Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7340
Gene name
LocationContig_78:25191..33728
Strand-
Gene length (bp)8537
Transcript length (bp)7425
Coding sequence length (bp)7425
Protein length (aa) 2475

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 2.9E-61 6 252
PF14765 PS-DH Polyketide synthase dehydratase 1.4E-56 902 1187
PF08659 KR KR domain 4.8E-54 2090 2264
PF00698 Acyl_transf_1 Acyl transferase domain 3.8E-48 531 840
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 5.8E-31 262 374
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 2.0E-23 377 506
PF08242 Methyltransf_12 Methyltransferase domain 4.5E-21 1371 1476
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 2.6E-16 1939 2066
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 2.1E-12 1892 1987
PF13649 Methyltransf_25 Methyltransferase domain 4.0E-10 1370 1474
PF13489 Methyltransf_23 Methyltransferase domain 4.5E-10 1365 1531
PF13847 Methyltransf_31 Methyltransferase domain 2.3E-09 1368 1481
PF08241 Methyltransf_11 Methyltransferase domain 2.0E-08 1371 1478
PF00106 adh_short short chain dehydrogenase 1.2E-06 2092 2247
PF00550 PP-binding Phosphopantetheine attachment site 4.4E-05 2397 2457

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 7 2460 0.0E+00
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 4 2303 0.0E+00
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 4 2303 0.0E+00
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 6 1724 0.0E+00
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 4 1114 7.0E-167
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 7 2460 0.0E+00
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 4 2303 0.0E+00
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 4 2303 0.0E+00
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 6 1724 0.0E+00
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 4 1114 7.0E-167
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 3 2466 1.0E-160
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 1 2282 1.0E-159
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 8 2440 2.0E-158
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 1 1109 1.0E-128
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 1 1109 1.0E-128
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 1 1109 1.0E-128
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 1 1109 1.0E-128
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 1 1109 4.0E-128
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 1 1119 2.0E-126
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 8 1184 2.0E-118
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 8 1184 4.0E-118
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 6 1109 1.0E-115
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 6 1120 6.0E-115
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 6 1120 6.0E-115
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 6 1120 7.0E-115
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 2 1109 4.0E-114
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 8 1109 1.0E-113
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 6 885 5.0E-113
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 7 885 2.0E-112
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 6 848 3.0E-112
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 6 848 1.0E-111
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 6 848 4.0E-111
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 4 994 1.0E-110
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 6 956 6.0E-110
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 2 895 1.0E-108
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1 885 2.0E-108
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 6 1109 5.0E-108
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 6 1117 6.0E-107
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 6 1117 6.0E-107
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 3 954 4.0E-106
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 7 933 1.0E-104
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 8 979 1.0E-103
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 8 979 2.0E-103
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 8 989 8.0E-103
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 6 893 6.0E-102
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 6 893 6.0E-102
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 6 893 6.0E-102
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 8 989 8.0E-102
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 8 979 9.0E-102
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 8 991 1.0E-100
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 5 1081 2.0E-100
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 8 982 3.0E-100
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 8 979 5.0E-100
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 5 1207 6.0E-100
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 8 972 1.0E-99
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 8 991 2.0E-99
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 5 979 5.0E-99
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 1 1019 5.0E-97
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 5 1076 1.0E-96
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 6 951 1.0E-96
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 8 979 5.0E-96
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 6 1020 7.0E-96
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 8 991 2.0E-95
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 15 988 2.0E-95
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 5 1076 3.0E-95
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 5 1207 3.0E-94
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 1 892 4.0E-93
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 1 892 4.0E-93
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 1 892 4.0E-93
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 8 878 1.0E-91
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 8 884 2.0E-91
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 8 979 3.0E-89
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 8 992 3.0E-89
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 8 992 3.0E-89
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 8 992 1.0E-87
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 8 1005 7.0E-87
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 8 1025 1.0E-86
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 8 992 4.0E-86
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 8 992 2.0E-85
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 8 992 6.0E-85
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 5 840 3.0E-84
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 8 992 8.0E-82
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1744 2268 3.0E-81
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1744 2268 3.0E-81
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 8 992 1.0E-80
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 8 819 2.0E-80
sp|P96284|PKS15_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks15 PE=1 SV=2 6 421 2.0E-77
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 6 421 2.0E-72
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2 502 2.0E-71
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 6 414 5.0E-70
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 1619 2436 2.0E-67
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 4 502 6.0E-67
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1328 2309 6.0E-66
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 8 501 6.0E-66
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 6 512 8.0E-66
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 6 502 1.0E-64
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 6 547 2.0E-64
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 6 502 5.0E-62
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 8 511 2.0E-61
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1710 2270 5.0E-61
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1410 2301 2.0E-59
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1751 2270 1.0E-58
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1860 2287 7.0E-58
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 8 422 8.0E-58
sp|P36189|FAS_ANSAN Fatty acid synthase (Fragment) OS=Anser anser anser GN=FASN PE=1 SV=1 5 365 2.0E-57
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 9 421 2.0E-57
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 8 421 4.0E-57
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 6 422 2.0E-56
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 1371 2440 1.0E-55
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1368 2279 1.0E-55
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 1785 2254 2.0E-55
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 1368 2438 6.0E-55
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1751 2301 1.0E-54
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 1726 2270 1.0E-54
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 1371 2299 2.0E-54
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 1775 2436 5.0E-54
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 1770 2262 2.0E-53
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 1775 2297 5.0E-53
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 1785 2254 6.0E-53
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 1687 2268 8.0E-53
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1849 2284 8.0E-53
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 1368 2260 2.0E-52
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 1785 2254 2.0E-52
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 8 551 2.0E-51
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 8 502 6.0E-50
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 1354 2270 1.0E-49
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 1359 2270 7.0E-48
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 8 502 4.0E-47
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 1692 2346 7.0E-47
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 1660 2434 2.0E-46
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 1636 2278 2.0E-45
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 6 436 2.0E-45
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 1651 2268 3.0E-45
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 1651 2268 3.0E-45
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 1651 2268 3.0E-45
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 1651 2268 3.0E-45
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 1651 2268 3.0E-45
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 8 511 8.0E-45
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 524 1512 2.0E-44
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 1760 2440 7.0E-44
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 1753 2428 3.0E-43
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 1602 2304 5.0E-42
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 8 423 4.0E-41
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 1707 2279 4.0E-41
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1707 2279 2.0E-40
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1711 2279 2.0E-40
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1707 2301 2.0E-40
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 1753 2428 5.0E-40
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1707 2279 9.0E-40
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 1760 2440 1.0E-39
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1707 2279 2.0E-39
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 1760 2434 3.0E-39
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 1707 2299 6.0E-39
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1707 2279 6.0E-39
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1707 2279 2.0E-38
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 1707 2279 3.0E-38
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 1760 2270 2.0E-36
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 1760 2270 5.0E-36
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 1769 2066 3.0E-30
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 2043 2454 3.0E-29
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 460 1109 2.0E-28
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 1777 2066 2.0E-28
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 524 1011 1.0E-26
sp|P19333|VAT1_TORCA Synaptic vesicle membrane protein VAT-1 OS=Torpedo californica PE=1 SV=1 1769 2085 4.0E-26
sp|Q3MIE4|VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus GN=Vat1 PE=1 SV=1 1775 2066 2.0E-25
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 1741 2068 5.0E-25
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 1741 2068 2.0E-24
sp|Q62465|VAT1_MOUSE Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus GN=Vat1 PE=1 SV=3 1775 2066 8.0E-24
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 519 861 1.0E-23
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 529 985 6.0E-23
sp|P9WQD7|FAB2_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasB PE=1 SV=1 22 416 3.0E-19
sp|P9WQD6|FAB2_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasB PE=3 SV=1 22 416 3.0E-19
sp|P63457|FAB2_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasB PE=3 SV=1 22 416 3.0E-19
sp|O69473|FAB2_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium leprae (strain TN) GN=kasB PE=3 SV=2 22 416 4.0E-19
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 1332 1551 8.0E-19
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 1804 1987 1.0E-18
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 1804 1987 2.0E-18
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 1775 1982 4.0E-18
sp|A6QQF5|QORL2_BOVIN Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2 1775 2068 5.0E-18
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 1771 1982 6.0E-18
sp|Q05356|KAS1_STRHA Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces halstedii GN=sch1 PE=3 SV=1 8 421 7.0E-18
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1939 2270 8.0E-18
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 529 829 8.0E-18
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 1761 2068 8.0E-18
sp|Q83E37|FABF_COXBU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fabF PE=1 SV=1 8 421 2.0E-17
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 1743 1982 2.0E-17
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 1804 2038 3.0E-17
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 1804 1987 3.0E-17
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 1804 1987 3.0E-17
sp|P23155|KAS1_STRCO Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5318 PE=3 SV=1 8 421 4.0E-17
sp|Q3UNZ8|QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 1775 2068 5.0E-17
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 1804 1987 6.0E-17
sp|B0BNC9|QORL2_RAT Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1 1775 2068 8.0E-17
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 529 820 9.0E-17
sp|Q8BGC4|ZADH2_MOUSE Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 1777 2068 1.0E-16
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1152 1503 2.0E-16
sp|Q9D404|OXSM_MOUSE 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus GN=Oxsm PE=1 SV=1 155 421 2.0E-16
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 529 827 2.0E-16
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 1804 1987 3.0E-16
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2089 2252 5.0E-16
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1152 1503 7.0E-16
sp|P0AAI8|FABF_SHIFL 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Shigella flexneri GN=fabF PE=3 SV=2 154 420 9.0E-16
sp|P0AAI5|FABF_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli (strain K12) GN=fabF PE=1 SV=2 154 420 9.0E-16
sp|P0AAI6|FABF_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabF PE=3 SV=2 154 420 9.0E-16
sp|P0AAI7|FABF_ECO57 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O157:H7 GN=fabF PE=3 SV=2 154 420 9.0E-16
sp|P42865|QOR_LEIAM Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 1774 2068 2.0E-15
sp|Q8N4Q0|ZADH2_HUMAN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Homo sapiens GN=ZADH2 PE=1 SV=1 1777 2068 2.0E-15
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 529 820 5.0E-15
sp|Q02578|KAS1_STRCN Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cyaneus GN=curA PE=3 SV=1 8 414 6.0E-15
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1333 1530 7.0E-15
sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 1769 2067 1.0E-14
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 2077 2297 1.0E-14
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 2077 2297 1.0E-14
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 2077 2297 1.0E-14
sp|O34825|PKSC_BACSU Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC OS=Bacillus subtilis (strain 168) GN=pksC PE=1 SV=1 529 825 1.0E-14
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 1775 1984 3.0E-14
sp|Q24K16|ZADH2_BOVIN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Bos taurus GN=ZADH2 PE=2 SV=1 1777 1982 6.0E-14
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1332 1530 6.0E-14
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 1144 1503 7.0E-14
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 1747 2066 8.0E-14
sp|Q9NWU1|OXSM_HUMAN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens GN=OXSM PE=1 SV=1 155 421 8.0E-14
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 1328 1530 8.0E-14
sp|O34787|PKSE_BACSU Polyketide biosynthesis protein PksE OS=Bacillus subtilis (strain 168) GN=pksE PE=1 SV=3 529 819 9.0E-14
sp|Q9CBS7|FAB1_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium leprae (strain TN) GN=kasA PE=3 SV=1 169 416 1.0E-13
sp|P06231|NOE4_RHIML Nodulation protein E OS=Rhizobium meliloti GN=nodE PE=3 SV=1 91 417 1.0E-13
sp|P0A953|FABB_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli (strain K12) GN=fabB PE=1 SV=1 139 421 2.0E-13
sp|P0A954|FABB_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabB PE=3 SV=1 139 421 2.0E-13
sp|P06230|NODE_RHIME Nodulation protein E OS=Rhizobium meliloti (strain 1021) GN=nodE PE=3 SV=1 153 417 3.0E-13
sp|P43710|FABB_HAEIN 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabB PE=3 SV=1 104 420 3.0E-13
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 2049 2253 4.0E-13
sp|Q9R9J2|FENF_BACIU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fenF PE=1 SV=1 528 819 8.0E-13
sp|Q8L3X9|KASM_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Arabidopsis thaliana GN=KAS PE=1 SV=1 155 423 8.0E-13
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 2077 2253 8.0E-13
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 2085 2252 8.0E-13
sp|A7Z4X8|BAEC_BACMF Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase BaeC OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeC PE=1 SV=1 529 819 1.0E-12
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 2106 2268 1.0E-12
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 2106 2268 1.0E-12
sp|Q5TKS0|FABF_STAAU 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Fragment) OS=Staphylococcus aureus GN=fabF PE=3 SV=1 155 417 2.0E-12
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 1322 1542 2.0E-12
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1368 1503 2.0E-12
sp|Q8NXE1|FABF_STAAW 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MW2) GN=fabF PE=1 SV=1 155 417 3.0E-12
sp|Q6GAU2|FABF_STAAS 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MSSA476) GN=fabF PE=3 SV=1 155 417 3.0E-12
sp|Q5HHA1|FABF_STAAC 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain COL) GN=fabF PE=1 SV=1 155 417 3.0E-12
sp|Q7A6F8|FABF_STAAN 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain N315) GN=fabF PE=1 SV=1 155 417 3.0E-12
sp|Q99VA6|FABF_STAAM 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabF PE=3 SV=1 155 417 3.0E-12
sp|Q6GIA3|FABF_STAAR 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MRSA252) GN=fabF PE=3 SV=1 155 417 3.0E-12
sp|Q9KQH9|FABF_VIBCH 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabF PE=1 SV=3 72 420 3.0E-12
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1368 1503 3.0E-12
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2074 2252 3.0E-12
sp|Q0VCA7|OXSM_BOVIN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Bos taurus GN=OXSM PE=2 SV=1 8 421 4.0E-12
sp|P9WQD9|FAB1_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasA PE=1 SV=1 169 416 5.0E-12
sp|P9WQD8|FAB1_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasA PE=3 SV=1 169 416 5.0E-12
sp|H8ESN0|FAB1_MYCTE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=kasA PE=2 SV=2 169 416 5.0E-12
sp|P63455|FAB1_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasA PE=3 SV=1 169 416 5.0E-12
sp|Q02059|KASA_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5087 PE=1 SV=2 8 428 6.0E-12
sp|O35017|YOGA_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 1775 2068 7.0E-12
sp|Q02K94|FABB_PSEAB 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fabB PE=1 SV=1 142 421 7.0E-12
sp|P57193|FABB_BUCAI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabB PE=3 SV=1 153 421 9.0E-12
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1368 1503 9.0E-12
sp|P16540|KAS1_STRVN Granaticin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces violaceoruber GN=gra-orf1 PE=3 SV=1 8 384 1.0E-11
sp|P38230|QOR_YEAST Probable quinone oxidoreductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZTA1 PE=1 SV=1 1741 1982 1.0E-11
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 1749 2068 1.0E-11
sp|A4YGN2|ACAR_METS5 Acryloyl-coenzyme A reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1426 PE=1 SV=1 1771 2066 3.0E-11
sp|P72331|NODE_RHIS3 Nodulation protein E OS=Rhizobium sp. (strain N33) GN=nodE PE=3 SV=1 59 417 3.0E-11
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 2065 2262 4.0E-11
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 2065 2262 4.0E-11
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 2065 2262 4.0E-11
sp|P56902|FABF_RHIME 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhizobium meliloti (strain 1021) GN=fabF PE=3 SV=2 111 421 5.0E-11
sp|P23902|KASC1_HORVU 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Hordeum vulgare GN=KAS12 PE=1 SV=1 3 417 5.0E-11
sp|Q89AY4|FABB_BUCBP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabB PE=3 SV=1 116 421 5.0E-11
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 2091 2262 5.0E-11
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 2105 2309 7.0E-11
sp|O94297|OXSM_SCHPO Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.13c PE=3 SV=1 158 417 8.0E-11
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 2089 2437 9.0E-11
sp|O34340|FABF_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Bacillus subtilis (strain 168) GN=fabF PE=1 SV=1 173 420 1.0E-10
sp|Q9C9P4|KASC2_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic OS=Arabidopsis thaliana GN=KAS2 PE=1 SV=1 165 421 1.0E-10
sp|P52410|KASC1_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Arabidopsis thaliana GN=KAS1 PE=2 SV=2 152 417 1.0E-10
sp|P04683|NODE_RHILV Nodulation protein E OS=Rhizobium leguminosarum bv. viciae GN=nodE PE=3 SV=2 153 417 1.0E-10
sp|P16538|KAS1_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces glaucescens GN=tcmK PE=3 SV=1 8 384 2.0E-10
sp|Q7A124|FABD_STAAW Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MW2) GN=fabD PE=3 SV=1 530 834 2.0E-10
sp|Q7A5Z3|FABD_STAAN Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain N315) GN=fabD PE=1 SV=1 530 834 2.0E-10
sp|Q99UN8|FABD_STAAM Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabD PE=1 SV=1 530 834 2.0E-10
sp|Q93QD4|FABD_STAAU Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus GN=fabD PE=3 SV=1 530 834 2.0E-10
sp|Q5HGK3|FABD_STAAC Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain COL) GN=fabD PE=3 SV=1 530 834 2.0E-10
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 1371 1560 3.0E-10
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1333 1530 3.0E-10
sp|Q6GHK5|FABD_STAAR Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MRSA252) GN=fabD PE=3 SV=1 530 834 4.0E-10
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 1368 1503 4.0E-10
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 2074 2262 4.0E-10
sp|P55338|FABF_VIBHA 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio harveyi GN=fabF PE=3 SV=2 72 425 6.0E-10
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2147 2258 6.0E-10
sp|Q6G9Y3|FABD_STAAS Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MSSA476) GN=fabD PE=3 SV=1 530 834 7.0E-10
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 527 834 7.0E-10
sp|Q14914|PTGR1_HUMAN Prostaglandin reductase 1 OS=Homo sapiens GN=PTGR1 PE=1 SV=2 1818 2066 9.0E-10
sp|Q91YR9|PTGR1_MOUSE Prostaglandin reductase 1 OS=Mus musculus GN=Ptgr1 PE=1 SV=2 1849 2066 9.0E-10
sp|Q9ZUC1|QORL_ARATH Quinone oxidoreductase-like protein At1g23740, chloroplastic OS=Arabidopsis thaliana GN=At1g23740 PE=2 SV=2 1741 2066 9.0E-10
sp|P73283|FABF_SYNY3 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabF PE=1 SV=1 166 416 1.0E-09
sp|P41175|KAS1_STRCM Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cinnamonensis PE=3 SV=1 8 384 2.0E-09
sp|Q8KA28|FABB_BUCAP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabB PE=3 SV=1 153 421 3.0E-09
sp|Q975C8|ACAR_SULTO Acryloyl-coenzyme A reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_04800 PE=1 SV=1 1773 2066 4.0E-09
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2090 2252 6.0E-09
sp|P39525|CEM1_YEAST 3-oxoacyl-[acyl-carrier-protein] synthase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CEM1 PE=1 SV=1 8 416 8.0E-09
sp|P97584|PTGR1_RAT Prostaglandin reductase 1 OS=Rattus norvegicus GN=Ptgr1 PE=2 SV=3 1849 2066 1.0E-08
sp|Q8T3L6|FABD_DROME Probable malonyl-CoA-acyl carrier protein transacylase, mitochondrial OS=Drosophila melanogaster GN=beg PE=2 SV=2 517 778 1.0E-08
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 2075 2461 1.0E-08
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 2075 2461 1.0E-08
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 2075 2461 2.0E-08
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 1371 1530 2.0E-08
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 1368 1525 3.0E-08
sp|K4BW79|ENOX_SOLLC 2-methylene-furan-3-one reductase OS=Solanum lycopersicum GN=EO PE=1 SV=1 1735 2066 3.0E-08
sp|Q84V25|ENOXE_FRAAN 2-methylene-furan-3-one reductase OS=Fragaria ananassa GN=EO PE=1 SV=1 1773 2066 3.0E-08
sp|Q921W4|QORL1_MOUSE Quinone oxidoreductase-like protein 1 OS=Mus musculus GN=Cryzl1 PE=1 SV=1 1773 1959 3.0E-08
sp|Q5HM44|ZDH1_STAEQ Zinc-type alcohol dehydrogenase-like protein SERP1785 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1785 PE=3 SV=1 1777 2068 5.0E-08
sp|P38113|ADH5_YEAST Alcohol dehydrogenase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH5 PE=1 SV=1 1804 2069 6.0E-08
sp|Q6XQ67|ADH5_SACPS Alcohol dehydrogenase 5 OS=Saccharomyces pastorianus GN=ADH5 PE=3 SV=1 1804 2069 6.0E-08
sp|Q9HU15|FABY_PSEAE Beta-ketoacyl-[acyl-carrier-protein] synthase FabY OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fabY PE=1 SV=1 159 421 7.0E-08
sp|Q8X8I7|FABD_ECO57 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O157:H7 GN=fabD PE=3 SV=3 530 820 8.0E-08
sp|Q8CRJ7|ZDH1_STAES Zinc-type alcohol dehydrogenase-like protein SE_1777 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1777 PE=3 SV=1 1777 2068 8.0E-08
sp|Q924D0|RT4I1_MOUSE Reticulon-4-interacting protein 1, mitochondrial OS=Mus musculus GN=Rtn4ip1 PE=1 SV=2 1803 2068 8.0E-08
sp|P04684|NODE_RHILT Nodulation protein E OS=Rhizobium leguminosarum bv. trifolii GN=nodE PE=3 SV=2 153 417 1.0E-07
sp|Q9BV79|MECR_HUMAN Trans-2-enoyl-CoA reductase, mitochondrial OS=Homo sapiens GN=MECR PE=1 SV=2 1775 1921 3.0E-07
sp|Q07288|ADH1_KLUMA Alcohol dehydrogenase 1 OS=Kluyveromyces marxianus GN=ADH1 PE=3 SV=1 1829 2069 3.0E-07
sp|P0AAI9|FABD_ECOLI Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli (strain K12) GN=fabD PE=1 SV=2 530 820 4.0E-07
sp|P0AAJ0|FABD_ECOL6 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabD PE=3 SV=2 530 820 4.0E-07
sp|Q5HE19|ZDH1_STAAC Zinc-type alcohol dehydrogenase-like protein SACOL2177 OS=Staphylococcus aureus (strain COL) GN=SACOL2177 PE=3 SV=1 1773 1923 4.0E-07
sp|Q9C0Y6|YKM8_SCHPO Zinc-type alcohol dehydrogenase-like protein PB24D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.08c PE=3 SV=1 1805 2069 4.0E-07
sp|Q6GEP3|ZDH1_STAAR Zinc-type alcohol dehydrogenase-like protein SAR2277 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2277 PE=3 SV=1 1773 1923 4.0E-07
sp|Q8NVD1|ZDH1_STAAW Zinc-type alcohol dehydrogenase-like protein MW2112 OS=Staphylococcus aureus (strain MW2) GN=MW2112 PE=3 SV=1 1773 1923 5.0E-07
sp|Q6G7C8|ZDH1_STAAS Zinc-type alcohol dehydrogenase-like protein SAS2087 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2087 PE=3 SV=1 1773 1923 5.0E-07
sp|Q9EQZ5|PTGR1_CAVPO Prostaglandin reductase 1 OS=Cavia porcellus GN=Ptgr1 PE=1 SV=1 1818 1978 7.0E-07
sp|P99173|ZDH1_STAAN Zinc-type alcohol dehydrogenase-like protein SA1988 OS=Staphylococcus aureus (strain N315) GN=SA1988 PE=1 SV=1 1773 1923 8.0E-07
sp|P63475|ZDH1_STAAM Zinc-type alcohol dehydrogenase-like protein SAV2186 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2186 PE=3 SV=1 1773 1923 8.0E-07
sp|Q941I0|ENOXC_FRAAN 2-methylene-furan-3-one reductase OS=Fragaria ananassa GN=EO PE=1 SV=2 1773 2066 1.0E-06
sp|Q28719|PTGR1_RABIT Prostaglandin reductase 1 OS=Oryctolagus cuniculus GN=PTGR1 PE=2 SV=1 1830 2063 1.0E-06
sp|Q8WWV3|RT4I1_HUMAN Reticulon-4-interacting protein 1, mitochondrial OS=Homo sapiens GN=RTN4IP1 PE=1 SV=2 1803 2068 1.0E-06
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 2091 2276 2.0E-06
sp|Q0VC50|RT4I1_BOVIN Reticulon-4-interacting protein 1, mitochondrial OS=Bos taurus GN=RTN4IP1 PE=2 SV=1 1803 2068 2.0E-06
sp|Q29073|PTGR1_PIG Prostaglandin reductase 1 OS=Sus scrofa GN=PTGR1 PE=1 SV=1 1830 2066 2.0E-06
sp|O95825|QORL1_HUMAN Quinone oxidoreductase-like protein 1 OS=Homo sapiens GN=CRYZL1 PE=1 SV=2 1773 1959 3.0E-06
sp|O85140|FABD_SALTY Malonyl CoA-acyl carrier protein transacylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabD PE=1 SV=3 530 820 3.0E-06
sp|P0C842|CJ052_HUMAN Putative uncharacterized protein encoded by LINC00614 OS=Homo sapiens GN=LINC00614 PE=5 SV=1 44 139 4.0E-06
sp|O23939|ENOX_FRAVE 2-methylene-furan-3-one reductase OS=Fragaria vesca GN=EO PE=2 SV=2 1773 2066 4.0E-06
sp|O34812|YFMJ_BACSU Putative NADP-dependent oxidoreductase YfmJ OS=Bacillus subtilis (strain 168) GN=yfmJ PE=2 SV=1 1867 1967 5.0E-06
sp|A0R0B2|FABD_MYCS2 Malonyl CoA-acyl carrier protein transacylase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=fabD PE=1 SV=1 588 821 5.0E-06
sp|Q7A742|ADH_STAAN Alcohol dehydrogenase OS=Staphylococcus aureus (strain N315) GN=adh PE=1 SV=1 1795 2066 5.0E-06
sp|Q99W07|ADH_STAAM Alcohol dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=adh PE=3 SV=1 1795 2066 5.0E-06
sp|Q59A28|QORL1_BOVIN Quinone oxidoreductase-like protein 1 OS=Bos taurus GN=CRYZL1 PE=2 SV=1 1773 1959 6.0E-06
sp|P16539|KAS2_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 2 OS=Streptomyces glaucescens GN=tcmL PE=3 SV=2 7 384 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0008168 methyltransferase activity Yes
GO:0008150 biological_process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7340
MAEPMQPIAIVGFGLRLPGGVSSAEEFWDLLINKKDSRCRVPSDRFNVDAFYNPEADQHALPSDMGYFIRDNLKH
FDAHFFSMGHTEVERLDPQQRLLLEVVWECMENAGQSDWRGSQIGCFVGSFSNDFQGTSSAEPQATGGYHLTGTH
DFALSNRVSYEYDLIGPSMTVKTACSSSLVSLDQACKSLLCGDCSGAIVAGSSLIFQPDLTLAIADAGALSPIGI
CKVFDAEADGYVRAEAINAVYIKLLGDAVRDGDPIRGVIRSTVSNADGKSSSFIIPSSAAQVALVRRAYEIAGID
DLSQTPLVECHGTGTQVGDSAEATAMANVFGTLPTFITSVKPNIGHAEGASGLNSLIKAVLALEHQVIPPNIHFS
TPSPNIPFDQGKLKVPVEAVPWPKDRHARVSVNSFGIGGSNAHTIIDSAASFGYSCRKEPLLEHNGNDHAKGKAK
DERPRLLVTSAKSAPSLEKRMQDLSAYFESHPDCVTDLAYTLGARRQHLSYRSFAVSKGEDETLTFQSVRPVLKN
PIDVCFVFSGQGAQWSGMAKSLLQYPSFRHDVMLMDQALQASNEPPSWTLQEMLCADYIGHLINKSEYSQPLCTA
LQLALVNFYKRCGIVPLSVVGHSSGEIAAAYAAGAMSLEEAILNAHIRGLATALQARKGAMAAISLGRAQVVPFI
VQGVELACENSPQSVTLSGDLDALEQTIQAIAEKLPATYVRKLHVETAYHSVHMQEIGSVYENRLKQRILNGKGP
TIPFYSSVTGQRHIAKASLGPAYWRNNLEKPVLFNKSINSLLSNLEHDHDIIFLEIGPHATLEGPLRQILQQRKD
INISYVASLCRNEDSSTSLLTSLGHLYSYGHTIDFSVVNPPASVLTNLPLYPWSHTQEYWEESRLSIAQRRRKHI
YHELLGWQSPEAGDAQPMWRNVLRVNKVAWLCDHKVGKEILFPCAGYIAMLGEAIRQVTGSETYTLRNLVLKSAM
VLEERDATEIITTMRPLRLTHSSNSPSWYEFCVSSFNGSSWTENCFTQGRAGHDEATWQLPQMLLGPYQRRVDAK
HWYKQLQRLGMDFGPHFQQLTDITADPADTKAAATLSSRLVSQRAHYSVHPTVIDGCIQLCYAASIAGVIRRMER
LAVPQMVSLVYVEPGEPEFVAQARAKRANHGKLTVSASVASLNSNKVVVSLTDVACAPIDVGQANDDSLPMASRL
VWRPHIDLVDAATLVFRVPRREVMEAIERLCILGILQVADMLPRLSRPTGHLAKYSVWIQQHKEAAARGEWDWLT
EDVRQWSCLPDKQRCSLRDESAKQVELLISPLVAQLCCRMSNEEIVRGLFAGTINPIQMMMDQAQLADFYKFFHD
TFDLKELLLLMTHATPCLKVLEIGAGTGGTTESVLEALAPKDGPQLYSSYTFTDISAGFFPSAKERFKGYKGVNY
QALDISQDPIQQDFKPACYDLIIASNVFHATPSLQQSLQNARLLLRPGGRLILQEIIAPTATRWLFTSFIMGYLP
GWWLGEQDGRVEQPFVSLERWDMELREAGFTCNDSAVLDDNEPYQHIASIIATAAHATNPDRNVALVYKDNKTDF
ALQVARCLESQGFNMQWARLDDANAPTNQDVISFVDLEGPLFYNISEADFEAFKTWTTGMQSRPILWLTQSAQIG
CSDPRYGTTLGVARSIRYELTPNFCTLELDKLDSKQVDATVEVFNRIRQQSSSDFYDAEQEFAVHDGLVHVCRFD
WLHLRDELETVSKDNEPKRLAIAQLGQLDSLRWERYTMDADSGSLAADMVEVEVRCVGLNFKDVASAKGFLDEDN
PRFGFEGAGVVGRIGSHIVHVKPGDRVLFIFDGTFADRLVLHRDVVVPMPHSLSFQEGVTLPGCFTTAIYSLMNI
GQLSKGQSVLIHSACGGFGLAAIQICQMLGAEIYATVGSEEKVQYLVKTQGIPRERIFHSRDASFLAEVMRATAN
RGVDVVLNSLSGDLLDASWKCVAKQGKMMELGKRDLIGQGQVALEQFLGNRAYCGIDLMAVLYKDVGSLARMLKQ
AIDYYSQGKIKPLPYRVFDCWKVLDAFRYMQKGQHIGKIVVDMSSASQLPAMDCISQRPRLSSQATYLVVGGLGG
VSKAVATWAVENGARSFVFLSRSAGKSVEDQSFLLELEAQGCRAVAVRGSVADMADVERAVEAAPSPIAGVWQLA
MVLRDSPLFKMSHEEWLAALAPKVQGTWNLHKAFLHADLDFMVLFGSVTSLGGSMAQTNYSAANSFLDAFVQYRH
SLGLPCSVIDCGQIDGIGYVHDRPALRAIKGQQDVVFLHEGQVLDALQVCMNRSRPCKIGGAPKGAYTSSGQFVV
GFQSTRALSDEQSRFYWRRDIRMASFHQYEAANNKNSRDQGTNNFLDSVAAKPQMLLEPDSLRFVCDMISRVLCG
FLLHPPDQVNTKSSLASMGLDSLVRAEFVLWWRKAFGVDVSAFAIANAENIENLAQLAMRLLQEKHGVAHKEPR*
Coding >OphauB2|7340
ATGGCAGAGCCGATGCAACCCATTGCCATTGTGGGATTTGGGCTTAGATTGCCCGGCGGGGTGTCGAGCGCTGAA
GAATTCTGGGATTTGCTCATCAACAAGAAGGATAGCAGATGTCGCGTTCCAAGTGATCGCTTCAATGTCGACGCT
TTCTATAATCCTGAGGCGGATCAGCATGCACTTCCGTCTGACATGGGATACTTTATACGCGATAATTTGAAGCAT
TTTGATGCCCATTTCTTCTCCATGGGCCATACCGAAGTGGAACGCCTTGATCCGCAGCAGCGCCTTTTGCTCGAG
GTGGTTTGGGAGTGCATGGAAAATGCCGGGCAGAGTGATTGGCGAGGGTCGCAAATTGGCTGTTTTGTCGGCAGC
TTTAGCAATGATTTTCAAGGCACTAGCAGCGCTGAACCACAGGCGACGGGGGGTTATCACCTGACGGGCACTCAT
GACTTTGCTCTTTCCAACCGCGTCTCTTATGAGTACGATCTCATAGGACCTAGTATGACAGTCAAGACAGCATGT
TCATCCTCTCTCGTCAGTCTTGACCAAGCTTGCAAGAGCCTCCTTTGTGGCGACTGCTCCGGGGCCATTGTGGCC
GGTTCGAGTTTGATTTTCCAGCCCGACTTGACGCTCGCCATAGCAGACGCAGGCGCCTTATCACCCATAGGAATC
TGTAAAGTATTTGACGCAGAAGCTGACGGCTATGTACGGGCCGAGGCCATAAACGCAGTCTATATCAAACTACTT
GGTGACGCGGTGCGTGACGGGGATCCGATTCGCGGCGTTATTCGCTCTACTGTTAGCAATGCCGATGGAAAAAGC
AGCAGTTTTATCATTCCCAGCTCTGCGGCACAAGTGGCTCTGGTGCGCCGGGCGTACGAGATTGCTGGTATAGAC
GACTTGTCGCAGACGCCTCTGGTTGAGTGTCACGGAACTGGAACCCAAGTCGGCGACTCGGCGGAAGCCACGGCC
ATGGCCAATGTTTTTGGGACTTTGCCTACCTTTATTACATCGGTCAAGCCCAACATTGGCCATGCCGAGGGCGCC
TCTGGCCTCAATAGTCTCATCAAGGCAGTCCTGGCTTTGGAACACCAAGTCATACCGCCAAACATTCATTTTTCG
ACACCCAGCCCCAATATCCCTTTTGACCAAGGCAAGCTAAAAGTGCCCGTCGAGGCCGTCCCTTGGCCCAAAGAC
CGACATGCCCGTGTCAGCGTCAACTCGTTTGGCATTGGCGGCTCCAATGCTCACACCATTATCGACTCTGCAGCC
TCGTTTGGATACTCGTGCCGCAAGGAGCCACTTCTCGAACACAATGGAAATGACCATGCCAAAGGAAAAGCAAAA
GATGAGCGGCCAAGACTCCTTGTCACCTCGGCAAAGAGCGCCCCGTCGCTCGAGAAGCGCATGCAGGATCTGTCG
GCCTACTTTGAATCTCATCCAGACTGTGTGACCGACTTGGCATACACACTTGGCGCGCGTCGACAACACTTGTCC
TATAGGTCATTCGCCGTATCCAAGGGCGAGGATGAGACGTTGACTTTCCAGAGTGTCCGCCCGGTGCTCAAAAAT
CCCATTGACGTGTGTTTTGTCTTTAGCGGCCAGGGCGCCCAATGGTCGGGCATGGCCAAATCTCTCCTTCAATAT
CCCTCCTTTCGCCACGATGTCATGCTTATGGATCAGGCACTGCAAGCGAGCAATGAGCCCCCGTCGTGGACTCTG
CAAGAAATGCTGTGCGCCGATTATATCGGGCATCTAATTAACAAATCTGAGTATTCGCAGCCTCTGTGCACTGCT
CTCCAACTGGCACTTGTCAACTTTTACAAGAGATGTGGCATTGTTCCATTGTCTGTTGTTGGTCATTCTTCTGGT
GAGATAGCTGCTGCGTATGCTGCTGGGGCAATGTCACTCGAGGAAGCCATTTTGAATGCACATATACGTGGTCTT
GCGACTGCTTTGCAGGCGCGAAAAGGAGCCATGGCAGCAATCAGTTTGGGGCGAGCACAAGTAGTGCCCTTTATT
GTCCAGGGCGTTGAATTGGCCTGTGAGAATAGTCCACAGAGCGTCACTTTGTCTGGCGATCTGGACGCTTTGGAG
CAGACTATACAAGCCATCGCGGAAAAGTTACCCGCCACATATGTTCGGAAGCTGCATGTCGAAACTGCCTATCAC
TCGGTGCACATGCAAGAAATCGGCTCCGTGTACGAGAATAGACTCAAACAGCGGATTTTGAATGGAAAAGGCCCG
ACCATACCCTTTTACTCAAGCGTGACGGGCCAAAGGCATATAGCCAAGGCGAGCCTGGGACCGGCATACTGGAGA
AACAACCTCGAGAAACCAGTTCTCTTCAACAAATCTATAAACTCTCTCTTGAGTAATCTCGAGCATGACCATGAT
ATCATCTTTCTCGAGATTGGACCCCACGCCACTCTCGAGGGCCCGCTGCGACAGATTTTACAGCAACGCAAAGAC
ATAAACATTTCCTATGTGGCGTCTTTGTGCAGGAATGAAGACTCGAGCACGTCACTGCTCACATCGTTAGGCCAT
TTGTACTCTTATGGCCACACGATTGATTTTTCAGTTGTGAATCCACCAGCGTCGGTACTCACAAACCTGCCCCTA
TATCCATGGAGCCACACGCAGGAATATTGGGAGGAAAGTCGCCTATCCATAGCTCAGCGACGGCGCAAGCACATC
TACCACGAACTCCTGGGATGGCAAAGTCCCGAAGCTGGCGATGCCCAGCCCATGTGGAGAAATGTTCTCCGTGTT
AACAAGGTTGCTTGGCTCTGCGACCACAAGGTTGGGAAAGAGATTTTGTTCCCTTGTGCAGGCTACATTGCCATG
CTGGGCGAGGCTATCCGACAGGTGACGGGCTCAGAGACATATACTCTGCGCAATCTCGTCCTCAAGTCAGCCATG
GTGCTTGAAGAACGGGACGCGACCGAAATCATTACCACGATGCGGCCTTTGCGCTTGACGCATAGTTCAAACTCG
CCATCGTGGTATGAATTCTGCGTTTCATCTTTTAATGGATCATCGTGGACGGAGAATTGCTTTACTCAAGGCAGA
GCTGGTCATGACGAAGCGACCTGGCAGCTTCCACAGATGCTTCTTGGGCCGTACCAGCGGAGAGTCGACGCCAAA
CACTGGTACAAACAGTTGCAACGTCTCGGCATGGACTTTGGGCCGCACTTTCAGCAATTGACAGACATTACTGCT
GACCCGGCCGACACAAAAGCAGCAGCCACTCTGTCTAGCCGCTTGGTCAGCCAGAGAGCCCACTACTCAGTTCAC
CCTACGGTTATTGATGGCTGTATCCAGCTCTGTTATGCCGCTTCGATTGCAGGTGTAATTCGGCGCATGGAAAGG
CTGGCCGTCCCCCAGATGGTGAGCCTTGTGTATGTCGAGCCTGGCGAACCTGAATTTGTGGCACAAGCACGGGCA
AAGCGCGCGAATCATGGCAAACTCACAGTGTCGGCCAGTGTAGCTTCACTGAACAGCAACAAGGTTGTCGTCAGC
CTCACAGATGTGGCGTGTGCTCCAATTGATGTGGGTCAAGCAAACGACGACAGTCTTCCCATGGCATCCCGCCTA
GTCTGGCGTCCGCATATTGATCTTGTCGATGCTGCAACACTGGTCTTCAGGGTGCCGAGGCGAGAGGTAATGGAG
GCAATAGAAAGACTGTGCATCCTTGGCATCTTGCAAGTTGCAGATATGTTGCCGCGACTGTCCCGGCCAACCGGA
CACTTGGCCAAGTATTCCGTCTGGATTCAGCAACACAAAGAGGCCGCGGCACGAGGCGAGTGGGACTGGCTGACG
GAAGATGTGCGCCAATGGTCTTGTTTGCCTGACAAACAAAGATGCTCGCTCAGGGATGAATCCGCCAAGCAGGTA
GAGCTTCTCATCAGCCCCCTAGTTGCTCAGCTATGCTGCAGAATGAGCAACGAAGAGATAGTTAGAGGCCTCTTT
GCCGGGACCATCAACCCCATTCAGATGATGATGGATCAAGCTCAACTGGCTGACTTCTACAAATTTTTTCATGAC
ACGTTTGACTTGAAGGAACTTTTATTATTAATGACACATGCAACACCTTGCTTGAAAGTGCTGGAAATTGGCGCC
GGAACCGGAGGGACAACAGAGAGTGTGCTTGAAGCCCTTGCGCCTAAAGACGGCCCTCAACTCTATAGCAGCTAC
ACCTTTACCGACATTTCTGCTGGCTTCTTCCCCTCTGCCAAGGAGCGGTTCAAGGGCTACAAGGGTGTCAACTAT
CAGGCCTTGGATATTTCTCAAGATCCCATTCAGCAAGACTTCAAGCCAGCATGTTATGATTTGATTATTGCCAGC
AATGTCTTTCATGCCACTCCTTCGCTTCAGCAGTCGCTGCAAAACGCACGGCTACTTCTCCGGCCAGGAGGTCGT
CTAATCTTGCAAGAAATAATCGCACCAACAGCGACGCGATGGCTATTTACCAGTTTCATCATGGGCTATCTCCCC
GGTTGGTGGCTAGGGGAGCAAGACGGACGTGTCGAGCAGCCGTTTGTCTCTCTAGAGCGTTGGGATATGGAGCTT
CGAGAGGCAGGCTTCACGTGTAATGATTCCGCTGTTCTAGATGACAACGAGCCATACCAGCATATAGCCAGCATC
ATTGCAACGGCTGCGCACGCCACCAATCCTGACAGAAACGTGGCACTTGTTTACAAAGACAACAAGACCGACTTT
GCCTTGCAAGTTGCTCGCTGTCTTGAGAGCCAAGGATTCAATATGCAATGGGCTAGGCTTGACGACGCAAATGCC
CCCACCAACCAGGATGTCATTTCCTTTGTCGACTTGGAGGGCCCCTTGTTTTATAATATATCAGAGGCCGATTTT
GAGGCCTTCAAGACGTGGACTACGGGAATGCAGAGCCGCCCCATCCTATGGTTGACACAGTCTGCTCAAATTGGC
TGCTCAGATCCGCGCTACGGGACGACACTGGGCGTGGCCCGCAGCATTAGATACGAATTGACACCCAATTTTTGC
ACCCTGGAGCTTGACAAATTGGATTCTAAACAAGTGGATGCCACGGTTGAAGTTTTTAACAGGATCCGACAGCAA
TCTTCTTCCGACTTCTACGATGCCGAGCAAGAATTTGCAGTCCATGACGGGCTTGTCCATGTTTGTCGCTTCGAC
TGGTTGCATTTGAGGGACGAGCTCGAGACTGTCTCAAAAGATAATGAACCCAAGCGTCTGGCTATTGCTCAGCTA
GGGCAGCTGGACTCGCTGCGATGGGAGCGCTATACCATGGACGCTGACTCTGGGAGTCTGGCGGCAGATATGGTA
GAAGTCGAGGTCCGCTGCGTTGGATTGAACTTTAAAGATGTGGCCTCAGCCAAAGGATTTTTGGATGAGGATAAC
CCGCGTTTTGGCTTCGAGGGCGCAGGTGTCGTTGGTCGCATCGGTTCTCATATTGTTCACGTCAAACCAGGAGAC
CGCGTCCTCTTCATCTTCGACGGCACTTTCGCAGATCGTCTAGTGCTCCATCGAGACGTTGTGGTTCCGATGCCG
CACAGTTTGAGCTTCCAGGAGGGAGTCACCTTACCCGGGTGTTTTACCACAGCCATATACTCTCTGATGAATATT
GGGCAGCTATCCAAGGGACAGTCTGTCTTGATTCACTCAGCCTGTGGTGGGTTTGGACTTGCCGCGATTCAGATT
TGTCAAATGCTGGGAGCTGAGATATACGCAACGGTCGGAAGTGAAGAAAAGGTGCAGTACCTTGTGAAAACCCAA
GGAATCCCTCGAGAGAGAATATTCCACTCTCGGGATGCTAGTTTCTTAGCCGAAGTCATGCGAGCCACAGCTAAT
CGCGGCGTGGATGTTGTGCTCAACTCTCTCTCTGGAGACCTGCTTGATGCATCTTGGAAATGCGTTGCCAAACAG
GGCAAGATGATGGAGCTGGGCAAACGAGACCTCATAGGTCAAGGCCAAGTAGCCCTCGAACAATTTCTAGGTAAC
CGGGCATACTGCGGCATCGATCTCATGGCTGTCTTGTATAAAGACGTTGGATCATTGGCGAGGATGTTGAAGCAG
GCCATCGACTATTACAGCCAGGGAAAGATTAAGCCGCTGCCATATCGCGTCTTTGACTGTTGGAAAGTGTTGGAT
GCGTTTCGATACATGCAGAAAGGGCAACACATTGGTAAGATTGTCGTCGACATGTCTTCAGCTAGCCAGCTGCCT
GCCATGGACTGCATCTCGCAGCGGCCTCGGCTCTCGAGCCAGGCGACGTATCTTGTTGTCGGCGGCCTCGGGGGC
GTGAGCAAGGCGGTTGCAACGTGGGCCGTGGAAAACGGGGCTCGCAGCTTTGTCTTTTTGTCCCGGTCTGCAGGC
AAGTCGGTGGAGGATCAGAGCTTCCTCTTGGAGCTCGAGGCGCAGGGCTGCCGTGCCGTTGCTGTGCGTGGCAGC
GTGGCCGACATGGCAGATGTTGAAAGAGCCGTCGAAGCGGCGCCGTCGCCCATAGCAGGTGTTTGGCAACTAGCC
ATGGTGCTCAGGGACAGCCCCTTGTTCAAGATGAGCCATGAAGAGTGGCTTGCCGCGCTGGCGCCCAAGGTTCAG
GGCACCTGGAACCTGCACAAGGCTTTCCTGCATGCCGACCTAGACTTTATGGTGCTTTTTGGCTCCGTTACTAGC
CTGGGTGGGTCCATGGCGCAGACAAATTACTCGGCAGCCAATTCCTTTTTAGATGCTTTTGTGCAGTACCGCCAT
AGCCTCGGCCTGCCGTGCAGCGTCATTGACTGCGGCCAGATCGACGGCATTGGCTATGTTCACGACCGACCTGCT
CTGCGGGCCATCAAAGGCCAACAAGACGTGGTGTTTTTGCACGAAGGTCAAGTGCTCGACGCGCTGCAAGTGTGC
ATGAACCGCTCCCGGCCGTGCAAAATAGGCGGCGCGCCCAAGGGAGCCTATACCAGCTCGGGCCAGTTCGTTGTT
GGCTTCCAATCCACCAGGGCGCTATCGGATGAGCAGAGCAGATTCTATTGGCGGCGCGACATTCGCATGGCCTCG
TTCCATCAATACGAGGCGGCCAATAACAAGAATAGTCGTGATCAGGGCACCAATAACTTCCTCGACTCGGTGGCG
GCCAAGCCGCAAATGCTCCTTGAGCCGGACAGTTTGCGCTTTGTTTGCGACATGATTTCACGCGTCTTGTGCGGT
TTCCTTCTGCATCCGCCTGACCAGGTCAACACCAAGAGCAGCCTGGCGTCTATGGGCCTCGACTCCCTCGTCAGG
GCGGAGTTTGTCCTATGGTGGCGTAAAGCCTTTGGTGTCGATGTTAGTGCCTTTGCAATCGCGAATGCGGAGAAT
ATTGAAAATTTGGCACAGCTGGCGATGCGTCTGTTGCAGGAAAAGCATGGGGTTGCGCACAAGGAGCCACGTTGA
Transcript >OphauB2|7340
ATGGCAGAGCCGATGCAACCCATTGCCATTGTGGGATTTGGGCTTAGATTGCCCGGCGGGGTGTCGAGCGCTGAA
GAATTCTGGGATTTGCTCATCAACAAGAAGGATAGCAGATGTCGCGTTCCAAGTGATCGCTTCAATGTCGACGCT
TTCTATAATCCTGAGGCGGATCAGCATGCACTTCCGTCTGACATGGGATACTTTATACGCGATAATTTGAAGCAT
TTTGATGCCCATTTCTTCTCCATGGGCCATACCGAAGTGGAACGCCTTGATCCGCAGCAGCGCCTTTTGCTCGAG
GTGGTTTGGGAGTGCATGGAAAATGCCGGGCAGAGTGATTGGCGAGGGTCGCAAATTGGCTGTTTTGTCGGCAGC
TTTAGCAATGATTTTCAAGGCACTAGCAGCGCTGAACCACAGGCGACGGGGGGTTATCACCTGACGGGCACTCAT
GACTTTGCTCTTTCCAACCGCGTCTCTTATGAGTACGATCTCATAGGACCTAGTATGACAGTCAAGACAGCATGT
TCATCCTCTCTCGTCAGTCTTGACCAAGCTTGCAAGAGCCTCCTTTGTGGCGACTGCTCCGGGGCCATTGTGGCC
GGTTCGAGTTTGATTTTCCAGCCCGACTTGACGCTCGCCATAGCAGACGCAGGCGCCTTATCACCCATAGGAATC
TGTAAAGTATTTGACGCAGAAGCTGACGGCTATGTACGGGCCGAGGCCATAAACGCAGTCTATATCAAACTACTT
GGTGACGCGGTGCGTGACGGGGATCCGATTCGCGGCGTTATTCGCTCTACTGTTAGCAATGCCGATGGAAAAAGC
AGCAGTTTTATCATTCCCAGCTCTGCGGCACAAGTGGCTCTGGTGCGCCGGGCGTACGAGATTGCTGGTATAGAC
GACTTGTCGCAGACGCCTCTGGTTGAGTGTCACGGAACTGGAACCCAAGTCGGCGACTCGGCGGAAGCCACGGCC
ATGGCCAATGTTTTTGGGACTTTGCCTACCTTTATTACATCGGTCAAGCCCAACATTGGCCATGCCGAGGGCGCC
TCTGGCCTCAATAGTCTCATCAAGGCAGTCCTGGCTTTGGAACACCAAGTCATACCGCCAAACATTCATTTTTCG
ACACCCAGCCCCAATATCCCTTTTGACCAAGGCAAGCTAAAAGTGCCCGTCGAGGCCGTCCCTTGGCCCAAAGAC
CGACATGCCCGTGTCAGCGTCAACTCGTTTGGCATTGGCGGCTCCAATGCTCACACCATTATCGACTCTGCAGCC
TCGTTTGGATACTCGTGCCGCAAGGAGCCACTTCTCGAACACAATGGAAATGACCATGCCAAAGGAAAAGCAAAA
GATGAGCGGCCAAGACTCCTTGTCACCTCGGCAAAGAGCGCCCCGTCGCTCGAGAAGCGCATGCAGGATCTGTCG
GCCTACTTTGAATCTCATCCAGACTGTGTGACCGACTTGGCATACACACTTGGCGCGCGTCGACAACACTTGTCC
TATAGGTCATTCGCCGTATCCAAGGGCGAGGATGAGACGTTGACTTTCCAGAGTGTCCGCCCGGTGCTCAAAAAT
CCCATTGACGTGTGTTTTGTCTTTAGCGGCCAGGGCGCCCAATGGTCGGGCATGGCCAAATCTCTCCTTCAATAT
CCCTCCTTTCGCCACGATGTCATGCTTATGGATCAGGCACTGCAAGCGAGCAATGAGCCCCCGTCGTGGACTCTG
CAAGAAATGCTGTGCGCCGATTATATCGGGCATCTAATTAACAAATCTGAGTATTCGCAGCCTCTGTGCACTGCT
CTCCAACTGGCACTTGTCAACTTTTACAAGAGATGTGGCATTGTTCCATTGTCTGTTGTTGGTCATTCTTCTGGT
GAGATAGCTGCTGCGTATGCTGCTGGGGCAATGTCACTCGAGGAAGCCATTTTGAATGCACATATACGTGGTCTT
GCGACTGCTTTGCAGGCGCGAAAAGGAGCCATGGCAGCAATCAGTTTGGGGCGAGCACAAGTAGTGCCCTTTATT
GTCCAGGGCGTTGAATTGGCCTGTGAGAATAGTCCACAGAGCGTCACTTTGTCTGGCGATCTGGACGCTTTGGAG
CAGACTATACAAGCCATCGCGGAAAAGTTACCCGCCACATATGTTCGGAAGCTGCATGTCGAAACTGCCTATCAC
TCGGTGCACATGCAAGAAATCGGCTCCGTGTACGAGAATAGACTCAAACAGCGGATTTTGAATGGAAAAGGCCCG
ACCATACCCTTTTACTCAAGCGTGACGGGCCAAAGGCATATAGCCAAGGCGAGCCTGGGACCGGCATACTGGAGA
AACAACCTCGAGAAACCAGTTCTCTTCAACAAATCTATAAACTCTCTCTTGAGTAATCTCGAGCATGACCATGAT
ATCATCTTTCTCGAGATTGGACCCCACGCCACTCTCGAGGGCCCGCTGCGACAGATTTTACAGCAACGCAAAGAC
ATAAACATTTCCTATGTGGCGTCTTTGTGCAGGAATGAAGACTCGAGCACGTCACTGCTCACATCGTTAGGCCAT
TTGTACTCTTATGGCCACACGATTGATTTTTCAGTTGTGAATCCACCAGCGTCGGTACTCACAAACCTGCCCCTA
TATCCATGGAGCCACACGCAGGAATATTGGGAGGAAAGTCGCCTATCCATAGCTCAGCGACGGCGCAAGCACATC
TACCACGAACTCCTGGGATGGCAAAGTCCCGAAGCTGGCGATGCCCAGCCCATGTGGAGAAATGTTCTCCGTGTT
AACAAGGTTGCTTGGCTCTGCGACCACAAGGTTGGGAAAGAGATTTTGTTCCCTTGTGCAGGCTACATTGCCATG
CTGGGCGAGGCTATCCGACAGGTGACGGGCTCAGAGACATATACTCTGCGCAATCTCGTCCTCAAGTCAGCCATG
GTGCTTGAAGAACGGGACGCGACCGAAATCATTACCACGATGCGGCCTTTGCGCTTGACGCATAGTTCAAACTCG
CCATCGTGGTATGAATTCTGCGTTTCATCTTTTAATGGATCATCGTGGACGGAGAATTGCTTTACTCAAGGCAGA
GCTGGTCATGACGAAGCGACCTGGCAGCTTCCACAGATGCTTCTTGGGCCGTACCAGCGGAGAGTCGACGCCAAA
CACTGGTACAAACAGTTGCAACGTCTCGGCATGGACTTTGGGCCGCACTTTCAGCAATTGACAGACATTACTGCT
GACCCGGCCGACACAAAAGCAGCAGCCACTCTGTCTAGCCGCTTGGTCAGCCAGAGAGCCCACTACTCAGTTCAC
CCTACGGTTATTGATGGCTGTATCCAGCTCTGTTATGCCGCTTCGATTGCAGGTGTAATTCGGCGCATGGAAAGG
CTGGCCGTCCCCCAGATGGTGAGCCTTGTGTATGTCGAGCCTGGCGAACCTGAATTTGTGGCACAAGCACGGGCA
AAGCGCGCGAATCATGGCAAACTCACAGTGTCGGCCAGTGTAGCTTCACTGAACAGCAACAAGGTTGTCGTCAGC
CTCACAGATGTGGCGTGTGCTCCAATTGATGTGGGTCAAGCAAACGACGACAGTCTTCCCATGGCATCCCGCCTA
GTCTGGCGTCCGCATATTGATCTTGTCGATGCTGCAACACTGGTCTTCAGGGTGCCGAGGCGAGAGGTAATGGAG
GCAATAGAAAGACTGTGCATCCTTGGCATCTTGCAAGTTGCAGATATGTTGCCGCGACTGTCCCGGCCAACCGGA
CACTTGGCCAAGTATTCCGTCTGGATTCAGCAACACAAAGAGGCCGCGGCACGAGGCGAGTGGGACTGGCTGACG
GAAGATGTGCGCCAATGGTCTTGTTTGCCTGACAAACAAAGATGCTCGCTCAGGGATGAATCCGCCAAGCAGGTA
GAGCTTCTCATCAGCCCCCTAGTTGCTCAGCTATGCTGCAGAATGAGCAACGAAGAGATAGTTAGAGGCCTCTTT
GCCGGGACCATCAACCCCATTCAGATGATGATGGATCAAGCTCAACTGGCTGACTTCTACAAATTTTTTCATGAC
ACGTTTGACTTGAAGGAACTTTTATTATTAATGACACATGCAACACCTTGCTTGAAAGTGCTGGAAATTGGCGCC
GGAACCGGAGGGACAACAGAGAGTGTGCTTGAAGCCCTTGCGCCTAAAGACGGCCCTCAACTCTATAGCAGCTAC
ACCTTTACCGACATTTCTGCTGGCTTCTTCCCCTCTGCCAAGGAGCGGTTCAAGGGCTACAAGGGTGTCAACTAT
CAGGCCTTGGATATTTCTCAAGATCCCATTCAGCAAGACTTCAAGCCAGCATGTTATGATTTGATTATTGCCAGC
AATGTCTTTCATGCCACTCCTTCGCTTCAGCAGTCGCTGCAAAACGCACGGCTACTTCTCCGGCCAGGAGGTCGT
CTAATCTTGCAAGAAATAATCGCACCAACAGCGACGCGATGGCTATTTACCAGTTTCATCATGGGCTATCTCCCC
GGTTGGTGGCTAGGGGAGCAAGACGGACGTGTCGAGCAGCCGTTTGTCTCTCTAGAGCGTTGGGATATGGAGCTT
CGAGAGGCAGGCTTCACGTGTAATGATTCCGCTGTTCTAGATGACAACGAGCCATACCAGCATATAGCCAGCATC
ATTGCAACGGCTGCGCACGCCACCAATCCTGACAGAAACGTGGCACTTGTTTACAAAGACAACAAGACCGACTTT
GCCTTGCAAGTTGCTCGCTGTCTTGAGAGCCAAGGATTCAATATGCAATGGGCTAGGCTTGACGACGCAAATGCC
CCCACCAACCAGGATGTCATTTCCTTTGTCGACTTGGAGGGCCCCTTGTTTTATAATATATCAGAGGCCGATTTT
GAGGCCTTCAAGACGTGGACTACGGGAATGCAGAGCCGCCCCATCCTATGGTTGACACAGTCTGCTCAAATTGGC
TGCTCAGATCCGCGCTACGGGACGACACTGGGCGTGGCCCGCAGCATTAGATACGAATTGACACCCAATTTTTGC
ACCCTGGAGCTTGACAAATTGGATTCTAAACAAGTGGATGCCACGGTTGAAGTTTTTAACAGGATCCGACAGCAA
TCTTCTTCCGACTTCTACGATGCCGAGCAAGAATTTGCAGTCCATGACGGGCTTGTCCATGTTTGTCGCTTCGAC
TGGTTGCATTTGAGGGACGAGCTCGAGACTGTCTCAAAAGATAATGAACCCAAGCGTCTGGCTATTGCTCAGCTA
GGGCAGCTGGACTCGCTGCGATGGGAGCGCTATACCATGGACGCTGACTCTGGGAGTCTGGCGGCAGATATGGTA
GAAGTCGAGGTCCGCTGCGTTGGATTGAACTTTAAAGATGTGGCCTCAGCCAAAGGATTTTTGGATGAGGATAAC
CCGCGTTTTGGCTTCGAGGGCGCAGGTGTCGTTGGTCGCATCGGTTCTCATATTGTTCACGTCAAACCAGGAGAC
CGCGTCCTCTTCATCTTCGACGGCACTTTCGCAGATCGTCTAGTGCTCCATCGAGACGTTGTGGTTCCGATGCCG
CACAGTTTGAGCTTCCAGGAGGGAGTCACCTTACCCGGGTGTTTTACCACAGCCATATACTCTCTGATGAATATT
GGGCAGCTATCCAAGGGACAGTCTGTCTTGATTCACTCAGCCTGTGGTGGGTTTGGACTTGCCGCGATTCAGATT
TGTCAAATGCTGGGAGCTGAGATATACGCAACGGTCGGAAGTGAAGAAAAGGTGCAGTACCTTGTGAAAACCCAA
GGAATCCCTCGAGAGAGAATATTCCACTCTCGGGATGCTAGTTTCTTAGCCGAAGTCATGCGAGCCACAGCTAAT
CGCGGCGTGGATGTTGTGCTCAACTCTCTCTCTGGAGACCTGCTTGATGCATCTTGGAAATGCGTTGCCAAACAG
GGCAAGATGATGGAGCTGGGCAAACGAGACCTCATAGGTCAAGGCCAAGTAGCCCTCGAACAATTTCTAGGTAAC
CGGGCATACTGCGGCATCGATCTCATGGCTGTCTTGTATAAAGACGTTGGATCATTGGCGAGGATGTTGAAGCAG
GCCATCGACTATTACAGCCAGGGAAAGATTAAGCCGCTGCCATATCGCGTCTTTGACTGTTGGAAAGTGTTGGAT
GCGTTTCGATACATGCAGAAAGGGCAACACATTGGTAAGATTGTCGTCGACATGTCTTCAGCTAGCCAGCTGCCT
GCCATGGACTGCATCTCGCAGCGGCCTCGGCTCTCGAGCCAGGCGACGTATCTTGTTGTCGGCGGCCTCGGGGGC
GTGAGCAAGGCGGTTGCAACGTGGGCCGTGGAAAACGGGGCTCGCAGCTTTGTCTTTTTGTCCCGGTCTGCAGGC
AAGTCGGTGGAGGATCAGAGCTTCCTCTTGGAGCTCGAGGCGCAGGGCTGCCGTGCCGTTGCTGTGCGTGGCAGC
GTGGCCGACATGGCAGATGTTGAAAGAGCCGTCGAAGCGGCGCCGTCGCCCATAGCAGGTGTTTGGCAACTAGCC
ATGGTGCTCAGGGACAGCCCCTTGTTCAAGATGAGCCATGAAGAGTGGCTTGCCGCGCTGGCGCCCAAGGTTCAG
GGCACCTGGAACCTGCACAAGGCTTTCCTGCATGCCGACCTAGACTTTATGGTGCTTTTTGGCTCCGTTACTAGC
CTGGGTGGGTCCATGGCGCAGACAAATTACTCGGCAGCCAATTCCTTTTTAGATGCTTTTGTGCAGTACCGCCAT
AGCCTCGGCCTGCCGTGCAGCGTCATTGACTGCGGCCAGATCGACGGCATTGGCTATGTTCACGACCGACCTGCT
CTGCGGGCCATCAAAGGCCAACAAGACGTGGTGTTTTTGCACGAAGGTCAAGTGCTCGACGCGCTGCAAGTGTGC
ATGAACCGCTCCCGGCCGTGCAAAATAGGCGGCGCGCCCAAGGGAGCCTATACCAGCTCGGGCCAGTTCGTTGTT
GGCTTCCAATCCACCAGGGCGCTATCGGATGAGCAGAGCAGATTCTATTGGCGGCGCGACATTCGCATGGCCTCG
TTCCATCAATACGAGGCGGCCAATAACAAGAATAGTCGTGATCAGGGCACCAATAACTTCCTCGACTCGGTGGCG
GCCAAGCCGCAAATGCTCCTTGAGCCGGACAGTTTGCGCTTTGTTTGCGACATGATTTCACGCGTCTTGTGCGGT
TTCCTTCTGCATCCGCCTGACCAGGTCAACACCAAGAGCAGCCTGGCGTCTATGGGCCTCGACTCCCTCGTCAGG
GCGGAGTTTGTCCTATGGTGGCGTAAAGCCTTTGGTGTCGATGTTAGTGCCTTTGCAATCGCGAATGCGGAGAAT
ATTGAAAATTTGGCACAGCTGGCGATGCGTCTGTTGCAGGAAAAGCATGGGGTTGCGCACAAGGAGCCACGTTGA
Gene >OphauB2|7340
ATGGCAGAGCCGATGCAACCCATTGCCATTGTGGGATTTGGGCTTAGATTGCCCGGCGGGGTGTCGAGCGCTGAA
GAATTCTGGGATTTGCTCATCAACAAGAAGGATAGCAGATGTCGCGTTCCAAGTGATCGCTTCAATGTCGACGCT
TTCTATAATCCTGAGGCGGATCAGCATGCACTTCCGTCTGACATGGGATACTTTATACGCGATAATTTGAAGCAT
TTTGATGCCCATTTCTTCTCCATGGGCCATACCGAAGTGGAACGCCTTGATCCGCAGCAGCGCCTTTTGCTCGAG
GTGGTTTGGGAGTGCATGGAAAATGCCGGGCAGAGTGATTGGCGAGGGTCGCAAATTGGCTGTTTTGTCGGCAGC
TTTAGCAATGATTTTCAAGGCACTAGCAGCGCTGAACCACAGGCGACGGGGGGTTATCACCTGACGGGCACTCAT
GACTTTGCTCTTTCCAACCGCGTCTCTTATGAGTACGATCTCATAGGACCTAGGTGAGCAAACCCCGTTGCAATA
GCCATGGCTGTCACATGTACTGAGACCATGGATAGTATGACAGTCAAGACAGCATGTTCATCCTCTCTCGTCAGT
CTTGACCAAGCTTGCAAGAGCCTCCTTTGTGGCGACTGCTCCGGGGCCATTGTGGCCGGTTCGAGTTTGATTTTC
CAGCCCGACTTGACGCTCGCCATAGCAGACGCAGGCGCCTTATCACCCATAGGAATCTGTAAAGTATTTGACGCA
GAAGCTGACGGCTATGTACGGGCCGAGGCCATAAACGCAGTCTATATCAAACTACTTGGTGACGCGGTGCGTGAC
GGGGATCCGATTCGCGGCGTTATTCGCTCTACTGTTAGCAATGCCGATGGAAAAAGCAGCAGTTTTATCATTCCC
AGCTCTGCGGCACAAGTGGCTCTGGTGCGCCGGGCGTACGAGATTGCTGGTATAGACGACTTGTCGCAGACGCCT
CTGGTTGAGTGTCACGGAACTGGAACCCAAGTCGGCGACTCGGCGGAAGCCACGGCCATGGCCAATGTTTTTGGG
ACTTTGCCTACCTTTATTACATCGGTAAGCATCCTAGCCATGCAGTCAATTGCTGTCAAGCGCCAAAAGGAGGCA
TTTCAAAGCTGAAGAGGTGCAAGAAGCCTCTACTGCAAACCTGCTCTTACAAACTTGCTCTCACACAAATGCCCG
GGCAGCTGAGTAATGATTTTTGACCAATCACGGCTAGATTTTTGACTGCTTTGCCCCGCATAACCCAAAACAGCA
GCTAATGCATCAATGTCCTACATTTCTAGGTCAAGCCCAACATTGGCCATGCCGAGGGCGCCTCTGGCCTCAATA
GTCTCATCAAGGCAGTCCTGGCTTTGGAACACCAAGTCATACCGCCAAACATTCATTTTTCGACACCCAGCCCCA
ATAGTACGTTGACCCTTGCCCATTCCATCCTTGCCTAGTCTGATTTGCCTTGTCCTTGCCAAATACATACTTGCT
TTGGTCTAACTCGCCTTTCCAGTCCCTTTTGACCAAGGCAAGCTAAAAGTGCCCGTCGAGGCCGTCCCTTGGCCC
AAAGACCGACATGCCCGTGTCAGCGTCAACTCGTTTGGCATTGGCGGCTCCAATGCTCACGTGAGTCCATTGTCA
CTTCAAAGTTCAACGTCCTTGTGCTCAAGCAAGCTCGTCCTGATTGATTTGCAGACCATTATCGACTCTGCAGCC
TCGTTTGGATACTCGTGCCGCAAGGAGCCACTTCTCGAACACAATGGAAATGACCATGCCAAAGGAAAAGCAAAA
GATGAGCGGCCAAGACTCCTTGTCACCTCGGCAAAGAGCGCCCCGTCGCTCGAGAAGCGCATGCAGGATCTGTCG
GCCTACTTTGAATCTCATCCAGACTGTGTGACCGACTTGGCATACACACTTGGCGCGCGTCGACAACACTTGTCC
TATAGGTCATTCGCCGTATCCAAGGGCGAGGATGAGACGTTGACTTTCCAGAGTGTCCGCCCGGTGCTCAAAAAT
CCCATTGACGTGTGTTTTGTCTTTAGCGGCCAGGGCGCCCAATGGTCGGGCATGGCCAAATCTCTCCTTCAATAT
CCCTCCTTTCGCCACGATGTCATGCTTATGGATCAGGCACTGCAAGCGAGCAATGAGCCCCCGTCGTGGACTCTG
CAAGGTTGGCAAAGCGTCTTGTTTGCACTGTACCGTGAACACGAGAGCTGATATATTTTGGGCCAGAAATGCTGT
GCGCCGATTATATCGGGCATCTAATTAACAAATCTGAGTATTCGCAGCCTCTGTGCACTGCTCTCCAACTGGCAC
TTGTCAACTTTTACAAGAGATGTGGCATTGTTCCATTGTCTGTTGTTGGTCATTCTTCTGGTGAGATAGCTGCTG
CGTATGCTGCTGGGGCAATGTCACTCGAGGAAGCCATTTTGAATGCACATATACGTGGTCTTGCGACTGCTTTGC
AGGCGCGAAAAGGAGCCATGGCAGCAATCAGTTTGGGGCGAGCACAAGTAGTGCCCTTTATTGTCCAGGGCGTTG
AATTGGCCTGTGAGAATAGTCCACAGAGCGTCACTTTGTCTGGCGATCTGGACGCTTTGGAGCAGACTATACAAG
CCATCGCGGAAAAGTTACCCGCCACATATGTTCGGAAGCTGCATGTCGAAACTGCCTATCACTCGGGTGAGCTGG
AACTCATTCTTCTTCATATTGATATGCAAATACTAATAATTACATGATTAGTGCACATGCAAGAAATCGGCTCCG
TGTACGAGAATAGACTCAAACAGCGGATTTTGAATGGAAAAGGCCCGACCATACCCTTTTACTCAAGCGTGACGG
GCCAAAGGCATATAGCCAAGGCGAGCCTGGGACCGGCATACTGGAGAAACAACCTCGAGAAACCAGTTCTCTTCA
ACAAATCTATAAACTCTCTCTTGAGTAATCTCGAGCATGACCATGATATCATCTTTCTCGAGATTGGACCCCACG
CCACTCTCGAGGGCCCGCTGCGACAGATTTTACAGCAACGCAAAGACATAAACATTTCCTATGTGGCGTCTTTGT
GCAGGAATGAAGACTCGAGCACGTCACTGCTCACATCGTTAGGCCATTTGTACTCTTATGGCCACACGATTGATT
TTTCAGTTGTGAATCCACCAGCGTCGGTACTCACAAACCTGCCCCTATATCCATGGAGCCACACGCAGGAATATT
GGGAGGAAAGTCGCCTATCCATAGCTCAGCGACGGCGCAAGCACATCTACCACGAACTCCTGGGATGGCAAAGTC
CCGAAGCTGGCGATGCCCAGCCCATGTGGAGAAATGTTCTCCGTGTTAACAAGGTTGCTTGGCTCTGCGACCACA
AGGTTGGGAAAGAGATTTTGTTCCCTTGTGCAGGCTACATTGCCATGCTGGGCGAGGCTATCCGACAGGTGACGG
GCTCAGAGACATATACTCTGCGCAATCTCGTCCTCAAGTCAGCCATGGTGCTTGAAGAACGGGACGCGACCGAAA
TCATTACCACGATGCGGCCTTTGCGCTTGACGCATAGTTCAAACTCGCCATCGTGGTATGAATTCTGCGTTTCAT
CTTTTAATGGATCATCGTGGACGGAGAATTGCTTTACTCAAGGCAGAGCTGGTCATGACGAAGCGACCTGGCAGC
TTCCACAGATGCTTCTTGGGCCGTACCAGCGGAGAGTCGACGCCAAACACTGGTACAAACAGTTGCAACGTCTCG
GCATGGACTTTGGGCCGCACTTTCAGCAATTGACAGACATTACTGCTGACCCGGCCGACACAAAAGCAGCAGCCA
CTCTGTCTAGCCGCTTGGTCAGCCAGAGAGCCCACTACTCAGTTCACCCTACGGTTATTGATGGCTGTATCCAGC
TCTGTTATGCCGCTTCGATTGCAGGTGTAATTCGGCGCATGGAAAGGCTGGCCGTCCCCCAGATGGTGAGCCTTG
TGTATGTCGAGCCTGGCGAACCTGAATTTGTGGCACAAGCACGGGCAAAGCGCGCGAATCATGGCAAACTCACAG
TGTCGGCCAGTGTAGCTTCACTGAACAGCAACAAGGTTGTCGTCAGCCTCACAGATGTGGCGTGTGCTCCAATTG
ATGTGGGTCAAGCAAACGACGACAGTCTTCCCATGGCATCCCGCCTAGTCTGGCGTCCGCATATTGATCTTGTCG
ATGCTGCAACACTGGTCTTCAGGGTGCCGAGGCGAGAGGTAATGGAGGCAATAGAAAGACTGTGCATCCTTGGCA
TCTTGCAAGTTGCAGATATGTTGCCGCGACTGTCCCGGCCAACCGGACACTTGGCCAAGTATTCCGTCTGGATTC
AGCAACACAAAGAGGCCGCGGCACGAGGCGAGTGGGACTGGCTGACGGAAGATGTGCGCCAATGGTCTTGTTTGC
CTGACAAACAAAGATGCTCGCTCAGGGATGAATCCGCCAAGCAGGTAGAGCTTCTCATCAGCCCCCTAGTTGCTC
AGCTATGCTGCAGAATGAGCAACGAAGAGATAGTTAGAGGCCTCTTTGCCGGGACCATCAACCCCATTCAGATGA
TGATGGATCAAGCTCAACTGGCTGACTTCTACAAATTTTTTCATGACACGTTTGACTTGAAGGAACTTTTATTAT
TAATGACACATGCAACACCTTGCTTGAAAGTGCTGGAAATTGGCGCCGGAACCGGAGGGACAACAGAGAGTGTGC
TTGAAGCCCTTGCGCCTAAAGACGGCCCTCAACTCTATAGCAGCTACACCTTTACCGACATTTCTGCTGGCTTCT
TCCCCTCTGCCAAGGAGCGGTTCAAGGGCTACAAGGGTGTCAACTATCAGGCCTTGGATATTTCTCAAGATCCCA
TTCAGCAAGACTTCAAGCCAGCATGTTATGATTTGATTATTGCCAGCAATGTGCGTATCTTGCACCAAGCCAAGT
TTGGCAGACAGCTTACTCTACGGCCCTTTAGGTCTTTCATGCCACTCCTTCGCTTCAGCAGTCGCTGCAAAACGC
ACGGCTACTTCTCCGGCCAGGAGGTCGTCTAATCTTGCAAGAAATAATCGCACGTGAGCTTTTCCGTATATTTGA
GTGGCTTGAATAGGTTTGTGCGCTTTCTGATATTTAGCAACAGCGACGCGATGGCTATTTACCAGTTTCATCATG
GTACGTTGGTGTACATTTCATTTCTTCCCAACATGCTTTCTCTGCAGCAAGCATCTTGGCAGCAGCCAGCAAAGC
GTGTCATGAGAATACTCATCTTTGGCTAATCCTTGATGCCATGTGTCAGGGCTATCTCCCCGGTTGGTGGCTAGG
GGAGCAAGACGGACGTGTCGAGCAGCCGTTTGTCTCTCTAGAGCGTTGGGATATGGAGCTTCGAGAGGCAGGCTT
CACGTGTAATGATTCCGCTGTTCTAGATGACAACGAGCCATACCAGCATATAGCCAGCATCATTGCAACGGCTGC
GCACGCCACCAATCCTGACAGAAACGTGGCACTTGTTTACAAAGACAACAAGACCGACTTTGCCTTGCAAGTTGC
TCGCTGTCTTGAGAGCCAAGGATTCAATATGCAATGGGCTAGGCTTGACGACGCAAATGCCCCCACCAACCAGGA
TGTCATTTCCTTTGTCGACTTGGAGGGCCCCTTGTTTTATAATATATCAGAGGCCGATTTTGAGGCCTTCAAGAC
GTGGACTACGGGAATGCAGAGCCGCCCCATCCTATGGTTGACACAGTCTGCTCAAATTGGCTGCTCAGATCCGCG
CTACGGGACGACACTGGGCGTGGCCCGCAGCATTAGATACGAATTGACACCCAATTTTTGCACCCTGGAGCTTGA
CAAATTGGATTCTAAACAAGTGGATGCCACGGTTGAAGTTTTTAACAGGATCCGACAGCAATCTTCTTCCGACTT
CTACGATGCCGAGCAAGAATTTGCAGTCCATGACGGGCTTGTCCATGTTTGTCGCTTCGACTGGTTGCATTTGAG
GGACGAGCTCGAGACTGTCTCAAAAGATAATGAACCCAAGCGTCTGGCTATTGCTCAGCTAGGGCAGCTGGACTC
GCTGCGATGGGAGCGCTATACCATGGACGCTGACTCTGGGAGTCTGGCGGCAGATATGGTAGAAGTCGAGGTCCG
CTGCGTTGGATTGAACTTTAAAGTAGGACTTGACGAGACTTGAAAGGCGACGCCCCTTAGTGTCTACATTTACTG
ACATTGAAAAGGATGTGGCCTCAGCCAAAGGATTTTTGGATGAGGATAACCCGCGTTTTGGCTTCGAGGGCGCAG
GTGTCGTTGGTCGCATCGGTTCTCATATTGTTCACGTCAAACCAGGAGACCGCGTCCTCTTCATCTTCGACGGCA
CTTTCGCAGATCGTCTAGTGCTCCATCGAGACGTTGTGGTTCCGATGCCGCACAGTTTGAGCTTCCAGGAGGGAG
TCACCTTACCCGGGTGTTTTACCACAGCCATATACTCTCTGATGAATATTGGGCAGCTATCCAAGGGACAGGTGA
GAAGACATGATGAACCTGACTGGACTGAATCTAAAGAGCTGCACTATAGTCTGTCTTGATTCACTCAGCCTGTGG
TGGGTTTGGACTTGCCGCGATTCAGATTTGTCAAATGCTGGGAGCTGAGGTAAGTATCACTGAAAACAAGTGGCT
CTAGCCTCTAGTCACTAACTAGATGCAACGTCTGATAGATATACGCAACGGTCGGAAGTGAAGAAAAGGTGCAGT
ACCTTGTGAAAACCCAAGGAATCCCTCGAGAGAGAATATTCCACTCTCGGGATGCTAGTTTCTTAGCCGAAGTCA
TGCGAGCCACAGCTAATCGCGGCGTGGATGTTGTGCTCAACTCTCTCTCTGGAGACCTGCTTGATGCATCTTGGA
AATGCGTTGCCAAACAGGGCAAGATGATGGAGCTGGGCAAACGAGACCTCATAGGTCAAGGCCAAGTAGCCCTCG
AACAATTTCTAGGTAACCGGGCATACTGCGGCATCGATCTCATGGCTGTCTTGTATAAAGACGTTGGATCATTGG
CGAGGTAAGTGGTGGAGCGATTTGAGCGGCTTGCATCCTCTCACGAGTAGTACAGGATGTTGAAGCAGGCCATCG
ACTATTACAGCCAGGGAAAGATTAAGCCGCTGCCATATCGCGTCTTTGACTGTTGGAAAGTGTTGGATGCGTTTC
GATACATGCAGAAAGGGCAACACATTGGTAAGATTGTCGTCGACATGTCTTCAGCTAGCCAGCTGCCTGCCATGG
ACTGCATCTCGCAGCGGCCTCGGCTCTCGAGCCAGGCGACGTATCTTGTTGTCGGCGGCCTCGGGGGCGTGAGCA
AGGCGGTTGCAACGTGGGCCGTGGAAAACGGGGCTCGCAGCTTTGTCTTTTTGTCCCGGTCTGCAGGCAAGTCGG
TGGAGGATCAGAGCTTCCTCTTGGAGCTCGAGGCGCAGGGCTGCCGTGCCGTTGCTGTGCGTGGCAGCGTGGCCG
ACATGGCAGATGTTGAAAGAGCCGTCGAAGCGGCGCCGTCGCCCATAGCAGGTGTTTGGCAACTAGCCATGGTGC
TCAGGGTATGAAACCGACTTTACTTGTTGCCCCTGGAAATGGACTGCTAACGCGCCACTGTTTTCTGCTTGCAGG
ACAGCCCCTTGTTCAAGATGAGCCATGAAGAGTGGCTTGCCGCGCTGGCGCCCAAGGTTCAGGGCACCTGGAACC
TGCACAAGGCTTTCCTGCATGCCGACCTAGACTTTATGGTGCTTTTTGGCTCCGTTACTAGCCTGGGTGGGTCCA
TGGCGCAGACAAATTACTCGGCAGCCAATTCCTTTTTAGATGCTTTTGTGCAGTACCGCCATAGCCTCGGCCTGC
CGTGCAGCGTCATTGACTGCGGCCAGATCGACGGCATTGGCTATGTTCACGACCGACCTGCTCTGCGGGCCATCA
AAGGCCAACAAGACGTGGTGTTTTTGCACGAAGGTCAAGTGCTCGACGCGCTGCAAGTGTGCATGAACCGCTCCC
GGCCGTGCAAAATAGGCGGCGCGCCCAAGGGAGCCTATACCAGCTCGGGCCAGTTCGTTGTTGGCTTCCAATCCA
CCAGGGCGCTATCGGATGAGCAGAGCAGATTCTATTGGCGGCGCGACATTCGCATGGCCTCGTTCCATCAATACG
AGGCGGCCAATAACAAGAATAGTCGTGATCAGGGCACCAATAACTTCCTCGACTCGGTGGCGGCCAAGCCGCAAA
TGCTCCTTGAGCCGGACAGTTTGCGCTTTGTTTGCGACATGATTTCACGCGTCTTGTGCGGTTTCCTTCTGCATC
CGCCTGACCAGGTCAACACCAAGAGCAGCCTGGCGTCTATGGGCCTCGACTCCCTCGTCAGGGCGGAGTTTGTCC
TATGGTGGCGTAAAGCCTTTGGTGTCGATGTTAGTGCCTTTGCAATCGCGAATGCGGAGAATATTGAAAATTTGG
CACAGCTGGCGATGCGTCTGTTGCAGGAAAAGCATGGGGTTGCGCACAAGGAGCCACGTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail