCCAACAAGACGGCAGC
CCCAGACGCAGTGCAGACTTTGCTCCCGCAAAGACACTTTCACCCAGCACCACGCCCAGCCTGCTCCCCGTGGCC
AAGGAAGCTCAAGCTCTGGTCCAAGCGCCCACGCCTCAAAAGCCCCCTGCTGTGCAAGAACTCAAAGACAGCCCT
CGTTGGCCCGTGTCGCCTCGTTTGCGCTCTCCTCCGCCCCAGTTGCAATTACACAAACCCAGCATCGCTACACCG
CGCCGCTGTGAGCAAGAGCCTCCTGTAATCAGCCTTCAACGCCCCAGCCCGTCGCCCCGTCCGCCCTGCGACCCG
TCACCCTCGCAGTCGCCTCCAGAAACCGACATCGATGACTTGCCCATGTTGCCTGGAATCCGCACCCCCGCCCGC
AGTCCGTTGGAAACTGTGCAAGAAGTCAGTCAAAACAATTCGCCGGCGCGTCCCGCCGACAAGGGCCTCGTTGAG
CACGTCAAGGAGAAGCTTGCACCTACCGACACCCAGTCAGACAGTGCCGTGAGCGACAGTGGACGCCTGCATAAG
CCCACCGTGGCAGCAATGGCGAGCAGTGACGCTGTTGCTAGCCAGCCCGAGTCACGACGCACCAGTTCTGTCCCT
CCACCGCCGCCCTTGATATCGCGACAGTCTAGTGCTCTGTCGGCCAAGCATGTCAAGCCCAGCAAGCCTGAAGGC
TCTACGCAAAATATGACGGTTGAGACAGAAACTGTGCCCAGCGTCCCTCAAGTTGCCCTGACAGCGGGCACCAAG
TCGGACAGTGGCAACGGCACGCTCAAGGCAAAGCCTAGCACGGAGACAATTAAGCCTCGCAAGGATAAAAAGCGC
ATGGCCCGGAAACAGCCTCAGGTCAATCCAGGAACAGGGTCAAAAGCCGACATCTTTGAGGCCAAGATTGCCAAT
GCGGTCGATGAAGCCAACACTTCGGACTCTGAAGAAACCTTTGTCTACGACTCCAATCCGCCCGAAAATGCCGAG
CGTGCAAACCGCCGCTTTCATTCTCGAACTCCCAGTGCCACTTCAATGGTTAGCCAAGCCGACCGTCAGAACTTG
CGATCTATTTACGGCATCATGGAGGCTGGCGTCCACGCCCATCCCCACGGCCCCGTACCCAAAAAGAGCATGAAG
TTTGTCAATACATTCAACGGCAATGCTAGCGACAGCTTGACTCCGGGCGATGAAGATGGAAAAGGAACGGGCAGA
AGCGCGGGTGGCTCCGGCCGTGGCACTGCTCGACATCACCATCACATTGGCGGCAGATGGGGGCGTCAGCCCGGT
AATGGTCACGCGTCACTTTTCGACAACGAATCACCCTTTCCCAATGCGGCCAAGTCGAAGCTGGCCGCCAGTGCT
TCGCGCACCTCGTCTGGCCCCCCCAGTCCTAGAAACTTCCACTCGACGCGAGGCCATTTTGGCACCAAGCGGTCG
GCCATGCAAATGTCAAGCTACGATCTCGACGAGGCTGCAGGTGCCGATGACGAGCGGACGCCGTTGATTGACTCG
AACCGCTCCTTGAGAAATAACAGAGTCAGACGCGGCCCACACAACCTCCGCCAAGCAGAGTCACAGACTTATACT
AGACGGTCATCCTATCTCAACAGATTTGCCGCCTGCCTCGTCTTGACCATGATGCTGCTCCTCGTCATTACGGGC
GCCATTGGCTTCATGTTTGCCACGTCGCAGCCCATGGACGGCATGGAGATTGTCTCAATTGACAATGTCGTGACG
AGCGAGCAGGTGCTCATGTTTGATCTGCAGGTCAAGGCGCACAACCCAAATATTGTTGTTGTTACAGTCTCTGAT
GCCAATCTGGAGATCTTTGCCAAGTCGGAATACGCAGGCAAAGACTCGGAGTGGTGGAGGCACCCCAACTCTGGC
GGGTTTCATGCTCAAGACGATCCGTGGGACGATCCGCCATGGATACCCGGCGATGACGACGACGACGACCGACGG
CCCAATGTGTTGCTGGGTCGTGTCACCGAGTTTGACAGCCCCCTGACTTTTGAAGGATCGCTGCTCCACCAGGGA
TTTTCGTATTCGACTGGCGAGATGCAACTTGCTTATCCAGGCAACGATACCTCAGGAGGATCCAAACGGTGGGAG
GCCATCTACCAAAACGAGTTTGATCTCATCATCAAGGGCGTAGTCAAATATAGCCTCCCGCTGAGCGCCCACGTA
CGCAGTGCTACCGTCTCGGGGAGGACAACAGTCAAGCCCAATGCCGCAAACGATCCGTCACTAACACCCAATACA
ACTGCTCAAAATTGA
Transcript >OphauB2|7345
ATGGCACCCGGCACACCCGCAAATGATTCACCGGTGGCTTCTCGAGACACGTCTCCGACCCGCAAGCCAAGCAGA
AAGTGCTCGATTCCAGCACTGGCCACGAGAAACGCGGCTAGTCGGTCGCGCAAAAATAGCCAACAAGACGGCAGC
CCCAGACGCAGTGCAGACTTTGCTCCCGCAAAGACACTTTCACCCAGCACCACGCCCAGCCTGCTCCCCGTGGCC
AAGGAAGCTCAAGCTCTGGTCCAAGCGCCCACGCCTCAAAAGCCCCCTGCTGTGCAAGAACTCAAAGACAGCCCT
CGTTGGCCCGTGTCGCCTCGTTTGCGCTCTCCTCCGCCCCAGTTGCAATTACACAAACCCAGCATCGCTACACCG
CGCCGCTGTGAGCAAGAGCCTCCTGTAATCAGCCTTCAACGCCCCAGCCCGTCGCCCCGTCCGCCCTGCGACCCG
TCACCCTCGCAGTCGCCTCCAGAAACCGACATCGATGACTTGCCCATGTTGCCTGGAATCCGCACCCCCGCCCGC
AGTCCGTTGGAAACTGTGCAAGAAGTCAGTCAAAACAATTCGCCGGCGCGTCCCGCCGACAAGGGCCTCGTTGAG
CACGTCAAGGAGAAGCTTGCACCTACCGACACCCAGTCAGACAGTGCCGTGAGCGACAGTGGACGCCTGCATAAG
CCCACCGTGGCAGCAATGGCGAGCAGTGACGCTGTTGCTAGCCAGCCCGAGTCACGACGCACCAGTTCTGTCCCT
CCACCGCCGCCCTTGATATCGCGACAGTCTAGTGCTCTGTCGGCCAAGCATGTCAAGCCCAGCAAGCCTGAAGGC
TCTACGCAAAATATGACGGTTGAGACAGAAACTGTGCCCAGCGTCCCTCAAGTTGCCCTGACAGCGGGCACCAAG
TCGGACAGTGGCAACGGCACGCTCAAGGCAAAGCCTAGCACGGAGACAATTAAGCCTCGCAAGGATAAAAAGCGC
ATGGCCCGGAAACAGCCTCAGGTCAATCCAGGAACAGGGTCAAAAGCCGACATCTTTGAGGCCAAGATTGCCAAT
GCGGTCGATGAAGCCAACACTTCGGACTCTGAAGAAACCTTTGTCTACGACTCCAATCCGCCCGAAAATGCCGAG
CGTGCAAACCGCCGCTTTCATTCTCGAACTCCCAGTGCCACTTCAATGGTTAGCCAAGCCGACCGTCAGAACTTG
CGATCTATTTACGGCATCATGGAGGCTGGCGTCCACGCCCATCCCCACGGCCCCGTACCCAAAAAGAGCATGAAG
TTTGTCAATACATTCAACGGCAATGCTAGCGACAGCTTGACTCCGGGCGATGAAGATGGAAAAGGAACGGGCAGA
AGCGCGGGTGGCTCCGGCCGTGGCACTGCTCGACATCACCATCACATTGGCGGCAGATGGGGGCGTCAGCCCGGT
AATGGTCACGCGTCACTTTTCGACAACGAATCACCCTTTCCCAATGCGGCCAAGTCGAAGCTGGCCGCCAGTGCT
TCGCGCACCTCGTCTGGCCCCCCCAGTCCTAGAAACTTCCACTCGACGCGAGGCCATTTTGGCACCAAGCGGTCG
GCCATGCAAATGTCAAGCTACGATCTCGACGAGGCTGCAGGTGCCGATGACGAGCGGACGCCGTTGATTGACTCG
AACCGCTCCTTGAGAAATAACAGAGTCAGACGCGGCCCACACAACCTCCGCCAAGCAGAGTCACAGACTTATACT
AGACGGTCATCCTATCTCAACAGATTTGCCGCCTGCCTCGTCTTGACCATGATGCTGCTCCTCGTCATTACGGGC
GCCATTGGCTTCATGTTTGCCACGTCGCAGCCCATGGACGGCATGGAGATTGTCTCAATTGACAATGTCGTGACG
AGCGAGCAGGTGCTCATGTTTGATCTGCAGGTCAAGGCGCACAACCCAAATATTGTTGTTGTTACAGTCTCTGAT
GCCAATCTGGAGATCTTTGCCAAGTCGGAATACGCAGGCAAAGACTCGGAGTGGTGGAGGCACCCCAACTCTGGC
GGGTTTCATGCTCAAGACGATCCGTGGGACGATCCGCCATGGATACCCGGCGATGACGACGACGACGACCGACGG
CCCAATGTGTTGCTGGGTCGTGTCACCGAGTTTGACAGCCCCCTGACTTTTGAAGGATCGCTGCTCCACCAGGGA
TTTTCGTATTCGACTGGCGAGATGCAACTTGCTTATCCAGGCAACGATACCTCAGGAGGATCCAAACGGTGGGAG
GCCATCTACCAAAACGAGTTTGATCTCATCATCAAGGGCGTAGTCAAATATAGCCTCCCGCTGAGCGCCCACGTA
CGCAGTGCTACCGTCTCGGGGAGGACAACAGTCAAGCCCAATGCCGCAAACGATCCGTCACTAACACCCAATACA
ACTGCTCAAAATTGA
Gene >OphauB2|7345
ATGGCACCCGGCACACCCGCAAATGATTCACCGGTGGCTTCTCGAGACACGTCTCCGACCCGCAAGCCAAGCAGA
AAGTGCTCGATTCCAGCACTGGCCACGAGAAACGCGGCTAGTCGGTCGCGCAAAAATAGCCAACAAGACGGCAGC
CCCAGACGCAGTGCAGACTTTGCTCCCGCAAAGACACTTTCACCCAGCACCACGCCCAGCCTGCTCCCCGTGGCC
AAGGAAGCTCAAGCTCTGGTCCAAGCGCCCACGCCTCAAAAGCCCCCTGCTGTGCAAGAACTCAAAGACAGCCCT
CGTTGGCCCGTGTCGCCTCGTTTGCGCTCTCCTCCGCCCCAGTTGCAATTACACAAACCCAGCATCGCTACACCG
CGCCGCTGTGAGCAAGAGCCTCCTGTAATCAGCCTTCAACGCCCCAGCCCGTCGCCCCGTCCGCCCTGCGACCCG
TCACCCTCGCAGTCGCCTCCAGAAACCGACATCGATGACTTGCCCATGTTGCCTGGAATCCGCACCCCCGCCCGC
AGTCCGTTGGAAACTGTGCAAGAAGTCAGTCAAAACAATTCGCCGGCGCGTCCCGCCGACAAGGGCCTCGTTGAG
CACGTCAAGGAGAAGCTTGCACCTACCGACACCCAGTCAGACAGTGCCGTGAGCGACAGTGGACGCCTGCATAAG
CCCACCGTGGCAGCAATGGCGAGCAGTGACGCTGTTGCTAGCCAGCCCGAGTCACGACGCACCAGTTCTGTCCCT
CCACCGCCGCCCTTGATATCGCGACAGTCTAGTGCTCTGTCGGCCAAGCATGTCAAGCCCAGCAAGCCTGAAGGC
TCTACGCAAAATATGACGGTTGAGACAGAAACTGTGCCCAGCGTCCCTCAAGTTGCCCTGACAGCGGGCACCAAG
TCGGACAGTGGCAACGGCACGCTCAAGGCAAAGCCTAGCACGGAGACAATTAAGCCTCGCAAGGATAAAAAGCGC
ATGGCCCGGAAACAGCCTCAGGTCAATCCAGGAACAGGTAACAAGGCGCCTTGGCTGATGGCTAGTCCATGATTA
ATTGCTGACTTGGCTGTCACACTAGGGTCAAAAGCCGACATCTTTGAGGCCAAGATTGCCAATGCGGTCGATGAA
GCCAACACTTCGGACTCTGAAGAAACCTTTGTCTACGACTCCAATCCGCCCGAAAATGCCGAGCGTGCAAACCGC
CGCTTTCATTCTCGAACTCCCAGTGCCACTTCAATGGTTAGCCAAGCCGACCGTCAGAACTTGCGATCTATTTAC
GGCATCATGGAGGCTGGCGTCCACGCCCATCCCCACGGCCCCGTACCCAAAAAGAGCATGAAGTTTGTCAATACA
TTCAACGGCAATGCTAGCGACAGCTTGACTCCGGGCGATGAAGATGGAAAAGGAACGGGCAGAAGCGCGGGTGGC
TCCGGCCGTGGCACTGCTCGACATCACCATCACATTGGCGGCAGATGGGGGCGTCAGCCCGGTAATGGTCACGCG
TCACTTTTCGACAACGAATCACCCTTTCCCAATGCGGCCAAGTCGAAGCTGGCCGCCAGTGCTTCGCGCACCTCG
TCTGGCCCCCCCAGTCCTAGAAACTTCCACTCGACGCGAGGCCATTTTGGCACCAAGCGGTCGGCCATGCAAATG
TCAAGCTACGATCTCGACGAGGCTGCAGGTGCCGATGACGAGCGGACGCCGTTGATTGACTCGAACCGCTCCTTG
AGAAATAACAGAGTCAGACGCGGCCCACACAACCTCCGCCAAGCAGAGTCACAGACTTATACTAGACGGTCATCC
TATCTCAACAGATTTGCCGCCTGCCTCGTCTTGACCATGATGCTGCTCCTCGTCATTACGGGCGCCATTGGCTTC
ATGTTTGCCACGTCGCAGCCCATGGACGGCATGGAGATTGTCTCAATTGACAATGTCGTGACGAGCGAGCAGGTG
CTCATGTTTGATCTGCAGGTCAAGGCGCACAACCCAAATATTGTTGTTGTTACAGTCTCTGATGCCAATCTGGAG
ATCTTTGCCAAGTCGGAATACGCAGGCAAAGACTCGGAGTGGTGGAGGCACCCCAACTCTGGCGGGTTTCATGCT
CAAGACGATCCGTGGGACGATCCGCCATGGATACCCGGCGATGACGACGACGACGACCGACGGCCCAATGTGTTG
CTGGGTCGTGTCACCGAGTTTGACAGCCCCCTGACTTTTGAAGGATCGCTGCTCCACCAGGGATTTTCGTATTCG
ACTGGCGAGATGCAACTTGCTTATCCAGGCAACGATACCTCAGGAGGATCCAAACGGTGGGAGGCCATCTACCAA
AACGAGTTTGATCTCATCATCAAGGGCGTAGTCAAATATAGCCTCCCGCTGAGCGCCCACGTACGCAGTGCTACC
GTCTCGGGGAGGACAACAGTCAAGCCCAATGCCGCAAACGATCCGTCACTAACACCCAATACAACTGCTCAAAAT
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail