Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7343
Gene name
LocationContig_78:38840..41627
Strand-
Gene length (bp)2787
Transcript length (bp)2787
Coding sequence length (bp)2787
Protein length (aa) 929

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06424 PRP1_N PRP1 splicing factor, N-terminal 1.5E-49 12 171
PF13428 TPR_14 Tetratricopeptide repeat 1.6E-05 598 639
PF14559 TPR_19 Tetratricopeptide repeat 9.6E-07 609 661
PF13181 TPR_8 Tetratricopeptide repeat 6.3E-03 699 730
PF13432 TPR_16 Tetratricopeptide repeat 2.2E-03 602 663
PF13432 TPR_16 Tetratricopeptide repeat 6.7E-05 676 731

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q91YR7|PRP6_MOUSE Pre-mRNA-processing factor 6 OS=Mus musculus GN=Prpf6 PE=1 SV=1 4 928 0.0E+00
sp|A1A5S1|PRP6_RAT Pre-mRNA-processing factor 6 OS=Rattus norvegicus GN=Prpf6 PE=1 SV=1 4 928 0.0E+00
sp|O94906|PRP6_HUMAN Pre-mRNA-processing factor 6 OS=Homo sapiens GN=PRPF6 PE=1 SV=1 4 928 0.0E+00
sp|Q5RCC2|PRP6_PONAB Pre-mRNA-processing factor 6 OS=Pongo abelii GN=PRPF6 PE=2 SV=1 4 928 0.0E+00
sp|Q2KJJ0|PRP6_BOVIN Pre-mRNA-processing factor 6 OS=Bos taurus GN=PRPF6 PE=2 SV=1 4 928 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q91YR7|PRP6_MOUSE Pre-mRNA-processing factor 6 OS=Mus musculus GN=Prpf6 PE=1 SV=1 4 928 0.0E+00
sp|A1A5S1|PRP6_RAT Pre-mRNA-processing factor 6 OS=Rattus norvegicus GN=Prpf6 PE=1 SV=1 4 928 0.0E+00
sp|O94906|PRP6_HUMAN Pre-mRNA-processing factor 6 OS=Homo sapiens GN=PRPF6 PE=1 SV=1 4 928 0.0E+00
sp|Q5RCC2|PRP6_PONAB Pre-mRNA-processing factor 6 OS=Pongo abelii GN=PRPF6 PE=2 SV=1 4 928 0.0E+00
sp|Q2KJJ0|PRP6_BOVIN Pre-mRNA-processing factor 6 OS=Bos taurus GN=PRPF6 PE=2 SV=1 4 928 0.0E+00
sp|Q9ZT71|STA1_ARATH Protein STABILIZED1 OS=Arabidopsis thaliana GN=STA1 PE=1 SV=1 4 927 0.0E+00
sp|Q12381|PRP1_SCHPO Pre-mRNA-splicing factor prp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp1 PE=1 SV=1 6 927 0.0E+00
sp|P19735|PRP6_YEAST Pre-mRNA-splicing factor 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP6 PE=1 SV=1 4 920 3.0E-101
sp|Q527H0|CLF1_MAGO7 Pre-mRNA-splicing factor CLF1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CLF1 PE=3 SV=1 306 791 3.0E-14
sp|Q54VF4|Y8236_DICDI TPR-containing protein DDB_G0280363 OS=Dictyostelium discoideum GN=DDB_G0280363 PE=4 SV=2 492 902 4.0E-13
sp|Q54XP4|CRNL1_DICDI Crooked neck-like protein 1 OS=Dictyostelium discoideum GN=crnkl1 PE=3 SV=1 531 807 3.0E-11
sp|Q54VF4|Y8236_DICDI TPR-containing protein DDB_G0280363 OS=Dictyostelium discoideum GN=DDB_G0280363 PE=4 SV=2 565 815 9.0E-11
sp|Q54VF4|Y8236_DICDI TPR-containing protein DDB_G0280363 OS=Dictyostelium discoideum GN=DDB_G0280363 PE=4 SV=2 283 672 3.0E-10
sp|Q9BZJ0|CRNL1_HUMAN Crooked neck-like protein 1 OS=Homo sapiens GN=CRNKL1 PE=1 SV=4 394 821 4.0E-10
sp|P87312|CLF1_SCHPO Pre-mRNA-splicing factor cwf4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf4 PE=1 SV=1 532 797 5.0E-10
sp|Q527H0|CLF1_MAGO7 Pre-mRNA-splicing factor CLF1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CLF1 PE=3 SV=1 531 797 6.0E-10
sp|Q9ZT71|STA1_ARATH Protein STABILIZED1 OS=Arabidopsis thaliana GN=STA1 PE=1 SV=1 275 485 7.0E-10
sp|Q9HF03|CLF1_CRYNH Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CLF1 PE=3 SV=1 546 783 1.0E-09
sp|Q9FNS4|MBB1_CHLRE PsbB mRNA maturation factor Mbb1, chloroplastic OS=Chlamydomonas reinhardtii GN=MBB1 PE=2 SV=1 594 897 1.0E-09
sp|Q4WT84|CLF1_ASPFU Pre-mRNA-splicing factor clf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=clf1 PE=3 SV=1 341 791 1.0E-09
sp|P0CO11|CLF1_CRYNB Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CLF1 PE=3 SV=1 556 783 2.0E-09
sp|P0CO10|CLF1_CRYNJ Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CLF1 PE=3 SV=1 556 783 2.0E-09
sp|Q9FNS4|MBB1_CHLRE PsbB mRNA maturation factor Mbb1, chloroplastic OS=Chlamydomonas reinhardtii GN=MBB1 PE=2 SV=1 543 807 2.0E-09
sp|P63155|CRNL1_RAT Crooked neck-like protein 1 OS=Rattus norvegicus GN=Crnkl1 PE=2 SV=1 394 821 3.0E-09
sp|P63154|CRNL1_MOUSE Crooked neck-like protein 1 OS=Mus musculus GN=Crnkl1 PE=1 SV=1 394 821 3.0E-09
sp|Q7SGD2|CLF1_NEUCR Pre-mRNA-splicing factor clf-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=clf-1 PE=3 SV=1 528 797 7.0E-09
sp|Q8RWG2|CF107_ARATH Protein high chlorophyll fluorescent 107 OS=Arabidopsis thaliana GN=HCF107 PE=1 SV=1 599 867 9.0E-09
sp|Q5BDX1|CLF1_EMENI Pre-mRNA-splicing factor clf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=clf1 PE=3 SV=2 342 791 1.0E-08
sp|Q9HF03|CLF1_CRYNH Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CLF1 PE=3 SV=1 341 791 5.0E-08
sp|P87312|CLF1_SCHPO Pre-mRNA-splicing factor cwf4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf4 PE=1 SV=1 600 799 9.0E-08
sp|Q5K654|CLF1_PARBR Pre-mRNA-splicing factor CLF1 OS=Paracoccidioides brasiliensis GN=CLF1 PE=3 SV=1 341 807 9.0E-08
sp|P87312|CLF1_SCHPO Pre-mRNA-splicing factor cwf4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf4 PE=1 SV=1 689 791 1.0E-07
sp|Q9FNS4|MBB1_CHLRE PsbB mRNA maturation factor Mbb1, chloroplastic OS=Chlamydomonas reinhardtii GN=MBB1 PE=2 SV=1 596 780 1.0E-07
sp|Q8RWG2|CF107_ARATH Protein high chlorophyll fluorescent 107 OS=Arabidopsis thaliana GN=HCF107 PE=1 SV=1 532 796 2.0E-07
sp|Q5K654|CLF1_PARBR Pre-mRNA-splicing factor CLF1 OS=Paracoccidioides brasiliensis GN=CLF1 PE=3 SV=1 530 799 2.0E-07
sp|Q6C186|CLF1_YARLI Pre-mRNA-splicing factor CLF1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CLF1 PE=3 SV=1 545 807 2.0E-07
sp|P0CO11|CLF1_CRYNB Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CLF1 PE=3 SV=1 341 791 2.0E-07
sp|P0CO10|CLF1_CRYNJ Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CLF1 PE=3 SV=1 341 791 2.0E-07
sp|Q54XP4|CRNL1_DICDI Crooked neck-like protein 1 OS=Dictyostelium discoideum GN=crnkl1 PE=3 SV=1 530 869 2.0E-07
sp|P87312|CLF1_SCHPO Pre-mRNA-splicing factor cwf4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf4 PE=1 SV=1 343 797 3.0E-07
sp|Q9FNS4|MBB1_CHLRE PsbB mRNA maturation factor Mbb1, chloroplastic OS=Chlamydomonas reinhardtii GN=MBB1 PE=2 SV=1 495 748 4.0E-07
sp|Q5BDX1|CLF1_EMENI Pre-mRNA-splicing factor clf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=clf1 PE=3 SV=2 524 871 5.0E-07
sp|Q4WT84|CLF1_ASPFU Pre-mRNA-splicing factor clf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=clf1 PE=3 SV=1 530 871 9.0E-07
sp|P87312|CLF1_SCHPO Pre-mRNA-splicing factor cwf4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf4 PE=1 SV=1 278 702 1.0E-06
sp|P17886|CRN_DROME Protein crooked neck OS=Drosophila melanogaster GN=crn PE=2 SV=2 279 716 1.0E-06
sp|Q4PB37|CLF1_USTMA Pre-mRNA-splicing factor CLF1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CLF1 PE=3 SV=1 556 781 1.0E-06
sp|Q4PB37|CLF1_USTMA Pre-mRNA-splicing factor CLF1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CLF1 PE=3 SV=1 658 804 2.0E-06
sp|Q4WT84|CLF1_ASPFU Pre-mRNA-splicing factor clf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=clf1 PE=3 SV=1 278 674 3.0E-06
sp|Q6C186|CLF1_YARLI Pre-mRNA-splicing factor CLF1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CLF1 PE=3 SV=1 690 797 3.0E-06
sp|F4J8K6|RRP5_ARATH rRNA biogenesis protein RRP5 OS=Arabidopsis thaliana GN=RRP5 PE=2 SV=2 586 809 3.0E-06
sp|Q5K654|CLF1_PARBR Pre-mRNA-splicing factor CLF1 OS=Paracoccidioides brasiliensis GN=CLF1 PE=3 SV=1 254 674 4.0E-06
sp|Q527H0|CLF1_MAGO7 Pre-mRNA-splicing factor CLF1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CLF1 PE=3 SV=1 278 674 5.0E-06
sp|Q527H0|CLF1_MAGO7 Pre-mRNA-splicing factor CLF1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CLF1 PE=3 SV=1 667 914 5.0E-06
sp|P0CO10|CLF1_CRYNJ Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CLF1 PE=3 SV=1 263 726 6.0E-06
sp|P0CO11|CLF1_CRYNB Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CLF1 PE=3 SV=1 263 726 6.0E-06
sp|Q4WT84|CLF1_ASPFU Pre-mRNA-splicing factor clf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=clf1 PE=3 SV=1 655 804 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000398 mRNA splicing, via spliceosome Yes
GO:0005515 protein binding Yes
GO:0090304 nucleic acid metabolic process No
GO:0000377 RNA splicing, via transesterification reactions with bulged adenosine as nucleophile No
GO:0043170 macromolecule metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0006396 RNA processing No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0000375 RNA splicing, via transesterification reactions No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006397 mRNA processing No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0008380 RNA splicing No
GO:0044238 primary metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0016071 mRNA metabolic process No
GO:0016070 RNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7343
MTTRRDFLSQPAPENYVAGLGRGATGFTTRSDLGPARDGPSEDQIKEALAKRAAQLGLAPEGKDGKKGKGDDGDD
GEDESRYQDPDNEVGLFAGGVYDKDDEEADRIWEAINERMDRRKRQREEREQAEREEYERNNPKIQQQFADLKRA
LSTVTDDEWASLPEVGDLTGKNRRSKQALRQRFYAVPDSVLAAARDSTEMGTTVADDGSATSSSADASSGTMTNF
ADIGAARDKVLKSRLEQASQSTGADTGSSTSIDPQGYITSLNKLNGAHAQVGDINRVRDLLQSVVKTNPNNALGW
TAAARLEELAGRLVAARKTIDKGCAQCPRSEDAWLENIRLNSESPNAKIIARKAIESNPRSVRLWVEAMKLESMA
SNKKRVVRQALDHLPESEALWKEAVNLEEDPEDARLMLAKATELIPLSVDLWLALARLETPENAQKVLNKARKAV
PTSHEIWIAAARLQEQLGRPSHVIMKRAVQVLAKEASMPSRQEWIGEAEKCDEEGARQTCESIIHETLGWSLEEG
PERKTTWEQDARNSINRGRYATARAIYAYALRVFGDSQSLWLDAADLERTHGTREAVWSLLSKATEACPTSFEIW
MALAREKWQAGQVDEARLVLKRAFMANPNNEDIWLAAVKLESENGNVSQARALLETARQNASTDRVWMKSVVFER
TQGQAEAALDMVIEALSRFRSAPKLWMLKGQIHQDAGRMAEARQAYSEGVKVAPKAAPLWLLYSHLEEQAGNVVK
ARSVLDRARLALPHDAAIWCEAVRLERRAGNAAQARSMMARAQHEVPRSGLLWAEQIWQLEPRTQRKPRSLEAMK
KVDNDALLFVAVARIFWADRKLDKAQSWFEKALVLDPDQGDSWAWYYRFLCQHGTDEKRFEVVAKCVHSEPRHGE
LWQAVAKHPKNANLGTQEVLKLVASELE*
Coding >OphauB2|7343
ATGACAACGCGACGCGACTTTCTGAGCCAACCGGCGCCGGAAAACTACGTTGCAGGCCTGGGTCGAGGCGCCACC
GGCTTCACAACACGATCCGATCTCGGCCCTGCGCGTGATGGTCCCAGCGAAGACCAGATCAAGGAGGCGCTCGCC
AAGCGTGCCGCACAGCTCGGCCTCGCACCCGAGGGCAAAGACGGCAAGAAGGGCAAGGGCGACGATGGCGACGAT
GGCGAGGACGAGAGCCGCTACCAGGACCCCGATAACGAAGTGGGCCTGTTTGCCGGCGGCGTCTATGACAAGGAC
GACGAGGAGGCGGACCGCATCTGGGAAGCCATTAATGAGCGCATGGACCGGCGGAAGCGACAGCGGGAGGAGCGG
GAGCAGGCTGAGCGCGAAGAGTATGAGCGCAACAATCCTAAGATTCAGCAGCAGTTTGCAGACCTTAAGCGCGCG
CTGTCAACAGTCACCGACGACGAGTGGGCTAGCTTGCCTGAAGTGGGCGACTTGACGGGCAAGAATCGGCGCAGC
AAGCAAGCGCTGCGTCAGCGGTTTTATGCTGTGCCTGATAGCGTCTTGGCTGCTGCTCGCGACTCGACAGAAATG
GGCACCACTGTTGCCGACGACGGCAGCGCCACGAGCAGCTCGGCCGACGCGAGCAGCGGCACAATGACCAACTTT
GCTGATATTGGAGCTGCTCGGGACAAGGTGCTCAAGTCGAGGCTGGAACAGGCCTCGCAGAGCACAGGCGCCGAT
ACGGGCAGCTCGACAAGCATCGACCCGCAAGGATATATTACCAGCCTCAACAAGCTCAACGGCGCCCATGCTCAG
GTTGGCGACATCAACCGTGTGCGCGACTTGCTGCAGTCAGTCGTCAAGACCAACCCCAACAATGCTCTGGGCTGG
ACTGCGGCTGCTCGTCTTGAGGAGCTGGCGGGAAGGCTGGTGGCTGCGCGAAAAACAATCGACAAGGGCTGCGCG
CAATGCCCTCGGAGCGAGGACGCATGGCTGGAGAATATCCGACTCAATTCGGAATCGCCAAACGCCAAGATTATT
GCGCGCAAGGCCATTGAGTCGAATCCACGGTCGGTGCGGCTCTGGGTAGAAGCAATGAAGCTGGAATCCATGGCA
AGCAACAAGAAGCGCGTCGTCCGCCAGGCACTTGACCATCTCCCCGAGTCAGAGGCCCTGTGGAAGGAAGCAGTC
AATCTAGAGGAGGATCCAGAGGACGCGCGGCTCATGCTGGCCAAGGCGACGGAGCTGATACCCCTATCGGTGGAC
CTCTGGCTGGCGCTGGCGCGGCTCGAGACACCAGAGAATGCGCAAAAAGTGCTAAACAAGGCGCGCAAAGCAGTG
CCAACGTCTCACGAGATTTGGATAGCAGCCGCACGACTGCAGGAGCAGCTTGGCCGGCCCAGCCATGTCATCATG
AAGCGAGCCGTACAAGTCTTGGCCAAGGAAGCCTCAATGCCCAGCCGCCAGGAATGGATCGGCGAGGCGGAAAAG
TGCGACGAAGAAGGCGCAAGACAAACGTGCGAGAGCATCATCCACGAGACGCTTGGCTGGAGTCTGGAGGAAGGA
CCAGAACGCAAGACGACGTGGGAGCAAGACGCGCGCAACAGCATCAACAGGGGCCGGTATGCCACTGCTCGCGCC
ATTTACGCCTATGCGCTGCGAGTGTTTGGCGACAGCCAGTCTCTGTGGCTCGACGCGGCCGACTTGGAGCGCACG
CATGGCACGCGAGAAGCCGTGTGGTCTCTGCTCAGCAAGGCAACAGAGGCGTGTCCGACAAGCTTTGAGATTTGG
ATGGCGCTGGCGCGCGAGAAGTGGCAAGCAGGCCAAGTAGACGAGGCGCGGCTGGTGCTGAAGCGAGCCTTCATG
GCAAACCCCAACAATGAAGACATTTGGCTGGCGGCAGTCAAGCTCGAGTCGGAAAACGGCAACGTCAGCCAGGCG
CGGGCGCTTCTGGAGACGGCGCGGCAAAACGCATCGACGGACCGGGTGTGGATGAAGAGCGTCGTTTTTGAGCGC
ACGCAGGGCCAGGCCGAGGCGGCGCTCGACATGGTGATTGAAGCGCTGAGCCGCTTCCGCTCGGCGCCCAAGCTA
TGGATGCTCAAGGGCCAGATTCACCAGGACGCAGGCCGCATGGCCGAGGCGCGCCAGGCCTACTCCGAGGGCGTC
AAGGTGGCGCCCAAGGCAGCGCCGCTGTGGCTGCTCTACTCGCATCTCGAGGAGCAGGCGGGCAACGTGGTCAAG
GCGCGCTCTGTGCTGGACCGCGCGCGTCTCGCCCTGCCGCACGATGCCGCCATTTGGTGCGAGGCGGTGCGTCTG
GAGCGGCGGGCCGGCAATGCTGCCCAGGCGCGGTCCATGATGGCGCGCGCGCAGCATGAGGTGCCTCGCAGCGGC
CTGCTCTGGGCCGAGCAGATTTGGCAGCTCGAGCCGCGCACCCAGCGCAAGCCGCGCAGCCTCGAGGCCATGAAA
AAGGTGGACAATGACGCCCTCCTCTTTGTCGCCGTGGCGCGCATCTTTTGGGCCGACCGCAAGCTCGACAAGGCG
CAGAGCTGGTTTGAAAAGGCCCTGGTGCTCGATCCCGACCAGGGCGACAGCTGGGCCTGGTATTACCGCTTCTTG
TGCCAGCACGGCACCGACGAGAAGCGCTTCGAGGTTGTCGCCAAGTGCGTCCATAGCGAGCCGCGCCATGGCGAG
CTGTGGCAGGCTGTGGCCAAGCACCCCAAGAATGCAAACCTCGGCACTCAAGAGGTGCTCAAGCTTGTCGCTTCG
GAGCTAGAGTAG
Transcript >OphauB2|7343
ATGACAACGCGACGCGACTTTCTGAGCCAACCGGCGCCGGAAAACTACGTTGCAGGCCTGGGTCGAGGCGCCACC
GGCTTCACAACACGATCCGATCTCGGCCCTGCGCGTGATGGTCCCAGCGAAGACCAGATCAAGGAGGCGCTCGCC
AAGCGTGCCGCACAGCTCGGCCTCGCACCCGAGGGCAAAGACGGCAAGAAGGGCAAGGGCGACGATGGCGACGAT
GGCGAGGACGAGAGCCGCTACCAGGACCCCGATAACGAAGTGGGCCTGTTTGCCGGCGGCGTCTATGACAAGGAC
GACGAGGAGGCGGACCGCATCTGGGAAGCCATTAATGAGCGCATGGACCGGCGGAAGCGACAGCGGGAGGAGCGG
GAGCAGGCTGAGCGCGAAGAGTATGAGCGCAACAATCCTAAGATTCAGCAGCAGTTTGCAGACCTTAAGCGCGCG
CTGTCAACAGTCACCGACGACGAGTGGGCTAGCTTGCCTGAAGTGGGCGACTTGACGGGCAAGAATCGGCGCAGC
AAGCAAGCGCTGCGTCAGCGGTTTTATGCTGTGCCTGATAGCGTCTTGGCTGCTGCTCGCGACTCGACAGAAATG
GGCACCACTGTTGCCGACGACGGCAGCGCCACGAGCAGCTCGGCCGACGCGAGCAGCGGCACAATGACCAACTTT
GCTGATATTGGAGCTGCTCGGGACAAGGTGCTCAAGTCGAGGCTGGAACAGGCCTCGCAGAGCACAGGCGCCGAT
ACGGGCAGCTCGACAAGCATCGACCCGCAAGGATATATTACCAGCCTCAACAAGCTCAACGGCGCCCATGCTCAG
GTTGGCGACATCAACCGTGTGCGCGACTTGCTGCAGTCAGTCGTCAAGACCAACCCCAACAATGCTCTGGGCTGG
ACTGCGGCTGCTCGTCTTGAGGAGCTGGCGGGAAGGCTGGTGGCTGCGCGAAAAACAATCGACAAGGGCTGCGCG
CAATGCCCTCGGAGCGAGGACGCATGGCTGGAGAATATCCGACTCAATTCGGAATCGCCAAACGCCAAGATTATT
GCGCGCAAGGCCATTGAGTCGAATCCACGGTCGGTGCGGCTCTGGGTAGAAGCAATGAAGCTGGAATCCATGGCA
AGCAACAAGAAGCGCGTCGTCCGCCAGGCACTTGACCATCTCCCCGAGTCAGAGGCCCTGTGGAAGGAAGCAGTC
AATCTAGAGGAGGATCCAGAGGACGCGCGGCTCATGCTGGCCAAGGCGACGGAGCTGATACCCCTATCGGTGGAC
CTCTGGCTGGCGCTGGCGCGGCTCGAGACACCAGAGAATGCGCAAAAAGTGCTAAACAAGGCGCGCAAAGCAGTG
CCAACGTCTCACGAGATTTGGATAGCAGCCGCACGACTGCAGGAGCAGCTTGGCCGGCCCAGCCATGTCATCATG
AAGCGAGCCGTACAAGTCTTGGCCAAGGAAGCCTCAATGCCCAGCCGCCAGGAATGGATCGGCGAGGCGGAAAAG
TGCGACGAAGAAGGCGCAAGACAAACGTGCGAGAGCATCATCCACGAGACGCTTGGCTGGAGTCTGGAGGAAGGA
CCAGAACGCAAGACGACGTGGGAGCAAGACGCGCGCAACAGCATCAACAGGGGCCGGTATGCCACTGCTCGCGCC
ATTTACGCCTATGCGCTGCGAGTGTTTGGCGACAGCCAGTCTCTGTGGCTCGACGCGGCCGACTTGGAGCGCACG
CATGGCACGCGAGAAGCCGTGTGGTCTCTGCTCAGCAAGGCAACAGAGGCGTGTCCGACAAGCTTTGAGATTTGG
ATGGCGCTGGCGCGCGAGAAGTGGCAAGCAGGCCAAGTAGACGAGGCGCGGCTGGTGCTGAAGCGAGCCTTCATG
GCAAACCCCAACAATGAAGACATTTGGCTGGCGGCAGTCAAGCTCGAGTCGGAAAACGGCAACGTCAGCCAGGCG
CGGGCGCTTCTGGAGACGGCGCGGCAAAACGCATCGACGGACCGGGTGTGGATGAAGAGCGTCGTTTTTGAGCGC
ACGCAGGGCCAGGCCGAGGCGGCGCTCGACATGGTGATTGAAGCGCTGAGCCGCTTCCGCTCGGCGCCCAAGCTA
TGGATGCTCAAGGGCCAGATTCACCAGGACGCAGGCCGCATGGCCGAGGCGCGCCAGGCCTACTCCGAGGGCGTC
AAGGTGGCGCCCAAGGCAGCGCCGCTGTGGCTGCTCTACTCGCATCTCGAGGAGCAGGCGGGCAACGTGGTCAAG
GCGCGCTCTGTGCTGGACCGCGCGCGTCTCGCCCTGCCGCACGATGCCGCCATTTGGTGCGAGGCGGTGCGTCTG
GAGCGGCGGGCCGGCAATGCTGCCCAGGCGCGGTCCATGATGGCGCGCGCGCAGCATGAGGTGCCTCGCAGCGGC
CTGCTCTGGGCCGAGCAGATTTGGCAGCTCGAGCCGCGCACCCAGCGCAAGCCGCGCAGCCTCGAGGCCATGAAA
AAGGTGGACAATGACGCCCTCCTCTTTGTCGCCGTGGCGCGCATCTTTTGGGCCGACCGCAAGCTCGACAAGGCG
CAGAGCTGGTTTGAAAAGGCCCTGGTGCTCGATCCCGACCAGGGCGACAGCTGGGCCTGGTATTACCGCTTCTTG
TGCCAGCACGGCACCGACGAGAAGCGCTTCGAGGTTGTCGCCAAGTGCGTCCATAGCGAGCCGCGCCATGGCGAG
CTGTGGCAGGCTGTGGCCAAGCACCCCAAGAATGCAAACCTCGGCACTCAAGAGGTGCTCAAGCTTGTCGCTTCG
GAGCTAGAGTAG
Gene >OphauB2|7343
ATGACAACGCGACGCGACTTTCTGAGCCAACCGGCGCCGGAAAACTACGTTGCAGGCCTGGGTCGAGGCGCCACC
GGCTTCACAACACGATCCGATCTCGGCCCTGCGCGTGATGGTCCCAGCGAAGACCAGATCAAGGAGGCGCTCGCC
AAGCGTGCCGCACAGCTCGGCCTCGCACCCGAGGGCAAAGACGGCAAGAAGGGCAAGGGCGACGATGGCGACGAT
GGCGAGGACGAGAGCCGCTACCAGGACCCCGATAACGAAGTGGGCCTGTTTGCCGGCGGCGTCTATGACAAGGAC
GACGAGGAGGCGGACCGCATCTGGGAAGCCATTAATGAGCGCATGGACCGGCGGAAGCGACAGCGGGAGGAGCGG
GAGCAGGCTGAGCGCGAAGAGTATGAGCGCAACAATCCTAAGATTCAGCAGCAGTTTGCAGACCTTAAGCGCGCG
CTGTCAACAGTCACCGACGACGAGTGGGCTAGCTTGCCTGAAGTGGGCGACTTGACGGGCAAGAATCGGCGCAGC
AAGCAAGCGCTGCGTCAGCGGTTTTATGCTGTGCCTGATAGCGTCTTGGCTGCTGCTCGCGACTCGACAGAAATG
GGCACCACTGTTGCCGACGACGGCAGCGCCACGAGCAGCTCGGCCGACGCGAGCAGCGGCACAATGACCAACTTT
GCTGATATTGGAGCTGCTCGGGACAAGGTGCTCAAGTCGAGGCTGGAACAGGCCTCGCAGAGCACAGGCGCCGAT
ACGGGCAGCTCGACAAGCATCGACCCGCAAGGATATATTACCAGCCTCAACAAGCTCAACGGCGCCCATGCTCAG
GTTGGCGACATCAACCGTGTGCGCGACTTGCTGCAGTCAGTCGTCAAGACCAACCCCAACAATGCTCTGGGCTGG
ACTGCGGCTGCTCGTCTTGAGGAGCTGGCGGGAAGGCTGGTGGCTGCGCGAAAAACAATCGACAAGGGCTGCGCG
CAATGCCCTCGGAGCGAGGACGCATGGCTGGAGAATATCCGACTCAATTCGGAATCGCCAAACGCCAAGATTATT
GCGCGCAAGGCCATTGAGTCGAATCCACGGTCGGTGCGGCTCTGGGTAGAAGCAATGAAGCTGGAATCCATGGCA
AGCAACAAGAAGCGCGTCGTCCGCCAGGCACTTGACCATCTCCCCGAGTCAGAGGCCCTGTGGAAGGAAGCAGTC
AATCTAGAGGAGGATCCAGAGGACGCGCGGCTCATGCTGGCCAAGGCGACGGAGCTGATACCCCTATCGGTGGAC
CTCTGGCTGGCGCTGGCGCGGCTCGAGACACCAGAGAATGCGCAAAAAGTGCTAAACAAGGCGCGCAAAGCAGTG
CCAACGTCTCACGAGATTTGGATAGCAGCCGCACGACTGCAGGAGCAGCTTGGCCGGCCCAGCCATGTCATCATG
AAGCGAGCCGTACAAGTCTTGGCCAAGGAAGCCTCAATGCCCAGCCGCCAGGAATGGATCGGCGAGGCGGAAAAG
TGCGACGAAGAAGGCGCAAGACAAACGTGCGAGAGCATCATCCACGAGACGCTTGGCTGGAGTCTGGAGGAAGGA
CCAGAACGCAAGACGACGTGGGAGCAAGACGCGCGCAACAGCATCAACAGGGGCCGGTATGCCACTGCTCGCGCC
ATTTACGCCTATGCGCTGCGAGTGTTTGGCGACAGCCAGTCTCTGTGGCTCGACGCGGCCGACTTGGAGCGCACG
CATGGCACGCGAGAAGCCGTGTGGTCTCTGCTCAGCAAGGCAACAGAGGCGTGTCCGACAAGCTTTGAGATTTGG
ATGGCGCTGGCGCGCGAGAAGTGGCAAGCAGGCCAAGTAGACGAGGCGCGGCTGGTGCTGAAGCGAGCCTTCATG
GCAAACCCCAACAATGAAGACATTTGGCTGGCGGCAGTCAAGCTCGAGTCGGAAAACGGCAACGTCAGCCAGGCG
CGGGCGCTTCTGGAGACGGCGCGGCAAAACGCATCGACGGACCGGGTGTGGATGAAGAGCGTCGTTTTTGAGCGC
ACGCAGGGCCAGGCCGAGGCGGCGCTCGACATGGTGATTGAAGCGCTGAGCCGCTTCCGCTCGGCGCCCAAGCTA
TGGATGCTCAAGGGCCAGATTCACCAGGACGCAGGCCGCATGGCCGAGGCGCGCCAGGCCTACTCCGAGGGCGTC
AAGGTGGCGCCCAAGGCAGCGCCGCTGTGGCTGCTCTACTCGCATCTCGAGGAGCAGGCGGGCAACGTGGTCAAG
GCGCGCTCTGTGCTGGACCGCGCGCGTCTCGCCCTGCCGCACGATGCCGCCATTTGGTGCGAGGCGGTGCGTCTG
GAGCGGCGGGCCGGCAATGCTGCCCAGGCGCGGTCCATGATGGCGCGCGCGCAGCATGAGGTGCCTCGCAGCGGC
CTGCTCTGGGCCGAGCAGATTTGGCAGCTCGAGCCGCGCACCCAGCGCAAGCCGCGCAGCCTCGAGGCCATGAAA
AAGGTGGACAATGACGCCCTCCTCTTTGTCGCCGTGGCGCGCATCTTTTGGGCCGACCGCAAGCTCGACAAGGCG
CAGAGCTGGTTTGAAAAGGCCCTGGTGCTCGATCCCGACCAGGGCGACAGCTGGGCCTGGTATTACCGCTTCTTG
TGCCAGCACGGCACCGACGAGAAGCGCTTCGAGGTTGTCGCCAAGTGCGTCCATAGCGAGCCGCGCCATGGCGAG
CTGTGGCAGGCTGTGGCCAAGCACCCCAAGAATGCAAACCTCGGCACTCAAGAGGTGCTCAAGCTTGTCGCTTCG
GAGCTAGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail