Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7338
Gene name
LocationContig_78:21603..23199
Strand+
Gene length (bp)1596
Transcript length (bp)1596
Coding sequence length (bp)1596
Protein length (aa) 532

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06101 Vps62 Vacuolar protein sorting-associated protein 62 1.4E-10 320 383

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q06466|TDA6_YEAST Putative vacuolar protein sorting-associated protein TDA6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA6 PE=2 SV=1 124 516 1.0E-54
sp|P53285|VPS62_YEAST Vacuolar protein sorting-associated protein 62 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS62 PE=1 SV=1 93 513 2.0E-48

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7338
MTWLTRCSLALGLLGLFSLVALVLPSLLDPTAASPEKRLRDRLWINSSPYVVDRQLCRWLGLCGLQHLRQDPAAL
SENGGDGGDDSGGGNGAIADEVWGELRRRALKHPEPRASKQQRRRILKDVPDYVVKHAPLVHLYSGEEFWPSDIQ
EHLQHMEVQIDNAVYNDSTAWSLDNLAQLNRRRGSLSLHSRDDVESRPAWLHSRQNTPSDFPSHAGGHAHAPKLG
SADDAPAGGEPTTWFDVDKHHRLHRIVPPRSARKKPPGPAPGQPRVFGRGHKPDAAGYSRAPAVLVLVDKGSGIV
DAFWFFFYSYNLGQTVLGIRFGNHVGDWEHCMMRFEHGVPRGIYFSEHEGGQAYAWEAVEKRGQRPVIYSALGSH
AMYALPGNHAYILPFGLLKDVTDKGPLWDPALNNYAYHYDATRDHDAPQSHDINTDPLQGHDKHDWQRAEQHSHS
HSLTPAAKNPNAPTSWFHYRGHWGDELYLLADPRQWRLFGQYHYVTGPTGPKFKQLARSKLCRGTRCRILHRLDP
NGKWYS*
Coding >OphauB2|7338
ATGACGTGGCTGACGCGCTGCTCGCTGGCGCTGGGGCTGCTGGGCCTTTTCTCTCTGGTGGCACTGGTGCTGCCC
AGCTTGCTGGACCCCACGGCGGCGTCGCCCGAGAAGCGTCTGCGGGACCGCCTCTGGATCAACAGCAGCCCGTAC
GTTGTGGACCGGCAGCTTTGTCGCTGGCTTGGGCTGTGTGGCCTGCAGCATTTGCGGCAAGATCCTGCTGCGCTG
AGTGAGAATGGTGGTGATGGTGGTGATGATAGTGGTGGTGGTAATGGGGCTATTGCCGACGAGGTTTGGGGCGAG
CTGCGGCGACGCGCTCTCAAGCACCCTGAGCCTCGCGCAAGCAAGCAGCAGCGCCGCCGCATCCTCAAAGACGTG
CCCGACTATGTCGTCAAGCACGCGCCGCTGGTGCATCTCTACTCGGGCGAAGAGTTTTGGCCGTCGGACATACAA
GAGCATCTGCAGCACATGGAGGTGCAGATTGACAATGCCGTCTACAACGACAGCACGGCCTGGTCTCTGGACAAC
TTGGCGCAGCTCAACCGCCGCCGCGGCTCCCTCTCCCTGCACAGCCGCGACGACGTGGAGTCGCGGCCCGCCTGG
CTGCACAGCCGGCAAAACACTCCCAGTGATTTCCCCAGCCACGCCGGCGGCCACGCCCACGCGCCCAAGCTCGGC
TCTGCAGACGACGCCCCCGCAGGCGGCGAGCCCACCACCTGGTTCGACGTGGACAAGCACCACCGCCTGCACCGC
ATCGTGCCGCCGCGCAGCGCCCGCAAAAAGCCTCCCGGGCCTGCTCCCGGCCAGCCGCGCGTCTTTGGCCGCGGC
CACAAGCCAGACGCTGCCGGATACTCGCGCGCCCCCGCCGTCCTGGTGCTGGTGGACAAGGGCTCGGGCATTGTC
GACGCCTTTTGGTTCTTCTTTTACTCGTACAACCTGGGCCAGACCGTCCTTGGCATCCGCTTCGGCAACCACGTG
GGCGACTGGGAGCACTGCATGATGCGCTTTGAGCACGGCGTCCCCCGTGGCATTTACTTTTCCGAGCACGAGGGC
GGCCAGGCCTATGCCTGGGAGGCGGTGGAGAAGCGCGGCCAGCGGCCCGTCATCTACTCGGCCCTTGGCTCCCAC
GCCATGTACGCGCTGCCGGGCAACCACGCCTACATTCTCCCCTTTGGCCTGCTCAAGGACGTGACGGACAAGGGC
CCGCTCTGGGACCCCGCCCTCAACAACTATGCCTACCACTATGACGCCACGCGCGACCACGACGCTCCTCAAAGC
CACGACATCAACACCGACCCTCTGCAAGGCCACGACAAGCACGACTGGCAGCGCGCAGAGCAGCACAGCCACTCG
CACAGCCTCACTCCCGCCGCCAAGAACCCCAATGCCCCAACCTCGTGGTTCCACTACCGCGGCCACTGGGGCGAC
GAGCTCTACCTCCTTGCCGACCCGCGTCAGTGGCGCCTCTTTGGCCAGTACCACTACGTTACCGGCCCCACGGGC
CCCAAGTTCAAGCAGCTTGCCCGCTCAAAGCTCTGCCGAGGCACAAGGTGCCGCATCTTGCACCGGCTGGATCCC
AATGGCAAGTGGTACTCTTGA
Transcript >OphauB2|7338
ATGACGTGGCTGACGCGCTGCTCGCTGGCGCTGGGGCTGCTGGGCCTTTTCTCTCTGGTGGCACTGGTGCTGCCC
AGCTTGCTGGACCCCACGGCGGCGTCGCCCGAGAAGCGTCTGCGGGACCGCCTCTGGATCAACAGCAGCCCGTAC
GTTGTGGACCGGCAGCTTTGTCGCTGGCTTGGGCTGTGTGGCCTGCAGCATTTGCGGCAAGATCCTGCTGCGCTG
AGTGAGAATGGTGGTGATGGTGGTGATGATAGTGGTGGTGGTAATGGGGCTATTGCCGACGAGGTTTGGGGCGAG
CTGCGGCGACGCGCTCTCAAGCACCCTGAGCCTCGCGCAAGCAAGCAGCAGCGCCGCCGCATCCTCAAAGACGTG
CCCGACTATGTCGTCAAGCACGCGCCGCTGGTGCATCTCTACTCGGGCGAAGAGTTTTGGCCGTCGGACATACAA
GAGCATCTGCAGCACATGGAGGTGCAGATTGACAATGCCGTCTACAACGACAGCACGGCCTGGTCTCTGGACAAC
TTGGCGCAGCTCAACCGCCGCCGCGGCTCCCTCTCCCTGCACAGCCGCGACGACGTGGAGTCGCGGCCCGCCTGG
CTGCACAGCCGGCAAAACACTCCCAGTGATTTCCCCAGCCACGCCGGCGGCCACGCCCACGCGCCCAAGCTCGGC
TCTGCAGACGACGCCCCCGCAGGCGGCGAGCCCACCACCTGGTTCGACGTGGACAAGCACCACCGCCTGCACCGC
ATCGTGCCGCCGCGCAGCGCCCGCAAAAAGCCTCCCGGGCCTGCTCCCGGCCAGCCGCGCGTCTTTGGCCGCGGC
CACAAGCCAGACGCTGCCGGATACTCGCGCGCCCCCGCCGTCCTGGTGCTGGTGGACAAGGGCTCGGGCATTGTC
GACGCCTTTTGGTTCTTCTTTTACTCGTACAACCTGGGCCAGACCGTCCTTGGCATCCGCTTCGGCAACCACGTG
GGCGACTGGGAGCACTGCATGATGCGCTTTGAGCACGGCGTCCCCCGTGGCATTTACTTTTCCGAGCACGAGGGC
GGCCAGGCCTATGCCTGGGAGGCGGTGGAGAAGCGCGGCCAGCGGCCCGTCATCTACTCGGCCCTTGGCTCCCAC
GCCATGTACGCGCTGCCGGGCAACCACGCCTACATTCTCCCCTTTGGCCTGCTCAAGGACGTGACGGACAAGGGC
CCGCTCTGGGACCCCGCCCTCAACAACTATGCCTACCACTATGACGCCACGCGCGACCACGACGCTCCTCAAAGC
CACGACATCAACACCGACCCTCTGCAAGGCCACGACAAGCACGACTGGCAGCGCGCAGAGCAGCACAGCCACTCG
CACAGCCTCACTCCCGCCGCCAAGAACCCCAATGCCCCAACCTCGTGGTTCCACTACCGCGGCCACTGGGGCGAC
GAGCTCTACCTCCTTGCCGACCCGCGTCAGTGGCGCCTCTTTGGCCAGTACCACTACGTTACCGGCCCCACGGGC
CCCAAGTTCAAGCAGCTTGCCCGCTCAAAGCTCTGCCGAGGCACAAGGTGCCGCATCTTGCACCGGCTGGATCCC
AATGGCAAGTGGTACTCTTGA
Gene >OphauB2|7338
ATGACGTGGCTGACGCGCTGCTCGCTGGCGCTGGGGCTGCTGGGCCTTTTCTCTCTGGTGGCACTGGTGCTGCCC
AGCTTGCTGGACCCCACGGCGGCGTCGCCCGAGAAGCGTCTGCGGGACCGCCTCTGGATCAACAGCAGCCCGTAC
GTTGTGGACCGGCAGCTTTGTCGCTGGCTTGGGCTGTGTGGCCTGCAGCATTTGCGGCAAGATCCTGCTGCGCTG
AGTGAGAATGGTGGTGATGGTGGTGATGATAGTGGTGGTGGTAATGGGGCTATTGCCGACGAGGTTTGGGGCGAG
CTGCGGCGACGCGCTCTCAAGCACCCTGAGCCTCGCGCAAGCAAGCAGCAGCGCCGCCGCATCCTCAAAGACGTG
CCCGACTATGTCGTCAAGCACGCGCCGCTGGTGCATCTCTACTCGGGCGAAGAGTTTTGGCCGTCGGACATACAA
GAGCATCTGCAGCACATGGAGGTGCAGATTGACAATGCCGTCTACAACGACAGCACGGCCTGGTCTCTGGACAAC
TTGGCGCAGCTCAACCGCCGCCGCGGCTCCCTCTCCCTGCACAGCCGCGACGACGTGGAGTCGCGGCCCGCCTGG
CTGCACAGCCGGCAAAACACTCCCAGTGATTTCCCCAGCCACGCCGGCGGCCACGCCCACGCGCCCAAGCTCGGC
TCTGCAGACGACGCCCCCGCAGGCGGCGAGCCCACCACCTGGTTCGACGTGGACAAGCACCACCGCCTGCACCGC
ATCGTGCCGCCGCGCAGCGCCCGCAAAAAGCCTCCCGGGCCTGCTCCCGGCCAGCCGCGCGTCTTTGGCCGCGGC
CACAAGCCAGACGCTGCCGGATACTCGCGCGCCCCCGCCGTCCTGGTGCTGGTGGACAAGGGCTCGGGCATTGTC
GACGCCTTTTGGTTCTTCTTTTACTCGTACAACCTGGGCCAGACCGTCCTTGGCATCCGCTTCGGCAACCACGTG
GGCGACTGGGAGCACTGCATGATGCGCTTTGAGCACGGCGTCCCCCGTGGCATTTACTTTTCCGAGCACGAGGGC
GGCCAGGCCTATGCCTGGGAGGCGGTGGAGAAGCGCGGCCAGCGGCCCGTCATCTACTCGGCCCTTGGCTCCCAC
GCCATGTACGCGCTGCCGGGCAACCACGCCTACATTCTCCCCTTTGGCCTGCTCAAGGACGTGACGGACAAGGGC
CCGCTCTGGGACCCCGCCCTCAACAACTATGCCTACCACTATGACGCCACGCGCGACCACGACGCTCCTCAAAGC
CACGACATCAACACCGACCCTCTGCAAGGCCACGACAAGCACGACTGGCAGCGCGCAGAGCAGCACAGCCACTCG
CACAGCCTCACTCCCGCCGCCAAGAACCCCAATGCCCCAACCTCGTGGTTCCACTACCGCGGCCACTGGGGCGAC
GAGCTCTACCTCCTTGCCGACCCGCGTCAGTGGCGCCTCTTTGGCCAGTACCACTACGTTACCGGCCCCACGGGC
CCCAAGTTCAAGCAGCTTGCCCGCTCAAAGCTCTGCCGAGGCACAAGGTGCCGCATCTTGCACCGGCTGGATCCC
AATGGCAAGTGGTACTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail